F454095

General Info

Members Datasets Scaffolds Average Seq Length
491 262 425 548

Family's Representative Sequence

Representative Sequence 3300013100|Ga0157373_10000005|Ga0157373_10000005217
Length 578
Sequence VIFLEQHLYERKICRTILKRIFAHFALKKQIKMINLILKINHKDNVLVALQDIPAETEIIFEGVTYTTLEAIPAKHKFFMNDMKQGDEIFMYGVLVGKVQYDLAAGTRMTTDNTKHAAEPYYYRDVDYHWTKPDVSRFLHKTFKGYHRSNGDVGTANYWLFIPTVFCENRNLDIIKESLYDNLGYAVDAKYKDYTHQLVEAISKGENIDDLNFSPSNIPAKERVFKNVDGIKFLNHTGGCGGTRQDADTLSKLLASYADHPNVAGVTLLSLGCQHLQIDNFKKDLYNRNPDFDKPLLVFEQQKAVSEETMIKNAIFETLKGLLEINKIEREDAPISKLCVGVKCGGSDGFSGISANPAVGHLADILSVLGAKVLLAEFPELCGVEQELIDRAVDKPTAEKFIRLMTEYDELAHAVGSGFYMNPSPGNIKDGLITDAIKSAGAAKKGGSAPVVDVLDYTEPATKPGLSLVCTPGNDVEATTGKAASGATLILFTTGLGTPTGNPVCPVMKVATNTILATKMSDIIDIDTGAVVRGEKTIQEMGEDILDFCIDVASGNIIPKAVALNQDDFIPWKRGVSL

Samples

Sample ID Description Type Environment
1 2519899754 Flavobacterium sp. F52 Isolate Rhizosphere
2 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
3 2585428061 Chryseobacterium sp. CF356 Isolate Rhizosphere
4 2585428095 Chryseobacterium sp. YR005 Isolate Rhizosphere
5 2585428115 Chryseobacterium sp. YR561 Isolate Rhizosphere
6 2585428187 Chryseobacterium sp. YR460 Isolate Rhizosphere
7 2643221667 Flavobacterium sp. Root420 Isolate Unclassified
8 2643221725 Flavobacterium sp. Root935 Isolate Unclassified
9 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
10 2738541273 Elizabethkingia sp. YR214 Isolate Unclassified
11 2738541279 Flavobacterium sp. GV069 Isolate Unclassified
12 2738541283 Pedobacter sp. OK701 Isolate Unclassified
13 2738541284 Pedobacter sp. YR016 Isolate Unclassified
14 2738541285 Flavobacterium sp. GV030 Isolate Unclassified
15 2738541302 Pedobacter sp. CF074 Isolate Unclassified
16 2738543007 Flavobacterium sp. GV063 Isolate Unclassified
17 2738543014 Elizabethkingia sp. YR191 Isolate Unclassified
18 2738543023 Pedobacter sp. OK628 Isolate Unclassified
19 2739367651 Pedobacter sp. OK291 Isolate Unclassified
20 2739367656 Pedobacter sp. CF523 Isolate Unclassified
21 2739367663 Pedobacter sp. YR510 Isolate Unclassified
22 2775506739 Chryseobacterium sp. 1335 Isolate Unclassified
23 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
24 2802428842 Flavobacterium sp. S87F.05.LMB.W.Kidney.N Isolate Unclassified
25 2816332280 Flavobacterium johnsoniae GSE09 Isolate Unclassified
26 2818991437 Pedobacter terrae 518 Isolate Unclassified
27 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
28 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
29 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
30 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
31 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
32 2881359912 Flavobacterium ustbae T13 Isolate Rhizosphere
33 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
34 2896344016 Sphingobacterium sp. SGL-16 Isolate Rhizosphere
35 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
36 2903895155 Flavobacterium sp. HBTb2-11-1 Isolate Rhizosphere
37 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
38 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere
39 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
40 2914759650 Rhizosphaericola mali Isolate Rhizosphere
41 2919097161 Chryseobacterium ginsenosidimutans 1394 Isolate Rhizosphere
42 2919177583 Sphingobacterium sp. 2149 Isolate Rhizosphere
43 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
44 2929150217 Flavobacterium sp. R-74510 Hybrid assembly Isolate Unclassified
45 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
46 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
47 2945924605 Chryseobacterium ginsenosidimutans W1I9 Isolate Rhizosphere
48 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
49 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
50 2958458903 Flavobacterium anhuiense RCM74 Isolate Rhizosphere
51 2958512119 Flavobacterium sp. Sd200 Isolate Rhizosphere
52 2977268062 Flavobacterium sp. SORGH_AS 622 Isolate Unclassified
53 3003233435 Sphingobacterium shayense CrR18 Isolate Unclassified
54 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
55 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
56 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
57 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
58 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
59 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
60 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
61 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
62 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
63 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
64 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
65 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
66 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
67 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
68 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
69 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
70 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
71 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
72 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
73 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
74 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
75 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
76 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
77 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
78 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
79 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
80 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
81 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
82 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
83 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
84 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
85 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
86 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
87 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
88 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
89 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
90 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
91 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
92 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
93 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
94 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
95 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
96 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
97 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
98 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
99 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
100 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
101 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
102 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
103 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
104 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
105 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
106 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
107 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
108 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
109 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
110 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
111 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
112 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
113 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
114 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
115 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
116 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
117 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
118 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
119 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
120 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
121 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
122 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
123 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
124 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
125 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
126 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
127 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
128 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
129 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
130 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
131 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
132 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
133 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
134 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
135 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
136 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
137 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
138 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
139 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
140 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
141 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
142 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
143 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
144 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
145 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
146 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
147 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
148 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
149 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
151 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
152 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
153 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
187 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
188 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
191 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
192 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
193 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
194 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
195 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
196 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
197 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
198 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
199 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
200 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
201 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
202 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
203 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
204 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
205 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
206 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
207 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
208 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
209 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
210 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
211 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
212 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
213 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
214 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
215 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
216 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
217 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
218 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
219 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
220 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
221 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
222 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
223 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
224 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
225 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
226 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
227 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
228 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
229 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
230 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
231 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
232 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
233 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
234 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
235 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
236 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
237 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
238 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
239 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
240 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
244 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
245 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
246 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
247 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
248 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
249 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
250 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
251 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
252 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
253 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
254 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
255 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
256 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
257 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
258 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
259 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
260 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
261 8055419101 Flavobacterium tyrosinilyticum KCTC 42726 Isolate Rhizosphere
262 8055592153 Flavobacterium panacis DCY106 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 86.56
Metatranscriptomes 0
Isolates 13.44

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.54
Nodule 1.02
Rhizoplane 0.41
Rhizosphere 81.26
Stem 0
Stem Tuber 0
Unclassified 9.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24751J29686_10002780 3300002459 Bacteria 3519
2 JGI25152J39213_1000080 3300002773 Bacteria 65432
3 JGI25152J39213_1000173 3300002773 Bacteria 43619
4 JGI25150J39212_1000003 3300002774 Bacteria 508651
5 JGI25150J39212_1000004 3300002774 Bacteria 417320
6 JGI25150J39212_1000015 3300002774 Bacteria 170613
7 JGI25151J46595_10000002 3300003187 Bacteria 731381
8 JGI25151J46595_10000043 3300003187 Bacteria 170613
9 JGI25153J46596_10000009 3300003215 Bacteria 340925
10 JGI25153J46596_10000015 3300003215 Bacteria 289820
11 Ga0055536_1000001 3300003781 Bacteria 630663
12 Ga0055536_1000002 3300003781 Bacteria 605605
13 Ga0055530_10001525 3300003791 Bacteria 16697
14 Ga0065714_10002204 3300005288 Bacteria 57902
15 Ga0065714_10002251 3300005288 Bacteria 34173
16 Ga0065714_10002553 3300005288 Bacteria 19114
17 Ga0065714_10004810 3300005288 Bacteria 6804
18 Ga0065714_10005601 3300005288 Bacteria 3769
19 Ga0065714_10006902 3300005288 Bacteria 3689
20 Ga0065714_10015106 3300005288 Bacteria 5772
21 Ga0065714_10082581 3300005288 Bacteria 2233
22 Ga0065704_10072354 3300005289 Bacteria 8680
23 Ga0065712_10003936 3300005290 Bacteria 3448
24 Ga0065715_10020339 3300005293 Bacteria 2593
25 Ga0065707_10131200 3300005295 Bacteria 1917
26 Ga0070658_10046148 3300005327 Bacteria 3526
27 Ga0070676_10015781 3300005328 Bacteria 4166
28 Ga0070683_100001724 3300005329 Bacteria 17005
29 Ga0070683_100096635 3300005329 Bacteria 2779
30 Ga0070690_100017022 3300005330 Bacteria 4364
31 Ga0070670_100085030 3300005331 Bacteria 2718
32 Ga0070670_100119595 3300005331 Bacteria 2272
33 Ga0068869_100001942 3300005334 Bacteria 12403
34 Ga0068869_100028571 3300005334 Bacteria 3899
35 Ga0068869_100053108 3300005334 Bacteria 2944
36 Ga0068869_100069306 3300005334 Bacteria 2607
37 Ga0068869_100126054 3300005334 Bacteria 1963
38 Ga0070666_10000696 3300005335 Bacteria 20362
39 Ga0070682_100000109 3300005337 Bacteria 73659
40 Ga0068868_100004734 3300005338 Bacteria 9556
41 Ga0070660_100001082 3300005339 Bacteria 18309
42 Ga0070689_100011094 3300005340 Bacteria 6446
43 Ga0070689_100031128 3300005340 Bacteria 4054
44 Ga0070689_100042753 3300005340 Bacteria 3480
45 Ga0070661_100003878 3300005344 Bacteria 10295
46 Ga0070661_100032497 3300005344 Bacteria 3778
47 Ga0070675_100018724 3300005354 Bacteria 5512
48 Ga0070671_100031632 3300005355 Bacteria 4372
49 Ga0070674_100013974 3300005356 Bacteria 4980
50 Ga0070673_100004392 3300005364 Bacteria 8912
51 Ga0070673_100005637 3300005364 Bacteria 8036
52 Ga0070673_100025696 3300005364 Bacteria 4339
53 Ga0070673_100113710 3300005364 Bacteria 2248
54 Ga0070659_100005067 3300005366 Bacteria 9446
55 Ga0070659_100007295 3300005366 Bacteria 8025
56 Ga0070667_100013413 3300005367 Bacteria 6774
57 Ga0070667_100032955 3300005367 Bacteria 4324
58 Ga0070667_100057511 3300005367 Bacteria 3287
59 Ga0070667_100081014 3300005367 Bacteria 2777
60 Ga0070713_100093706 3300005436 Bacteria 2588
61 Ga0070678_100077865 3300005456 Bacteria 2502
62 Ga0070662_100008428 3300005457 Bacteria 6720
63 Ga0070662_100022494 3300005457 Bacteria 4318
64 Ga0070662_100066034 3300005457 Bacteria 2654
65 Ga0070681_10234334 3300005458 Bacteria 1750
66 Ga0068867_100012501 3300005459 Bacteria 6008
67 Ga0068867_100016386 3300005459 Bacteria 5261
68 Ga0070685_10019145 3300005466 Bacteria 3691
69 Ga0070685_10059655 3300005466 Bacteria 2228
70 Ga0070698_100004841 3300005471 Bacteria 14779
71 Ga0070698_100005154 3300005471 Bacteria 14294
72 Ga0070698_100006108 3300005471 Bacteria 13114
73 Ga0070698_100022314 3300005471 Bacteria 6622
74 Ga0070698_100070417 3300005471 Bacteria 3510
75 Ga0070699_100097249 3300005518 Bacteria 2579
76 Ga0070679_100046381 3300005530 Bacteria 4331
77 Ga0070684_100000417 3300005535 Bacteria 29183
78 Ga0070684_100014019 3300005535 Bacteria 6481
79 Ga0070684_100034633 3300005535 Bacteria 4318
80 Ga0068853_100040143 3300005539 Bacteria 3992
81 Ga0068853_100180196 3300005539 Bacteria 1916
82 Ga0070686_100020608 3300005544 Bacteria 3904
83 Ga0070665_100022051 3300005548 Bacteria 6407
84 Ga0070704_100032638 3300005549 Bacteria 3514
85 Ga0068855_100019915 3300005563 Bacteria 8057
86 Ga0070664_100000360 3300005564 Bacteria 33570
87 Ga0070664_100012371 3300005564 Bacteria 6935
88 Ga0070664_100018647 3300005564 Bacteria 5705
89 Ga0070664_100062016 3300005564 Bacteria 3187
90 Ga0068857_100044096 3300005577 Bacteria 3955
91 Ga0068859_100000098 3300005617 Bacteria 80555
92 Ga0068859_100000285 3300005617 Bacteria 50405
93 Ga0068859_100013654 3300005617 Bacteria 8143
94 Ga0068861_100011359 3300005719 Bacteria 6186
95 Ga0068861_100015969 3300005719 Bacteria 5302
96 Ga0068861_100092712 3300005719 Bacteria 2386
97 Ga0068861_100101180 3300005719 Bacteria 2292
98 Ga0068851_10051166 3300005834 Bacteria 2099
99 Ga0068863_100001430 3300005841 Bacteria 23658
100 Ga0068863_100005978 3300005841 Bacteria 11939
101 Ga0068863_100017784 3300005841 Bacteria 6803
102 Ga0068863_100056220 3300005841 Bacteria 3726
103 Ga0068860_100003920 3300005843 Bacteria 15287
104 Ga0068860_100100682 3300005843 Bacteria 2757
105 Ga0068862_100026893 3300005844 Bacteria 4838
106 Ga0075366_10013752 3300006195 Bacteria 4612
107 Ga0097621_100001501 3300006237 Bacteria 15978
108 Ga0097621_100052525 3300006237 Unclassified 3321
109 Ga0097621_100121898 3300006237 Bacteria 2212
110 Ga0068871_100004024 3300006358 Bacteria 10153
111 Ga0068871_100018358 3300006358 Bacteria 5314
112 Ga0068871_100035985 3300006358 Bacteria 3938
113 Ga0068871_100088297 3300006358 Bacteria 2579
114 Ga0075428_100018917 3300006844 Bacteria 7617
115 Ga0075428_100023631 3300006844 Bacteria 6804
116 Ga0075428_100030907 3300006844 Bacteria 5922
117 Ga0075428_100036418 3300006844 Bacteria 5419
118 Ga0075430_100009461 3300006846 Bacteria 8235
119 Ga0075430_100013447 3300006846 Bacteria 6977
120 Ga0075431_100024790 3300006847 Bacteria 6149
121 Ga0075431_100027720 3300006847 Bacteria 5814
122 Ga0075434_100253555 3300006871 Bacteria 1778
123 Ga0075429_100000557 3300006880 Bacteria 28537
124 Ga0068865_100001792 3300006881 Bacteria 12609
125 Ga0097620_100000098 3300006931 Bacteria 80555
126 Ga0097620_100000285 3300006931 Bacteria 50405
127 Ga0097620_100013654 3300006931 Bacteria 8143
128 Ga0099824_1004036 3300006942 Bacteria 21249
129 Ga0079104_1000079 3300006946 Bacteria 141480
130 Ga0099826_10026672 3300006948 Bacteria 4257
131 Ga0105251_10035098 3300009011 Bacteria 2476
132 Ga0105240_10068320 3300009093 Bacteria 4402
133 Ga0111539_10004863 3300009094 Bacteria 17500
134 Ga0114129_10004260 3300009147 Bacteria 20220
135 Ga0114129_10247196 3300009147 Bacteria 2396
136 Ga0105241_10006435 3300009174 Bacteria 8656
137 Ga0105241_10102000 3300009174 Bacteria 2283
138 Ga0105242_10115112 3300009176 Bacteria 2299
139 Ga0105237_10003809 3300009545 Bacteria 17731
140 Ga0105237_10011376 3300009545 Bacteria 9413
141 Ga0105249_10001120 3300009553 Bacteria 23848
142 Ga0105249_10001157 3300009553 Bacteria 23330
143 Ga0105249_10001277 3300009553 Bacteria 22079
144 Ga0105249_10021242 3300009553 Bacteria 5813
145 Ga0105249_10021677 3300009553 Bacteria 5752
146 Ga0105249_10062412 3300009553 Bacteria 3422
147 Ga0105239_10064256 3300010375 Bacteria 4029
148 Ga0105239_10275530 3300010375 Bacteria 1893
149 Ga0157373_10000005 3300013100 Bacteria 262158
150 Ga0157373_10000035 3300013100 Bacteria 123284
151 Ga0157373_10003444 3300013100 Bacteria 11972
152 Ga0157373_10008374 3300013100 Bacteria 7681
153 Ga0157373_10045547 3300013100 Bacteria 3131
154 Ga0157371_10000021 3300013102 Bacteria 301017
155 Ga0157371_10000025 3300013102 Bacteria 279746
156 Ga0157371_10001207 3300013102 Bacteria 27564
157 Ga0157371_10006892 3300013102 Bacteria 9275
158 Ga0157371_10007560 3300013102 Bacteria 8777
159 Ga0157370_10000383 3300013104 Bacteria 55670
160 Ga0157370_10001800 3300013104 Bacteria 26427
161 Ga0157370_10003591 3300013104 Bacteria 18145
162 Ga0157370_10015356 3300013104 Bacteria 7784
163 Ga0157370_10024060 3300013104 Bacteria 6038
164 Ga0157370_10037772 3300013104 Bacteria 4677
165 Ga0157370_10052091 3300013104 Bacteria 3908
166 Ga0157370_10067718 3300013104 Bacteria 3375
167 Ga0157370_10155103 3300013104 Bacteria 2130
168 Ga0157370_10181478 3300013104 Bacteria 1956
169 Ga0157369_10000008 3300013105 Bacteria 309315
170 Ga0157369_10000038 3300013105 Bacteria 189078
171 Ga0157369_10039587 3300013105 Bacteria 5151
172 Ga0157369_10150971 3300013105 Bacteria 2455
173 Ga0157369_10240920 3300013105 Bacteria 1889
174 Ga0157374_10007311 3300013296 Bacteria 9415
175 Ga0157374_10017645 3300013296 Bacteria 6288
176 Ga0157378_10026991 3300013297 Bacteria 5065
177 Ga0157378_10037267 3300013297 Bacteria 4306
178 Ga0157378_10071514 3300013297 Bacteria 3115
179 Ga0157378_10094244 3300013297 Bacteria 2726
180 Ga0163162_10000050 3300013306 Bacteria 120151
181 Ga0163162_10000155 3300013306 Bacteria 63251
182 Ga0163162_10006015 3300013306 Bacteria 11744
183 Ga0157372_10032190 3300013307 Bacteria 5747
184 Ga0157372_10047069 3300013307 Bacteria 4790
185 Ga0157375_10002645 3300013308 Bacteria 15517
186 Ga0157375_10004308 3300013308 Bacteria 12343
187 Ga0157375_10016379 3300013308 Bacteria 6657
188 Ga0163163_10003073 3300014325 Bacteria 14131
189 Ga0163163_10006182 3300014325 Bacteria 10440
190 Ga0157380_10009601 3300014326 Bacteria 6941
191 Ga0157380_10096760 3300014326 Unclassified 2448
192 Ga0157380_10187997 3300014326 Bacteria 1821
193 Ga0182008_10000020 3300014497 Bacteria 228333
194 Ga0182008_10000037 3300014497 Bacteria 129884
195 Ga0182008_10000309 3300014497 Bacteria 38347
196 Ga0182008_10000603 3300014497 Bacteria 26394
197 Ga0182008_10003307 3300014497 Bacteria 9801
198 Ga0182008_10012375 3300014497 Bacteria 4504
199 Ga0182008_10050715 3300014497 Bacteria 2060
200 Ga0157379_10015571 3300014968 Bacteria 6676
201 Ga0157379_10193420 3300014968 Bacteria 1838
202 Ga0157376_10001928 3300014969 Bacteria 13861
203 Ga0157376_10002899 3300014969 Bacteria 11760
204 Ga0157376_10008614 3300014969 Bacteria 7373
205 Ga0157376_10031148 3300014969 Unclassified 4267
206 Ga0157376_10041397 3300014969 Bacteria 3771
207 Ga0157376_10074721 3300014969 Bacteria 2890
208 Ga0182006_1000109 3300015261 Bacteria 89541
209 Ga0182006_1000127 3300015261 Bacteria 81679
210 Ga0182006_1000227 3300015261 Bacteria 53817
211 Ga0182006_1000888 3300015261 Bacteria 20046
212 Ga0182006_1001210 3300015261 Bacteria 16125
213 Ga0182006_1002244 3300015261 Bacteria 10677
214 Ga0182006_1009706 3300015261 Bacteria 4305
215 Ga0182007_10000003 3300015262 Bacteria 548244
216 Ga0182007_10000024 3300015262 Bacteria 181761
217 Ga0182007_10002394 3300015262 Bacteria 9379
218 Ga0183373_1001 3300015682 Bacteria 1410374
219 Ga0183373_1002 3300015682 Bacteria 990153
220 Ga0163161_10000136 3300017792 Bacteria 69043
221 Ga0163161_10000470 3300017792 Bacteria 33480
222 Ga0163161_10000815 3300017792 Bacteria 24459
223 Ga0163161_10001151 3300017792 Bacteria 19912
224 Ga0163161_10001518 3300017792 Bacteria 17178
225 Ga0163161_10010250 3300017792 Bacteria 6489
226 Ga0163161_10035915 3300017792 Bacteria 3548
227 Ga0163161_10096055 3300017792 Bacteria 2199
228 Ga0207425_1000003 3300025245 Bacteria 1145342
229 Ga0207425_1000023 3300025245 Bacteria 341339
230 Ga0209129_1000014 3300025258 Bacteria 509018
231 Ga0209129_1000032 3300025258 Bacteria 341150
232 Ga0209676_1000008 3300025292 Bacteria 991778
233 Ga0209676_1000022 3300025292 Bacteria 605659
234 Ga0209025_1000007 3300025294 Bacteria 1145109
235 Ga0209025_1000047 3300025294 Bacteria 341150
236 Ga0209758_1000012 3300025297 Bacteria 949866
237 Ga0209758_1000144 3300025297 Bacteria 170724
238 Ga0209050_1000020 3300025298 Bacteria 605671
239 Ga0209050_1000343 3300025298 Bacteria 92045
240 Ga0207680_10000120 3300025903 Bacteria 36545
241 Ga0207680_10073094 3300025903 Bacteria 2131
242 Ga0207647_10022367 3300025904 Bacteria 4200
243 Ga0207645_10000334 3300025907 Bacteria 39321
244 Ga0207645_10028538 3300025907 Bacteria 3602
245 Ga0207654_10001306 3300025911 Bacteria 13282
246 Ga0207671_10001247 3300025914 Bacteria 29996
247 Ga0207671_10016536 3300025914 Bacteria 5729
248 Ga0207657_10001634 3300025919 Bacteria 24147
249 Ga0207649_10078781 3300025920 Bacteria 2127
250 Ga0207650_10030282 3300025925 Bacteria 3897
251 Ga0207650_10047930 3300025925 Bacteria 3150
252 Ga0207650_10061601 3300025925 Bacteria 2801
253 Ga0207650_10083152 3300025925 Bacteria 2431
254 Ga0207644_10034862 3300025931 Bacteria 3523
255 Ga0207644_10151665 3300025931 Bacteria 1794
256 Ga0207690_10003665 3300025932 Bacteria 9145
257 Ga0207706_10006057 3300025933 Bacteria 11244
258 Ga0207706_10020425 3300025933 Bacteria 5955
259 Ga0207686_10000405 3300025934 Bacteria 29880
260 Ga0207686_10005263 3300025934 Bacteria 6943
261 Ga0207670_10044244 3300025936 Bacteria 2945
262 Ga0207670_10111807 3300025936 Bacteria 1970
263 Ga0207669_10043503 3300025937 Bacteria 2631
264 Ga0207691_10065090 3300025940 Bacteria 3301
265 Ga0207691_10109635 3300025940 Bacteria 2456
266 Ga0207689_10003219 3300025942 Bacteria 14956
267 Ga0207689_10005450 3300025942 Bacteria 11387
268 Ga0207689_10012712 3300025942 Bacteria 7192
269 Ga0207689_10019387 3300025942 Bacteria 5734
270 Ga0207689_10046567 3300025942 Bacteria 3584
271 Ga0207689_10096391 3300025942 Bacteria 2429
272 Ga0207661_10048895 3300025944 Bacteria 3363
273 Ga0207661_10078337 3300025944 Bacteria 2720
274 Ga0207679_10007831 3300025945 Bacteria 6789
275 Ga0207679_10064690 3300025945 Bacteria 2734
276 Ga0207667_10010203 3300025949 Bacteria 11001
277 Ga0207651_10023979 3300025960 Bacteria 3765
278 Ga0207651_10040522 3300025960 Bacteria 3082
279 Ga0207651_10043655 3300025960 Bacteria 2994
280 Ga0207651_10151296 3300025960 Bacteria 1807
281 Ga0207712_10000821 3300025961 Bacteria 22848
282 Ga0207712_10004491 3300025961 Bacteria 8811
283 Ga0207712_10007724 3300025961 Bacteria 6802
284 Ga0207712_10016604 3300025961 Bacteria 4772
285 Ga0207712_10082854 3300025961 Unclassified 2339
286 Ga0207640_10054545 3300025981 Bacteria 2614
287 Ga0207658_10026332 3300025986 Bacteria 4077
288 Ga0207658_10075616 3300025986 Bacteria 2563
289 Ga0207703_10100305 3300026035 Bacteria 2453
290 Ga0207703_10208091 3300026035 Bacteria 1742
291 Ga0207639_10006556 3300026041 Bacteria 7914
292 Ga0207639_10103832 3300026041 Bacteria 2303
293 Ga0207639_10167908 3300026041 Bacteria 1855
294 Ga0207678_10099642 3300026067 Bacteria 2482
295 Ga0207641_10001054 3300026088 Bacteria 27824
296 Ga0207641_10001908 3300026088 Bacteria 20026
297 Ga0207641_10021870 3300026088 Bacteria 5258
298 Ga0207641_10063206 3300026088 Bacteria 3162
299 Ga0207641_10093210 3300026088 Bacteria 2639
300 Ga0207641_10180517 3300026088 Bacteria 1933
301 Ga0207648_10004255 3300026089 Bacteria 14783
302 Ga0207648_10036523 3300026089 Bacteria 4328
303 Ga0207648_10062347 3300026089 Bacteria 3250
304 Ga0207676_10004127 3300026095 Bacteria 10254
305 Ga0207676_10012612 3300026095 Bacteria 6062
306 Ga0207676_10035567 3300026095 Bacteria 3782
307 Ga0207674_10045060 3300026116 Bacteria 4540
308 Ga0207674_10062516 3300026116 Bacteria 3761
309 Ga0207675_100002484 3300026118 Bacteria 18257
310 Ga0207675_100029305 3300026118 Bacteria 5129
311 Ga0207675_100069416 3300026118 Bacteria 3294
312 Ga0207675_100121459 3300026118 Bacteria 2472
313 Ga0207683_10031001 3300026121 Bacteria 4639
314 Ga0207698_10024279 3300026142 Bacteria 4252
315 Ga0209281_1000367 3300027111 Bacteria 73152
316 Ga0209489_111689 3300027361 Bacteria 8728
317 Ga0268266_10131878 3300028379 Bacteria 2236
318 Ga0268264_10009194 3300028381 Bacteria 8187
319 Ga0268264_10080005 3300028381 Bacteria 2790
320 Ga0268264_10139747 3300028381 Bacteria 2158
321 Ga0307515_10000001 3300028794 Bacteria 4259510
322 Ga0307515_10000002 3300028794 Bacteria 1231751
323 Ga0307515_10001521 3300028794 Bacteria 51888
324 Ga0307515_10053353 3300028794 Bacteria 5968
325 Ga0316181_1190315 3300030744 Bacteria 3579
326 Ga0265327_10000488 3300031251 Bacteria 69809
327 Ga0307509_10045625 3300031507 Bacteria 4724
328 Ga0307509_10068760 3300031507 Bacteria 3705
329 Ga0307508_10001227 3300031616 Bacteria 29288
330 Ga0307405_10000008 3300031731 Bacteria 264953
331 Ga0307405_10000011 3300031731 Bacteria 241071
332 Ga0307407_10000018 3300031903 Bacteria 135979
333 Ga0307407_10000026 3300031903 Bacteria 108029
334 Ga0307412_10000001 3300031911 Bacteria 822691
335 Ga0307412_10000283 3300031911 Bacteria 32305
336 Ga0307412_10004974 3300031911 Bacteria 7428
337 Ga0307409_100001787 3300031995 Bacteria 10863
338 Ga0307416_100000053 3300032002 Bacteria 108029
339 Ga0307416_100000066 3300032002 Bacteria 94549
340 Ga0307416_100000081 3300032002 Bacteria 65986
341 Ga0307414_10000046 3300032004 Bacteria 133496
342 Ga0307414_10000474 3300032004 Bacteria 21053
343 Ga0307414_10000947 3300032004 Bacteria 14835
344 Ga0307414_10002029 3300032004 Bacteria 10513
345 Ga0307414_10003034 3300032004 Bacteria 8901
346 Ga0307414_10012708 3300032004 Bacteria 4991
347 Ga0307414_10014405 3300032004 Bacteria 4740
348 Ga0307411_10056560 3300032005 Bacteria 2586
349 Ga0373924_0010001 3300035410 Bacteria 3491
350 Ga0373937_0032091 3300036401 Bacteria 4762
351 Ga0395900_0012957 3300037418 Bacteria 8520
352 Ga0395905_0002019 3300037471 Bacteria 23194
353 Ga0395905_0098703 3300037471 Bacteria 2743
354 Ga0439439_0006352 3300041406 Bacteria 2733
355 Ga0439439_0007265 3300041406 Bacteria 2587
356 Ga0439465_0000153 3300041413 Bacteria 17071
357 Ga0451853_0006869 3300041512 Bacteria 2965
358 Ga0451853_3749989 3300041512 Unclassified 4943
359 Ga0451577_0122689 3300042876 Bacteria 2327
360 Ga0466969_0000151 3300044656 Bacteria 37632
361 Ga0466966_0000113 3300044684 Bacteria 49984
362 Ga0453684_0077574 3300044712 Bacteria 4162
363 Ga0453684_0144202 3300044712 Bacteria 2839
364 Ga0466959_0000015 3300045049 Bacteria 149242
365 Ga0495627_000002 3300046453 Bacteria 903861
366 Ga0495606_0006357 3300046507 Bacteria 10922
367 Ga0495606_0028372 3300046507 Bacteria 3949
368 Ga0495610_0000037 3300046512 Bacteria 186354
369 Ga0495610_0000049 3300046512 Bacteria 149009
370 Ga0495610_0000747 3300046512 Bacteria 30695
371 Ga0495610_0001062 3300046512 Bacteria 25264
372 Ga0495616_0014695 3300046513 Bacteria 4375
373 Ga0495628_0021869 3300046516 Bacteria 5257
374 Ga0495630_0036974 3300046517 Bacteria 3650
375 Ga0495632_0005245 3300046519 Bacteria 8619
376 Ga0495643_0001223 3300046522 Bacteria 24830
377 Ga0495654_0000056 3300046530 Bacteria 140658
378 Ga0495609_0000025 3300046538 Bacteria 256898
379 Ga0495633_0000562 3300046558 Bacteria 36317
380 Ga0495633_0015264 3300046558 Bacteria 3989
381 Ga0495668_0001808 3300046616 Bacteria 19480
382 Ga0495634_0041482 3300046642 Bacteria 3125
383 Ga0495625_0002377 3300046660 Bacteria 20476
384 Ga0495625_0043937 3300046660 Bacteria 3237
385 Ga0495657_0092337 3300046675 Bacteria 1940
386 Ga0495672_0027850 3300047320 Bacteria 3585
387 Ga0495686_0000386 3300047472 Bacteria 70225
388 Ga0495686_0001452 3300047472 Bacteria 25815
389 Ga0495686_0011295 3300047472 Bacteria 6296
390 Ga0496114_0091923 3300048917 Bacteria 2578
391 Ga0496115_0046659 3300048918 Bacteria 3464
392 Ga0496116_0001157 3300048919 Bacteria 31125
393 Ga0496117_0000980 3300048920 Bacteria 43732
394 Ga0496121_0009909 3300048924 Bacteria 10846
395 Ga0496122_0002730 3300048925 Bacteria 24410
396 Ga0496122_0003059 3300048925 Bacteria 22617
397 Ga0496123_0003661 3300048926 Bacteria 16971
398 Ga0496124_0027614 3300048927 Bacteria 5091
399 Ga0496125_0023543 3300048928 Bacteria 5683
400 Ga0501034_0027850 3300049571 Bacteria 5746
401 Ga0501034_0028044 3300049571 Bacteria 5726
402 Ga0501038_0023587 3300049574 Bacteria 5498
403 Ga0501043_0024414 3300049579 Bacteria 4744
404 Ga0501043_0066386 3300049579 Bacteria 2833
405 Ga0501241_000020 3300049758 Bacteria 83005
406 Ga0501241_005760 3300049758 Bacteria 2300
407 Ga0501269_000181 3300049766 Bacteria 19450
408 Ga0501044_0061545 3300049823 Bacteria 3840
409 nmdc:mga0k408_3695_c2 3300050493 Bacteria 5638
410 nmdc:mga05p37_2426_c2 3300050507 Bacteria 15408
411 nmdc:mga09592_4890_c1 3300050508 Bacteria 10852
412 nmdc:mga0qj67_13768_c1 3300050509 Bacteria 6105
413 nmdc:mga08y16_41578_c1 3300050511 Bacteria 4815
414 nmdc:mga0n895_213443_c1 3300050512 Bacteria 1960
415 Ga0500646_0004164 3300053090 Bacteria 3670
416 Ga0500583_0000028 3300053092 Bacteria 108276
417 Ga0500583_0002283 3300053092 Bacteria 5721
418 Ga0500651_0000357 3300053093 Bacteria 25575
419 Ga0500641_0000040 3300053096 Bacteria 68174
420 Ga0500562_000047 3300053108 Bacteria 62430
421 Ga0500616_0001915 3300053153 Bacteria 18592
422 Ga0500622_0000751 3300053156 Bacteria 28221
423 Ga0500611_000002 3300053727 Bacteria 345991
424 Ga0500611_000008 3300053727 Bacteria 198346
425 Ga0500661_001831 3300055283 Bacteria 4014

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046517 Ga0495630_0036974 Ga0495630_0036974_2224_3639 471
2 3300049579 Ga0501043_0066386 Ga0501043_0066386_24_1502 475
3 3300037471 Ga0395905_0098703 Ga0395905_0098703_561_2096 511
4 3300005367 Ga0070667_100081014 Ga0070667_1000810142 531
5 3300049571 Ga0501034_0028044 Ga0501034_0028044_1592_3250 533
6 3300049574 Ga0501038_0023587 Ga0501038_0023587_1385_3043 533
7 3300049579 Ga0501043_0024414 Ga0501043_0024414_1978_3636 533
8 3300013104 Ga0157370_10037772 Ga0157370_100377724 535
9 3300042876 Ga0451577_0122689 Ga0451577_0122689_412_2055 535
10 iso_pu_bacteria 2643221667 2644373259 535
11 iso_pu_bacteria 2585427687 2586208942 541
12 iso_pu_bacteria 2738541273 2738698315 541
13 iso_pu_bacteria 2738541302 2738856292 541
14 iso_pu_bacteria 2738543014 2739252641 541
15 iso_pu_bacteria 2739367651 2739590472 541
16 iso_pu_bacteria 2818991437 2819549384 541
17 iso_pu_bacteria 2842722452 2842724757 541
18 iso_pu_bacteria 2842909656 2842913217 541
19 iso_pu_bacteria 2849281842 2849285526 541
20 iso_pu_bacteria 2904445276 2904449852 541
21 iso_pu_bacteria 2914759650 2914761858 541
22 iso_pu_bacteria 2945997725 2946001770 541
23 iso_pu_bacteria 2954016120 2954018592 541
24 iso_pu_bacteria 2958512119 2958513695 541
25 iso_pu_bacteria 2585428095 2587865787 542
26 iso_pu_bacteria 2585428115 2587943945 542
27 iso_pu_bacteria 2585428187 2588231824 542
28 iso_pu_bacteria 2775506739 2775672153 542
29 iso_pu_bacteria 2919097161 2919099240 542
30 iso_pu_bacteria 2945924605 2945926540 542
31 3300032004 Ga0307414_10000947 Ga0307414_100009474 543
32 iso_pu_bacteria 2585427687 2586208889 543
33 iso_pu_bacteria 2738541302 2738852540 543
34 iso_pu_bacteria 2739367651 2739591348 543
35 iso_pu_bacteria 2739367656 2739614787 543
36 iso_pu_bacteria 2739367663 2739646080 543
37 iso_pu_bacteria 2818991437 2819549611 543
38 iso_pu_bacteria 2842722452 2842727429 543
39 iso_pu_bacteria 2842909656 2842913825 543
40 iso_pu_bacteria 2849281842 2849283490 543
41 iso_pu_bacteria 2857627736 2857631950 543
42 iso_pu_bacteria 2896344016 2896345246 543
43 iso_pu_bacteria 2902048731 2902048924 543
44 iso_pu_bacteria 2904445276 2904447209 543
45 iso_pu_bacteria 2945997725 2945998254 543
46 iso_pu_bacteria 2954016120 2954020718 543
47 3300005367 Ga0070667_100032955 Ga0070667_1000329553 544
48 3300005458 Ga0070681_10234334 Ga0070681_102343341 544
49 3300006237 Ga0097621_100001501 Ga0097621_1000015014 544
50 3300006358 Ga0068871_100004024 Ga0068871_1000040246 544
51 3300006871 Ga0075434_100253555 Ga0075434_1002535551 544
52 3300013297 Ga0157378_10026991 Ga0157378_100269912 544
53 3300013306 Ga0163162_10006015 Ga0163162_100060157 544
54 3300013308 Ga0157375_10004308 Ga0157375_100043087 544
55 3300014969 Ga0157376_10001928 Ga0157376_100019282 544
56 3300050512 nmdc:mga0n895_213443_c1 nmdc:mga0n895_213443_c1_60_1715 544
57 iso_pu_bacteria 2721755487 2722731051 544
58 iso_pu_bacteria 2904780799 2904783415 544
59 iso_pu_bacteria 2914759650 2914761567 544
60 iso_pu_bacteria 2919177583 2919181281 544
61 iso_pu_bacteria 2929154850 2929155313 544
62 iso_pu_bacteria 3003233435 3003237164 544
63 3300003781 Ga0055536_1000001 Ga0055536_100000157 545
64 3300003791 Ga0055530_10001525 Ga0055530_1000152510 545
65 3300005288 Ga0065714_10002251 Ga0065714_100022513 545
66 3300005288 Ga0065714_10005601 Ga0065714_100056012 545
67 3300005329 Ga0070683_100096635 Ga0070683_1000966352 545
68 3300005331 Ga0070670_100119595 Ga0070670_1001195951 545
69 3300005366 Ga0070659_100007295 Ga0070659_1000072954 545
70 3300005471 Ga0070698_100005154 Ga0070698_10000515410 545
71 3300005530 Ga0070679_100046381 Ga0070679_1000463812 545
72 3300005535 Ga0070684_100034633 Ga0070684_1000346332 545
73 3300005564 Ga0070664_100018647 Ga0070664_1000186475 545
74 3300005841 Ga0068863_100056220 Ga0068863_1000562203 545
75 3300013102 Ga0157371_10000021 Ga0157371_1000002175 545
76 3300013102 Ga0157371_10007560 Ga0157371_100075602 545
77 3300013104 Ga0157370_10067718 Ga0157370_100677182 545
78 3300013104 Ga0157370_10155103 Ga0157370_101551032 545
79 3300013105 Ga0157369_10000008 Ga0157369_10000008226 545
80 3300013306 Ga0163162_10000155 Ga0163162_1000015550 545
81 3300013307 Ga0157372_10032190 Ga0157372_100321904 545
82 3300013307 Ga0157372_10047069 Ga0157372_100470692 545
83 3300014325 Ga0163163_10003073 Ga0163163_100030734 545
84 3300014497 Ga0182008_10000603 Ga0182008_1000060320 545
85 3300015261 Ga0182006_1000888 Ga0182006_100088815 545
86 3300015262 Ga0182007_10000003 Ga0182007_1000000333 545
87 3300015682 Ga0183373_1001 Ga0183373_1001938 545
88 3300017792 Ga0163161_10000470 Ga0163161_100004707 545
89 3300017792 Ga0163161_10001518 Ga0163161_1000151819 545
90 3300025292 Ga0209676_1000008 Ga0209676_1000008801 545
91 3300025298 Ga0209050_1000343 Ga0209050_100034316 545
92 3300025925 Ga0207650_10047930 Ga0207650_100479302 545
93 3300025925 Ga0207650_10083152 Ga0207650_100831521 545
94 3300025944 Ga0207661_10078337 Ga0207661_100783372 545
95 3300026142 Ga0207698_10024279 Ga0207698_100242794 545
96 3300031731 Ga0307405_10000008 Ga0307405_10000008242 545
97 3300031903 Ga0307407_10000026 Ga0307407_1000002673 545
98 3300032002 Ga0307416_100000053 Ga0307416_10000005373 545
99 3300032004 Ga0307414_10012708 Ga0307414_100127082 545
100 3300037418 Ga0395900_0012957 Ga0395900_0012957_6028_7665 545
101 3300037471 Ga0395905_0002019 Ga0395905_0002019_6625_8262 545
102 3300041406 Ga0439439_0006352 Ga0439439_0006352_375_2030 545
103 3300044712 Ga0453684_0077574 Ga0453684_0077574_84_1721 545
104 3300046507 Ga0495606_0028372 Ga0495606_0028372_2182_3819 545
105 3300046512 Ga0495610_0000747 Ga0495610_0000747_23673_25310 545
106 3300046512 Ga0495610_0001062 Ga0495610_0001062_21569_23206 545
107 3300046616 Ga0495668_0001808 Ga0495668_0001808_3534_5171 545
108 3300048918 Ga0496115_0046659 Ga0496115_0046659_337_1974 545
109 iso_pu_bacteria 2895498888 2895501697 545
110 iso_pu_bacteria 2910245624 2910248442 545
111 3300002773 JGI25152J39213_1000173 JGI25152J39213_10001735 546
112 3300002774 JGI25150J39212_1000015 JGI25150J39212_1000015127 546
113 3300003187 JGI25151J46595_10000043 JGI25151J46595_100000435 546
114 3300003215 JGI25153J46596_10000009 JGI25153J46596_10000009268 546
115 3300005288 Ga0065714_10006902 Ga0065714_100069022 546
116 3300005288 Ga0065714_10082581 Ga0065714_100825811 546
117 3300005295 Ga0065707_10131200 Ga0065707_101312001 546
118 3300005334 Ga0068869_100126054 Ga0068869_1001260541 546
119 3300005337 Ga0070682_100000109 Ga0070682_10000010952 546
120 3300005339 Ga0070660_100001082 Ga0070660_1000010829 546
121 3300005340 Ga0070689_100042753 Ga0070689_1000427532 546
122 3300005364 Ga0070673_100004392 Ga0070673_1000043923 546
123 3300005457 Ga0070662_100066034 Ga0070662_1000660341 546
124 3300005459 Ga0068867_100016386 Ga0068867_1000163864 546
125 3300005471 Ga0070698_100006108 Ga0070698_1000061081 546
126 3300005471 Ga0070698_100070417 Ga0070698_1000704172 546
127 3300005539 Ga0068853_100040143 Ga0068853_1000401432 546
128 3300005539 Ga0068853_100180196 Ga0068853_1001801961 546
129 3300005548 Ga0070665_100022051 Ga0070665_1000220513 546
130 3300005563 Ga0068855_100019915 Ga0068855_1000199155 546
131 3300005719 Ga0068861_100015969 Ga0068861_1000159695 546
132 3300006195 Ga0075366_10013752 Ga0075366_100137524 546
133 3300006358 Ga0068871_100018358 Ga0068871_1000183584 546
134 3300006358 Ga0068871_100035985 Ga0068871_1000359852 546
135 3300006844 Ga0075428_100030907 Ga0075428_1000309074 546
136 3300006844 Ga0075428_100036418 Ga0075428_1000364182 546
137 3300006846 Ga0075430_100009461 Ga0075430_1000094616 546
138 3300006847 Ga0075431_100024790 Ga0075431_1000247905 546
139 3300006880 Ga0075429_100000557 Ga0075429_10000055717 546
140 3300006881 Ga0068865_100001792 Ga0068865_1000017926 546
141 3300006942 Ga0099824_1004036 Ga0099824_100403610 546
142 3300006946 Ga0079104_1000079 Ga0079104_1000079109 546
143 3300006948 Ga0099826_10026672 Ga0099826_100266723 546
144 3300009011 Ga0105251_10035098 Ga0105251_100350981 546
145 3300009093 Ga0105240_10068320 Ga0105240_100683203 546
146 3300009147 Ga0114129_10004260 Ga0114129_1000426012 546
147 3300009147 Ga0114129_10247196 Ga0114129_102471962 546
148 3300009174 Ga0105241_10102000 Ga0105241_101020002 546
149 3300009553 Ga0105249_10001157 Ga0105249_1000115717 546
150 3300009553 Ga0105249_10021677 Ga0105249_100216772 546
151 3300010375 Ga0105239_10064256 Ga0105239_100642563 546
152 3300013100 Ga0157373_10000005 Ga0157373_10000005217 546
153 3300013100 Ga0157373_10000035 Ga0157373_1000003599 546
154 3300013104 Ga0157370_10001800 Ga0157370_1000180014 546
155 3300013104 Ga0157370_10015356 Ga0157370_100153564 546
156 3300013105 Ga0157369_10039587 Ga0157369_100395872 546
157 3300013105 Ga0157369_10240920 Ga0157369_102409201 546
158 3300013297 Ga0157378_10094244 Ga0157378_100942442 546
159 3300013308 Ga0157375_10002645 Ga0157375_1000264512 546
160 3300014326 Ga0157380_10096760 Ga0157380_100967602 546
161 3300014326 Ga0157380_10187997 Ga0157380_101879971 546
162 3300014497 Ga0182008_10000037 Ga0182008_10000037103 546
163 3300014969 Ga0157376_10008614 Ga0157376_100086142 546
164 3300014969 Ga0157376_10031148 Ga0157376_100311482 546
165 3300014969 Ga0157376_10041397 Ga0157376_100413972 546
166 3300015261 Ga0182006_1001210 Ga0182006_10012107 546
167 3300015261 Ga0182006_1002244 Ga0182006_10022447 546
168 3300017792 Ga0163161_10000815 Ga0163161_100008157 546
169 3300025245 Ga0207425_1000023 Ga0207425_1000023266 546
170 3300025258 Ga0209129_1000032 Ga0209129_10000326 546
171 3300025294 Ga0209025_1000047 Ga0209025_10000476 546
172 3300025297 Ga0209758_1000144 Ga0209758_1000144124 546
173 3300025903 Ga0207680_10073094 Ga0207680_100730941 546
174 3300025907 Ga0207645_10000334 Ga0207645_1000033431 546
175 3300025919 Ga0207657_10001634 Ga0207657_1000163418 546
176 3300025934 Ga0207686_10005263 Ga0207686_100052635 546
177 3300025942 Ga0207689_10046567 Ga0207689_100465671 546
178 3300025942 Ga0207689_10096391 Ga0207689_100963912 546
179 3300025949 Ga0207667_10010203 Ga0207667_100102034 546
180 3300025961 Ga0207712_10000821 Ga0207712_100008215 546
181 3300025961 Ga0207712_10007724 Ga0207712_100077242 546
182 3300025961 Ga0207712_10082854 Ga0207712_100828541 546
183 3300025981 Ga0207640_10054545 Ga0207640_100545452 546
184 3300026041 Ga0207639_10103832 Ga0207639_101038322 546
185 3300026041 Ga0207639_10167908 Ga0207639_101679081 546
186 3300026088 Ga0207641_10063206 Ga0207641_100632061 546
187 3300026088 Ga0207641_10180517 Ga0207641_101805172 546
188 3300026089 Ga0207648_10004255 Ga0207648_100042556 546
189 3300026116 Ga0207674_10045060 Ga0207674_100450603 546
190 3300026116 Ga0207674_10062516 Ga0207674_100625162 546
191 3300026118 Ga0207675_100029305 Ga0207675_1000293054 546
192 3300027111 Ga0209281_1000367 Ga0209281_100036733 546
193 3300027361 Ga0209489_111689 Ga0209489_1116894 546
194 3300028381 Ga0268264_10139747 Ga0268264_101397472 546
195 3300028794 Ga0307515_10000001 Ga0307515_100000013025 546
196 3300031507 Ga0307509_10068760 Ga0307509_100687602 546
197 3300031911 Ga0307412_10000283 Ga0307412_1000028331 546
198 3300031911 Ga0307412_10004974 Ga0307412_100049744 546
199 3300032002 Ga0307416_100000066 Ga0307416_10000006630 546
200 3300032004 Ga0307414_10000046 Ga0307414_1000004655 546
201 3300041413 Ga0439465_0000153 Ga0439465_0000153_3122_4762 546
202 3300041512 Ga0451853_0006869 Ga0451853_0006869_116_1768 546
203 3300041512 Ga0451853_3749989 Ga0451853_3749989_1290_2942 546
204 3300044656 Ga0466969_0000151 Ga0466969_0000151_4353_6005 546
205 3300044684 Ga0466966_0000113 Ga0466966_0000113_10568_12220 546
206 3300045049 Ga0466959_0000015 Ga0466959_0000015_17381_19033 546
207 3300046453 Ga0495627_000002 Ga0495627_000002_394005_395645 546
208 3300046507 Ga0495606_0006357 Ga0495606_0006357_8795_10435 546
209 3300046513 Ga0495616_0014695 Ga0495616_0014695_430_2070 546
210 3300046519 Ga0495632_0005245 Ga0495632_0005245_1938_3578 546
211 3300046522 Ga0495643_0001223 Ga0495643_0001223_6330_7970 546
212 3300046530 Ga0495654_0000056 Ga0495654_0000056_30115_31755 546
213 3300046538 Ga0495609_0000025 Ga0495609_0000025_121018_122658 546
214 3300046558 Ga0495633_0000562 Ga0495633_0000562_26692_28332 546
215 3300046660 Ga0495625_0002377 Ga0495625_0002377_15184_16824 546
216 3300046660 Ga0495625_0043937 Ga0495625_0043937_383_2023 546
217 3300047472 Ga0495686_0000386 Ga0495686_0000386_29147_30787 546
218 3300047472 Ga0495686_0011295 Ga0495686_0011295_2671_4350 546
219 3300048924 Ga0496121_0009909 Ga0496121_0009909_564_2219 546
220 3300049758 Ga0501241_000020 Ga0501241_000020_49871_51511 546
221 3300049766 Ga0501269_000181 Ga0501269_000181_16949_18589 546
222 3300050493 nmdc:mga0k408_3695_c2 nmdc:mga0k408_3695_c2_2588_4267 546
223 3300050507 nmdc:mga05p37_2426_c2 nmdc:mga05p37_2426_c2_5424_7076 546
224 3300050508 nmdc:mga09592_4890_c1 nmdc:mga09592_4890_c1_6759_8438 546
225 3300050509 nmdc:mga0qj67_13768_c1 nmdc:mga0qj67_13768_c1_1364_3043 546
226 3300053090 Ga0500646_0004164 Ga0500646_0004164_1257_2912 546
227 3300053092 Ga0500583_0000028 Ga0500583_0000028_15721_17391 546
228 3300053092 Ga0500583_0002283 Ga0500583_0002283_331_1983 546
229 3300053096 Ga0500641_0000040 Ga0500641_0000040_65929_67584 546
230 3300053727 Ga0500611_000002 Ga0500611_000002_13260_14939 546
231 3300053727 Ga0500611_000008 Ga0500611_000008_169370_171010 546
232 iso_pu_bacteria 2519899754 2520880520 546
233 iso_pu_bacteria 2585428061 2587751788 546
234 iso_pu_bacteria 2643221725 2644682526 546
235 iso_pu_bacteria 2738541279 2738734414 546
236 iso_pu_bacteria 2738541285 2738767172 546
237 iso_pu_bacteria 2738543007 2739215995 546
238 iso_pu_bacteria 2802428842 2802651300 546
239 iso_pu_bacteria 2816332280 2817414184 546
240 iso_pu_bacteria 2881359912 2881361486 546
241 iso_pu_bacteria 2903895155 2903895260 546
242 iso_pu_bacteria 2929150217 2929153820 546
243 iso_pu_bacteria 2958458903 2958459607 546
244 iso_pu_bacteria 2977268062 2977272714 546
245 iso_pu_bacteria 8055419101 8055420069 546
246 iso_pu_bacteria 8055592153 8055596959 546
247 3300002773 JGI25152J39213_1000080 JGI25152J39213_10000808 547
248 3300002774 JGI25150J39212_1000003 JGI25150J39212_1000003457 547
249 3300002774 JGI25150J39212_1000004 JGI25150J39212_1000004168 547
250 3300003187 JGI25151J46595_10000002 JGI25151J46595_10000002457 547
251 3300003215 JGI25153J46596_10000015 JGI25153J46596_10000015268 547
252 3300003781 Ga0055536_1000002 Ga0055536_1000002403 547
253 3300005288 Ga0065714_10002204 Ga0065714_1000220412 547
254 3300005290 Ga0065712_10003936 Ga0065712_100039362 547
255 3300005293 Ga0065715_10020339 Ga0065715_100203391 547
256 3300005327 Ga0070658_10046148 Ga0070658_100461481 547
257 3300005328 Ga0070676_10015781 Ga0070676_100157811 547
258 3300005329 Ga0070683_100001724 Ga0070683_1000017245 547
259 3300005330 Ga0070690_100017022 Ga0070690_1000170223 547
260 3300005334 Ga0068869_100001942 Ga0068869_1000019426 547
261 3300005334 Ga0068869_100028571 Ga0068869_1000285713 547
262 3300005334 Ga0068869_100053108 Ga0068869_1000531082 547
263 3300005334 Ga0068869_100069306 Ga0068869_1000693061 547
264 3300005335 Ga0070666_10000696 Ga0070666_100006961 547
265 3300005338 Ga0068868_100004734 Ga0068868_1000047345 547
266 3300005340 Ga0070689_100011094 Ga0070689_1000110943 547
267 3300005340 Ga0070689_100031128 Ga0070689_1000311282 547
268 3300005344 Ga0070661_100003878 Ga0070661_1000038785 547
269 3300005344 Ga0070661_100032497 Ga0070661_1000324973 547
270 3300005354 Ga0070675_100018724 Ga0070675_1000187244 547
271 3300005355 Ga0070671_100031632 Ga0070671_1000316322 547
272 3300005356 Ga0070674_100013974 Ga0070674_1000139744 547
273 3300005364 Ga0070673_100005637 Ga0070673_1000056375 547
274 3300005364 Ga0070673_100025696 Ga0070673_1000256962 547
275 3300005364 Ga0070673_100113710 Ga0070673_1001137102 547
276 3300005366 Ga0070659_100005067 Ga0070659_1000050676 547
277 3300005367 Ga0070667_100013413 Ga0070667_1000134134 547
278 3300005367 Ga0070667_100057511 Ga0070667_1000575111 547
279 3300005436 Ga0070713_100093706 Ga0070713_1000937062 547
280 3300005456 Ga0070678_100077865 Ga0070678_1000778652 547
281 3300005457 Ga0070662_100008428 Ga0070662_1000084281 547
282 3300005457 Ga0070662_100022494 Ga0070662_1000224942 547
283 3300005459 Ga0068867_100012501 Ga0068867_1000125014 547
284 3300005466 Ga0070685_10019145 Ga0070685_100191452 547
285 3300005466 Ga0070685_10059655 Ga0070685_100596552 547
286 3300005471 Ga0070698_100022314 Ga0070698_1000223143 547
287 3300005518 Ga0070699_100097249 Ga0070699_1000972492 547
288 3300005535 Ga0070684_100000417 Ga0070684_10000041719 547
289 3300005535 Ga0070684_100014019 Ga0070684_1000140195 547
290 3300005544 Ga0070686_100020608 Ga0070686_1000206082 547
291 3300005549 Ga0070704_100032638 Ga0070704_1000326382 547
292 3300005564 Ga0070664_100000360 Ga0070664_10000036026 547
293 3300005564 Ga0070664_100012371 Ga0070664_1000123712 547
294 3300005564 Ga0070664_100062016 Ga0070664_1000620162 547
295 3300005577 Ga0068857_100044096 Ga0068857_1000440963 547
296 3300005617 Ga0068859_100000098 Ga0068859_1000000981 547
297 3300005617 Ga0068859_100000285 Ga0068859_10000028544 547
298 3300005617 Ga0068859_100013654 Ga0068859_1000136545 547
299 3300005719 Ga0068861_100011359 Ga0068861_1000113593 547
300 3300005719 Ga0068861_100092712 Ga0068861_1000927122 547
301 3300005719 Ga0068861_100101180 Ga0068861_1001011802 547
302 3300005834 Ga0068851_10051166 Ga0068851_100511662 547
303 3300005841 Ga0068863_100001430 Ga0068863_1000014302 547
304 3300005841 Ga0068863_100005978 Ga0068863_1000059785 547
305 3300005841 Ga0068863_100017784 Ga0068863_1000177844 547
306 3300005843 Ga0068860_100003920 Ga0068860_10000392011 547
307 3300005843 Ga0068860_100100682 Ga0068860_1001006822 547
308 3300005844 Ga0068862_100026893 Ga0068862_1000268932 547
309 3300006237 Ga0097621_100052525 Ga0097621_1000525252 547
310 3300006237 Ga0097621_100121898 Ga0097621_1001218982 547
311 3300006358 Ga0068871_100088297 Ga0068871_1000882972 547
312 3300006844 Ga0075428_100018917 Ga0075428_1000189173 547
313 3300006846 Ga0075430_100013447 Ga0075430_1000134472 547
314 3300006847 Ga0075431_100027720 Ga0075431_1000277202 547
315 3300006931 Ga0097620_100000098 Ga0097620_1000000981 547
316 3300006931 Ga0097620_100000285 Ga0097620_10000028544 547
317 3300006931 Ga0097620_100013654 Ga0097620_1000136545 547
318 3300009094 Ga0111539_10004863 Ga0111539_100048639 547
319 3300009174 Ga0105241_10006435 Ga0105241_100064351 547
320 3300009176 Ga0105242_10115112 Ga0105242_101151122 547
321 3300009545 Ga0105237_10011376 Ga0105237_100113766 547
322 3300009553 Ga0105249_10001120 Ga0105249_100011202 547
323 3300009553 Ga0105249_10001277 Ga0105249_1000127713 547
324 3300009553 Ga0105249_10021242 Ga0105249_100212423 547
325 3300009553 Ga0105249_10062412 Ga0105249_100624122 547
326 3300010375 Ga0105239_10275530 Ga0105239_102755301 547
327 3300013100 Ga0157373_10003444 Ga0157373_100034446 547
328 3300013100 Ga0157373_10045547 Ga0157373_100455472 547
329 3300013102 Ga0157371_10000025 Ga0157371_10000025161 547
330 3300013104 Ga0157370_10000383 Ga0157370_100003832 547
331 3300013104 Ga0157370_10181478 Ga0157370_101814781 547
332 3300013105 Ga0157369_10000038 Ga0157369_10000038103 547
333 3300013296 Ga0157374_10007311 Ga0157374_100073112 547
334 3300013296 Ga0157374_10017645 Ga0157374_100176455 547
335 3300013297 Ga0157378_10037267 Ga0157378_100372673 547
336 3300013297 Ga0157378_10071514 Ga0157378_100715142 547
337 3300013306 Ga0163162_10000050 Ga0163162_1000005094 547
338 3300013308 Ga0157375_10016379 Ga0157375_100163793 547
339 3300014325 Ga0163163_10006182 Ga0163163_100061826 547
340 3300014326 Ga0157380_10009601 Ga0157380_100096012 547
341 3300014497 Ga0182008_10000309 Ga0182008_1000030934 547
342 3300014497 Ga0182008_10012375 Ga0182008_100123753 547
343 3300014968 Ga0157379_10015571 Ga0157379_100155716 547
344 3300014968 Ga0157379_10193420 Ga0157379_101934201 547
345 3300014969 Ga0157376_10002899 Ga0157376_100028994 547
346 3300014969 Ga0157376_10074721 Ga0157376_100747212 547
347 3300015261 Ga0182006_1000127 Ga0182006_100012755 547
348 3300015261 Ga0182006_1000227 Ga0182006_100022723 547
349 3300015262 Ga0182007_10000024 Ga0182007_10000024144 547
350 3300015682 Ga0183373_1002 Ga0183373_1002139 547
351 3300017792 Ga0163161_10000136 Ga0163161_1000013626 547
352 3300017792 Ga0163161_10001151 Ga0163161_100011517 547
353 3300017792 Ga0163161_10035915 Ga0163161_100359152 547
354 3300017792 Ga0163161_10096055 Ga0163161_100960552 547
355 3300025245 Ga0207425_1000003 Ga0207425_1000003389 547
356 3300025258 Ga0209129_1000014 Ga0209129_1000014444 547
357 3300025292 Ga0209676_1000022 Ga0209676_1000022135 547
358 3300025294 Ga0209025_1000007 Ga0209025_1000007388 547
359 3300025297 Ga0209758_1000012 Ga0209758_1000012389 547
360 3300025298 Ga0209050_1000020 Ga0209050_1000020405 547
361 3300025903 Ga0207680_10000120 Ga0207680_100001201 547
362 3300025904 Ga0207647_10022367 Ga0207647_100223672 547
363 3300025907 Ga0207645_10028538 Ga0207645_100285381 547
364 3300025911 Ga0207654_10001306 Ga0207654_1000130610 547
365 3300025914 Ga0207671_10001247 Ga0207671_1000124713 547
366 3300025920 Ga0207649_10078781 Ga0207649_100787812 547
367 3300025925 Ga0207650_10061601 Ga0207650_100616011 547
368 3300025931 Ga0207644_10034862 Ga0207644_100348622 547
369 3300025931 Ga0207644_10151665 Ga0207644_101516651 547
370 3300025932 Ga0207690_10003665 Ga0207690_100036653 547
371 3300025933 Ga0207706_10006057 Ga0207706_100060577 547
372 3300025933 Ga0207706_10020425 Ga0207706_100204255 547
373 3300025934 Ga0207686_10000405 Ga0207686_1000040522 547
374 3300025936 Ga0207670_10044244 Ga0207670_100442442 547
375 3300025936 Ga0207670_10111807 Ga0207670_101118071 547
376 3300025937 Ga0207669_10043503 Ga0207669_100435032 547
377 3300025940 Ga0207691_10065090 Ga0207691_100650902 547
378 3300025940 Ga0207691_10109635 Ga0207691_101096351 547
379 3300025942 Ga0207689_10003219 Ga0207689_1000321912 547
380 3300025942 Ga0207689_10005450 Ga0207689_100054501 547
381 3300025942 Ga0207689_10012712 Ga0207689_100127126 547
382 3300025942 Ga0207689_10019387 Ga0207689_100193874 547
383 3300025944 Ga0207661_10048895 Ga0207661_100488952 547
384 3300025945 Ga0207679_10007831 Ga0207679_100078314 547
385 3300025945 Ga0207679_10064690 Ga0207679_100646902 547
386 3300025960 Ga0207651_10023979 Ga0207651_100239793 547
387 3300025960 Ga0207651_10040522 Ga0207651_100405222 547
388 3300025960 Ga0207651_10043655 Ga0207651_100436552 547
389 3300025960 Ga0207651_10151296 Ga0207651_101512961 547
390 3300025961 Ga0207712_10004491 Ga0207712_100044914 547
391 3300025961 Ga0207712_10016604 Ga0207712_100166042 547
392 3300025986 Ga0207658_10026332 Ga0207658_100263323 547
393 3300025986 Ga0207658_10075616 Ga0207658_100756162 547
394 3300026035 Ga0207703_10100305 Ga0207703_101003051 547
395 3300026035 Ga0207703_10208091 Ga0207703_102080911 547
396 3300026041 Ga0207639_10006556 Ga0207639_100065562 547
397 3300026067 Ga0207678_10099642 Ga0207678_100996422 547
398 3300026088 Ga0207641_10001054 Ga0207641_100010547 547
399 3300026088 Ga0207641_10001908 Ga0207641_1000190812 547
400 3300026088 Ga0207641_10021870 Ga0207641_100218702 547
401 3300026088 Ga0207641_10093210 Ga0207641_100932102 547
402 3300026089 Ga0207648_10036523 Ga0207648_100365233 547
403 3300026089 Ga0207648_10062347 Ga0207648_100623472 547
404 3300026095 Ga0207676_10004127 Ga0207676_100041278 547
405 3300026095 Ga0207676_10012612 Ga0207676_100126122 547
406 3300026095 Ga0207676_10035567 Ga0207676_100355672 547
407 3300026118 Ga0207675_100002484 Ga0207675_10000248411 547
408 3300026118 Ga0207675_100069416 Ga0207675_1000694162 547
409 3300026118 Ga0207675_100121459 Ga0207675_1001214591 547
410 3300026121 Ga0207683_10031001 Ga0207683_100310013 547
411 3300028379 Ga0268266_10131878 Ga0268266_101318782 547
412 3300028381 Ga0268264_10009194 Ga0268264_100091947 547
413 3300028381 Ga0268264_10080005 Ga0268264_100800052 547
414 3300028794 Ga0307515_10000002 Ga0307515_10000002718 547
415 3300028794 Ga0307515_10001521 Ga0307515_100015219 547
416 3300028794 Ga0307515_10053353 Ga0307515_100533534 547
417 3300031251 Ga0265327_10000488 Ga0265327_1000048814 547
418 3300031507 Ga0307509_10045625 Ga0307509_100456252 547
419 3300031616 Ga0307508_10001227 Ga0307508_1000122712 547
420 3300031731 Ga0307405_10000011 Ga0307405_10000011148 547
421 3300031903 Ga0307407_10000018 Ga0307407_10000018105 547
422 3300031995 Ga0307409_100001787 Ga0307409_10000178710 547
423 3300032002 Ga0307416_100000081 Ga0307416_10000008117 547
424 3300032004 Ga0307414_10000474 Ga0307414_100004742 547
425 3300035410 Ga0373924_0010001 Ga0373924_0010001_1439_3082 547
426 3300036401 Ga0373937_0032091 Ga0373937_0032091_1842_3485 547
427 3300041406 Ga0439439_0007265 Ga0439439_0007265_71_1714 547
428 3300044712 Ga0453684_0144202 Ga0453684_0144202_1011_2654 547
429 3300046512 Ga0495610_0000037 Ga0495610_0000037_107856_109502 547
430 3300046512 Ga0495610_0000049 Ga0495610_0000049_110485_112131 547
431 3300046516 Ga0495628_0021869 Ga0495628_0021869_2872_4515 547
432 3300046558 Ga0495633_0015264 Ga0495633_0015264_1488_3131 547
433 3300046642 Ga0495634_0041482 Ga0495634_0041482_691_2334 547
434 3300046675 Ga0495657_0092337 Ga0495657_0092337_85_1728 547
435 3300047320 Ga0495672_0027850 Ga0495672_0027850_79_1722 547
436 3300048917 Ga0496114_0091923 Ga0496114_0091923_65_1708 547
437 3300049571 Ga0501034_0027850 Ga0501034_0027850_876_2522 547
438 3300049823 Ga0501044_0061545 Ga0501044_0061545_179_1825 547
439 3300050511 nmdc:mga08y16_41578_c1 nmdc:mga08y16_41578_c1_2562_4205 547
440 3300005288 Ga0065714_10002553 Ga0065714_100025533 548
441 3300005288 Ga0065714_10004810 Ga0065714_100048102 548
442 3300005288 Ga0065714_10015106 Ga0065714_100151062 548
443 3300005289 Ga0065704_10072354 Ga0065704_100723544 548
444 3300009545 Ga0105237_10003809 Ga0105237_100038097 548
445 3300013100 Ga0157373_10008374 Ga0157373_100083746 548
446 3300013102 Ga0157371_10001207 Ga0157371_1000120710 548
447 3300013102 Ga0157371_10006892 Ga0157371_100068925 548
448 3300013104 Ga0157370_10003591 Ga0157370_100035916 548
449 3300013104 Ga0157370_10024060 Ga0157370_100240605 548
450 3300013104 Ga0157370_10052091 Ga0157370_100520913 548
451 3300013105 Ga0157369_10150971 Ga0157369_101509711 548
452 3300014497 Ga0182008_10000020 Ga0182008_10000020168 548
453 3300014497 Ga0182008_10003307 Ga0182008_100033072 548
454 3300014497 Ga0182008_10050715 Ga0182008_100507152 548
455 3300015261 Ga0182006_1000109 Ga0182006_100010935 548
456 3300015261 Ga0182006_1009706 Ga0182006_10097063 548
457 3300015262 Ga0182007_10002394 Ga0182007_1000239410 548
458 3300017792 Ga0163161_10010250 Ga0163161_100102505 548
459 3300025914 Ga0207671_10016536 Ga0207671_100165365 548
460 3300030744 Ga0316181_1190315 Ga0316181_11903153 548
461 3300031911 Ga0307412_10000001 Ga0307412_10000001224 548
462 3300032004 Ga0307414_10002029 Ga0307414_100020296 548
463 3300032004 Ga0307414_10014405 Ga0307414_100144054 548
464 3300048919 Ga0496116_0001157 Ga0496116_0001157_16807_18453 548
465 3300048920 Ga0496117_0000980 Ga0496117_0000980_16056_17702 548
466 3300048925 Ga0496122_0002730 Ga0496122_0002730_17773_19419 548
467 3300048925 Ga0496122_0003059 Ga0496122_0003059_10356_12014 548
468 3300048926 Ga0496123_0003661 Ga0496123_0003661_11245_12891 548
469 3300048927 Ga0496124_0027614 Ga0496124_0027614_2907_4553 548
470 3300048928 Ga0496125_0023543 Ga0496125_0023543_3439_5097 548
471 3300049758 Ga0501241_005760 Ga0501241_005760_226_1884 548
472 3300053093 Ga0500651_0000357 Ga0500651_0000357_7749_9407 548
473 3300053108 Ga0500562_000047 Ga0500562_000047_7938_9584 548
474 3300053156 Ga0500622_0000751 Ga0500622_0000751_4068_5714 548
475 3300055283 Ga0500661_001831 Ga0500661_001831_993_2639 548
476 iso_pu_bacteria 2738541283 2738759393 548
477 iso_pu_bacteria 2738541284 2738763273 548
478 iso_pu_bacteria 2738543023 2739304184 548
479 iso_pu_bacteria 2775506987 2776616121 548
480 iso_pu_bacteria 2852627209 2852630641 548
481 iso_pu_bacteria 2919186247 2919190601 548
482 iso_pu_bacteria 2939664404 2939669189 548
483 3300002459 JGI24751J29686_10002780 JGI24751J29686_100027802 549
484 3300005331 Ga0070670_100085030 Ga0070670_1000850301 549
485 3300005471 Ga0070698_100004841 Ga0070698_1000048419 549
486 3300006844 Ga0075428_100023631 Ga0075428_1000236312 549
487 3300025925 Ga0207650_10030282 Ga0207650_100302822 549
488 3300032004 Ga0307414_10003034 Ga0307414_100030343 549
489 3300032005 Ga0307411_10056560 Ga0307411_100565602 549
490 3300047472 Ga0495686_0001452 Ga0495686_0001452_8172_9824 549
491 3300053153 Ga0500616_0001915 Ga0500616_0001915_9378_11030 549

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF20629

GD_AH_C

D-galactarate/Altronate dehydratase, C-terminal

335

577

0.99

PF04295

GD_AH_second

D-galactarate dehydratase/Altronate hydrolase, second domain

145

326

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
3k3s-assembly3.cif.gz_C crystal structure of altronate hydrolase (fragment 1-84) from shigella flexneri. 0.9785 4 84
3k3s-assembly3.cif.gz_C crystal structure of altronate hydrolase (fragment 1-84) from shigella flexneri. 0.9227 4 84
6u7l-assembly1.cif.gz_A 2.75 angstrom crystal structure of galactarate dehydratase from escherichia coli. 0.8704 5 547
6u7l-assembly2.cif.gz_C 2.75 angstrom crystal structure of galactarate dehydratase from escherichia coli. 0.8701 5 547
6u7l-assembly1.cif.gz_B 2.75 angstrom crystal structure of galactarate dehydratase from escherichia coli. 0.8673 5 547
ID Description Score Start End Superfamily
3k3sD01 Mainly Beta;Roll;Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4; 0.9615 5 84 2.30.130.110
3k3sD01 Mainly Beta;Roll;Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4; 0.9173 5 84 2.30.130.110
af_P39829_14_92_2.30.130.110 Mainly Beta;Roll;Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4; 0.8724 5 83 2.30.130.110
af_P39829_14_92_2.30.130.110 Mainly Beta;Roll;Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4; 0.8518 5 83 2.30.130.110
af_Q9VEN6_71_200_3.30.420.80 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribosomal protein S11/S14 0.5851 211 272 3.30.420.80
ID Description Score Start End GO Terms
AF-A0A4Q5QFK8-F1-model_v4 Altronate dehydratase 1.003 1 85 GO:0016829
GO:0019698
AF-A0A2V9BGE4-F1-model_v4 Altronate hydrolase 1.002 1 75 GO:0016787
GO:0016829
AF-A0A4Q5QFK8-F1-model_v4 Altronate dehydratase 0.9917 1 85 GO:0016829
GO:0019698
AF-A0A2V9BGE4-F1-model_v4 Altronate hydrolase 0.9887 1 75 GO:0016787
GO:0016829
AF-A0A5J4RPN1-F1-model_v4 Altronate dehydratase (EC 4.2.1.7) 0.9833 3 84 GO:0008789
GO:0019698

Feature Viewer

pLDDT pTM Quality
84.99 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map