F454085

General Info

Members Datasets Scaffolds Average Seq Length
491 200 982 168

Family's Representative Sequence

Representative Sequence 3300006847|Ga0075431_100001270|Ga0075431_10000127021
Length 188
Sequence MPVETRRGFWGETLQLVRAVGRAMGVTFKNLLRRPITVRYPTVKRVFPDRFRGILALTYDPQTGEENCIGCRLCEYICPPQVIKVEMLKAEKRNWAKTFTLELYVMLRSFDLATADRRELLLDKDRLHALGLQFEPSWATGNRLRDMQAPPKPVKPATHSTPDRRAPEASEGAPTADPRSAAPSSANP

Samples

Sample ID Description Type Environment
1 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
4 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
57 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
58 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
87 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
88 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
128 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
131 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
132 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
133 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
134 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
135 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
136 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
137 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
138 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
139 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
140 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
141 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
142 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
143 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
144 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
145 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
146 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
147 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
148 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
149 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
150 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
151 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
152 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
153 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
154 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
155 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
156 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
157 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
158 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
159 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
160 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
161 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
162 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
163 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
175 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
176 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
177 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
178 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
179 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
180 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
181 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
182 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
183 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
184 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
185 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
186 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
187 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
188 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
189 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
190 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
191 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
192 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
193 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
194 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
195 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
196 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
197 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
198 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
199 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
200 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.02
Rhizosphere 98.98
Stem 0
Stem Tuber 0
Unclassified 11.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075431_100001270 3300006847 Bacteria 22987
2 JGI24746J21847_1001951 3300001977 Bacteria 3285
3 JGI24745J21846_1010929 3300002073 Unclassified 1035
4 JGI24035J26624_1021093 3300002126 Unclassified 688
5 JGI25406J46586_10011300 3300003203 Bacteria 3923
6 Ga0065715_10162957 3300005293 Unclassified 1564
7 Ga0065707_10390774 3300005295 Unclassified 865
8 Ga0070676_10074028 3300005328 Bacteria 2050
9 Ga0070690_100082077 3300005330 Unclassified 2110
10 Ga0070690_101094629 3300005330 Bacteria 632
11 Ga0070677_10002331 3300005333 Bacteria 6065
12 Ga0068869_100258101 3300005334 Bacteria 1394
13 Ga0070666_10029185 3300005335 Bacteria 3624
14 Ga0070680_100411165 3300005336 Bacteria 1154
15 Ga0070689_100179427 3300005340 Bacteria 1719
16 Ga0070687_100015745 3300005343 Bacteria 3427
17 Ga0070668_100021604 3300005347 Bacteria 4862
18 Ga0070668_100044110 3300005347 Bacteria 3420
19 Ga0070669_100012365 3300005353 Bacteria 6055
20 Ga0070669_100031693 3300005353 Bacteria 3818
21 Ga0070675_100252044 3300005354 Bacteria 1545
22 Ga0070675_100565990 3300005354 Unclassified 1029
23 Ga0070673_100124601 3300005364 Bacteria 2154
24 Ga0070688_100048283 3300005365 Bacteria 2644
25 Ga0070659_100102975 3300005366 Bacteria 2299
26 Ga0070667_100034478 3300005367 Bacteria 4234
27 Ga0070701_10038494 3300005438 Bacteria 2420
28 Ga0070705_100195712 3300005440 Unclassified 1382
29 Ga0070705_100218810 3300005440 Bacteria 1317
30 Ga0070708_100042179 3300005445 Bacteria 4004
31 Ga0070708_100086704 3300005445 Bacteria 2844
32 Ga0070708_100329876 3300005445 Bacteria 1438
33 Ga0070708_100996774 3300005445 Unclassified 786
34 Ga0070678_100016025 3300005456 Bacteria 4780
35 Ga0070662_100006443 3300005457 Bacteria 7565
36 Ga0070662_101017438 3300005457 Bacteria 710
37 Ga0068867_100030066 3300005459 Bacteria 3917
38 Ga0068867_100897905 3300005459 Unclassified 797
39 Ga0070685_10045159 3300005466 Bacteria 2525
40 Ga0070706_100008450 3300005467 Bacteria 9590
41 Ga0070706_100577870 3300005467 Archaea 1045
42 Ga0070706_100620262 3300005467 Bacteria 1004
43 Ga0070707_100000729 3300005468 Bacteria 32778
44 Ga0070707_100045468 3300005468 Bacteria 4202
45 Ga0070707_100077890 3300005468 Bacteria 3198
46 Ga0070707_100138098 3300005468 Bacteria 2372
47 Ga0070707_100603894 3300005468 Bacteria 1060
48 Ga0070698_100004426 3300005471 Bacteria 15440
49 Ga0070698_100282480 3300005471 Bacteria 1591
50 Ga0070699_100000534 3300005518 Bacteria 36008
51 Ga0070699_100003941 3300005518 Bacteria 13112
52 Ga0070699_100080194 3300005518 Bacteria 2844
53 Ga0070699_100174329 3300005518 Bacteria 1906
54 Ga0070699_100234239 3300005518 Bacteria 1638
55 Ga0070699_100509393 3300005518 Unclassified 1094
56 Ga0070699_100583625 3300005518 Bacteria 1019
57 Ga0070699_100893964 3300005518 Unclassified 813
58 Ga0070679_100158348 3300005530 Bacteria 2239
59 Ga0070684_100829224 3300005535 Unclassified 865
60 Ga0070697_100001086 3300005536 Bacteria 20540
61 Ga0070697_100047520 3300005536 Bacteria 3479
62 Ga0070697_100048568 3300005536 Bacteria 3441
63 Ga0070697_100099340 3300005536 Bacteria 2416
64 Ga0070697_100274192 3300005536 Bacteria 1446
65 Ga0070697_100294054 3300005536 Bacteria 1395
66 Ga0068853_100601448 3300005539 Unclassified 1044
67 Ga0070672_100014619 3300005543 Bacteria 5567
68 Ga0070672_100049360 3300005543 Bacteria 3274
69 Ga0070686_100116357 3300005544 Bacteria 1829
70 Ga0070695_100063589 3300005545 Bacteria 2399
71 Ga0070696_100018685 3300005546 Bacteria 4689
72 Ga0070696_100092008 3300005546 Bacteria 2161
73 Ga0070696_100544939 3300005546 Bacteria 929
74 Ga0070693_100074595 3300005547 Bacteria 2007
75 Ga0070704_100043338 3300005549 Bacteria 3119
76 Ga0070704_100118148 3300005549 Bacteria 2031
77 Ga0070704_100224808 3300005549 Bacteria 1528
78 Ga0070704_100307111 3300005549 Unclassified 1324
79 Ga0070664_100024184 3300005564 Bacteria 5023
80 Ga0068854_100279027 3300005578 Unclassified 1345
81 Ga0068852_101182625 3300005616 Unclassified 786
82 Ga0068859_100065876 3300005617 Bacteria 3656
83 Ga0068859_100524987 3300005617 Bacteria 1279
84 Ga0068864_100170777 3300005618 Bacteria 1982
85 Ga0068866_10303690 3300005718 Bacteria 998
86 Ga0068861_100096593 3300005719 Bacteria 2342
87 Ga0068861_100178774 3300005719 Bacteria 1764
88 Ga0068861_100548868 3300005719 Bacteria 1053
89 Ga0068870_10002979 3300005840 Bacteria 7138
90 Ga0068863_100025327 3300005841 Bacteria 5656
91 Ga0068863_100873616 3300005841 Unclassified 899
92 Ga0068858_100034467 3300005842 Bacteria 4696
93 Ga0068860_100083585 3300005843 Bacteria 3037
94 Ga0068860_100159168 3300005843 Bacteria 2177
95 Ga0068862_100039181 3300005844 Bacteria 4023
96 Ga0068862_100182182 3300005844 Bacteria 1886
97 Ga0068862_100558532 3300005844 Bacteria 1094
98 Ga0068862_100595566 3300005844 Bacteria 1061
99 Ga0081455_10064100 3300005937 Bacteria 3079
100 Ga0081538_10003260 3300005981 Bacteria 15419
101 Ga0081540_1019869 3300005983 Bacteria 4064
102 Ga0081539_10000454 3300005985 Bacteria 87230
103 Ga0097621_100070646 3300006237 Bacteria 2883
104 Ga0068871_100200215 3300006358 Unclassified 1724
105 Ga0068871_100991748 3300006358 Bacteria 782
106 Ga0075428_100004648 3300006844 Bacteria 15196
107 Ga0075428_100006929 3300006844 Bacteria 12586
108 Ga0075428_100123681 3300006844 Bacteria 2816
109 Ga0075428_100197201 3300006844 Bacteria 2177
110 Ga0075428_100336358 3300006844 Bacteria 1622
111 Ga0075428_100446829 3300006844 Bacteria 1385
112 Ga0075428_100842536 3300006844 Unclassified 974
113 Ga0075430_100003492 3300006846 Bacteria 13154
114 Ga0075430_100012886 3300006846 Bacteria 7125
115 Ga0075430_100019472 3300006846 Bacteria 5771
116 Ga0075430_100028925 3300006846 Bacteria 4705
117 Ga0075430_100029617 3300006846 Bacteria 4646
118 Ga0075430_100032620 3300006846 Bacteria 4421
119 Ga0075430_100188262 3300006846 Bacteria 1716
120 Ga0075430_100345004 3300006846 Bacteria 1230
121 Ga0075431_100000082 3300006847 Bacteria 56660
122 Ga0075431_100000455 3300006847 Bacteria 33646
123 Ga0075431_100001687 3300006847 Bacteria 20728
124 Ga0075431_100001936 3300006847 Bacteria 19722
125 Ga0075431_100052800 3300006847 Bacteria 4191
126 Ga0075431_100227399 3300006847 Bacteria 1902
127 Ga0075431_100759265 3300006847 Bacteria 945
128 Ga0075431_101011398 3300006847 Bacteria 798
129 Ga0075433_10000061 3300006852 Bacteria 47469
130 Ga0075433_10000427 3300006852 Bacteria 27010
131 Ga0075433_10005550 3300006852 Bacteria 9906
132 Ga0075433_10059591 3300006852 Bacteria 3340
133 Ga0075433_10181580 3300006852 Bacteria 1872
134 Ga0075433_10258382 3300006852 Bacteria 1544
135 Ga0075433_10270537 3300006852 Bacteria 1506
136 Ga0075433_10337826 3300006852 Bacteria 1331
137 Ga0075433_10358774 3300006852 Bacteria 1288
138 Ga0075433_10807578 3300006852 Bacteria 820
139 Ga0075433_11104542 3300006852 Unclassified 689
140 Ga0075434_100000180 3300006871 Bacteria 41040
141 Ga0075434_100017104 3300006871 Bacteria 6979
142 Ga0075434_100040188 3300006871 Bacteria 4633
143 Ga0075434_100073024 3300006871 Bacteria 3423
144 Ga0075434_100085881 3300006871 Bacteria 3146
145 Ga0075434_100094218 3300006871 Bacteria 2999
146 Ga0075434_100119131 3300006871 Unclassified 2654
147 Ga0075434_100165276 3300006871 Bacteria 2233
148 Ga0075434_100309702 3300006871 Bacteria 1599
149 Ga0075434_100451075 3300006871 Bacteria 1307
150 Ga0075429_100002106 3300006880 Bacteria 16613
151 Ga0075429_100002213 3300006880 Bacteria 16272
152 Ga0075429_100002798 3300006880 Bacteria 14762
153 Ga0075429_100002856 3300006880 Bacteria 14619
154 Ga0075429_100023887 3300006880 Bacteria 5305
155 Ga0075429_100064236 3300006880 Bacteria 3197
156 Ga0075429_100181246 3300006880 Bacteria 1846
157 Ga0075429_100197369 3300006880 Bacteria 1763
158 Ga0075429_100803774 3300006880 Bacteria 824
159 Ga0075429_100874527 3300006880 Unclassified 787
160 Ga0068865_100100613 3300006881 Bacteria 2115
161 Ga0068865_100219178 3300006881 Bacteria 1487
162 Ga0068865_100919620 3300006881 Unclassified 762
163 Ga0075436_100002146 3300006914 Bacteria 13600
164 Ga0075436_100144567 3300006914 Bacteria 1672
165 Ga0097620_100065876 3300006931 Bacteria 3656
166 Ga0097620_100524995 3300006931 Bacteria 1279
167 Ga0075435_100017542 3300007076 Bacteria 5422
168 Ga0075435_100051710 3300007076 Bacteria 3309
169 Ga0075435_100063505 3300007076 Bacteria 2999
170 Ga0075435_100099992 3300007076 Bacteria 2402
171 Ga0075435_100333209 3300007076 Unclassified 1300
172 Ga0075435_100387527 3300007076 Bacteria 1201
173 Ga0111539_10006594 3300009094 Bacteria 14961
174 Ga0111539_10012644 3300009094 Bacteria 10575
175 Ga0111539_10250103 3300009094 Bacteria 2064
176 Ga0111539_11218257 3300009094 Bacteria 874
177 Ga0114129_10000110 3300009147 Bacteria 81178
178 Ga0114129_10000936 3300009147 Bacteria 38136
179 Ga0114129_10002179 3300009147 Bacteria 26947
180 Ga0114129_10013658 3300009147 Bacteria 11571
181 Ga0114129_10020399 3300009147 Bacteria 9427
182 Ga0114129_10044379 3300009147 Bacteria 6253
183 Ga0114129_10085483 3300009147 Bacteria 4376
184 Ga0114129_10114857 3300009147 Bacteria 3712
185 Ga0114129_10211158 3300009147 Bacteria 2624
186 Ga0114129_10413676 3300009147 Bacteria 1775
187 Ga0114129_10445810 3300009147 Bacteria 1698
188 Ga0114129_10735289 3300009147 Bacteria 1265
189 Ga0114129_10750296 3300009147 Bacteria 1249
190 Ga0114129_10797536 3300009147 Bacteria 1205
191 Ga0114129_11037305 3300009147 Bacteria 1030
192 Ga0114129_11340586 3300009147 Bacteria 885
193 Ga0105243_10016133 3300009148 Bacteria 5650
194 Ga0105241_10041676 3300009174 Bacteria 3470
195 Ga0105242_10344983 3300009176 Bacteria 1373
196 Ga0105248_10194352 3300009177 Bacteria 2286
197 Ga0105248_10395701 3300009177 Bacteria 1556
198 Ga0105248_10463107 3300009177 Bacteria 1429
199 Ga0105249_10008153 3300009553 Bacteria 9132
200 Ga0105249_10732399 3300009553 Unclassified 1050
201 Ga0105239_10612823 3300010375 Bacteria 1242
202 Ga0157378_10060912 3300013297 Bacteria 3367
203 Ga0157378_10972879 3300013297 Bacteria 882
204 Ga0163162_10055861 3300013306 Bacteria 3976
205 Ga0163162_10103890 3300013306 Bacteria 2935
206 Ga0163162_10672215 3300013306 Bacteria 1158
207 Ga0157375_10137022 3300013308 Bacteria 2573
208 Ga0157375_10374942 3300013308 Bacteria 1589
209 Ga0157380_10003226 3300014326 Bacteria 11146
210 Ga0157377_10005724 3300014745 Bacteria 5860
211 Ga0157379_10181268 3300014968 Bacteria 1903
212 Ga0157379_10433169 3300014968 Bacteria 1212
213 Ga0157376_10435855 3300014969 Bacteria 1275
214 Ga0163161_10104805 3300017792 Bacteria 2109
215 Ga0163161_10120352 3300017792 Bacteria 1972
216 Ga0207673_1012930 3300025290 Unclassified 1091
217 Ga0207697_10001435 3300025315 Bacteria 13051
218 Ga0207682_10003116 3300025893 Bacteria 7262
219 Ga0207688_10001607 3300025901 Bacteria 11929
220 Ga0207680_10023261 3300025903 Bacteria 3381
221 Ga0207645_10008679 3300025907 Bacteria 7079
222 Ga0207643_10000732 3300025908 Bacteria 20161
223 Ga0207643_10016950 3300025908 Bacteria 3976
224 Ga0207643_10155728 3300025908 Unclassified 1372
225 Ga0207684_10000279 3300025910 Bacteria 74399
226 Ga0207684_10018762 3300025910 Bacteria 5918
227 Ga0207684_10270741 3300025910 Bacteria 1465
228 Ga0207684_10319722 3300025910 Unclassified 1338
229 Ga0207684_10474242 3300025910 Archaea 1074
230 Ga0207654_10058214 3300025911 Bacteria 2249
231 Ga0207663_10241733 3300025916 Bacteria 1324
232 Ga0207660_10318513 3300025917 Unclassified 1241
233 Ga0207662_10039826 3300025918 Bacteria 2758
234 Ga0207649_10041050 3300025920 Bacteria 2815
235 Ga0207646_10001682 3300025922 Bacteria 26908
236 Ga0207646_10027725 3300025922 Bacteria 5163
237 Ga0207646_10039239 3300025922 Bacteria 4262
238 Ga0207646_10063999 3300025922 Bacteria 3283
239 Ga0207646_10284741 3300025922 Archaea 1494
240 Ga0207646_10340453 3300025922 Bacteria 1355
241 Ga0207681_10008334 3300025923 Bacteria 6339
242 Ga0207681_10294417 3300025923 Bacteria 1282
243 Ga0207659_10071452 3300025926 Bacteria 2534
244 Ga0207644_10087713 3300025931 Bacteria 2313
245 Ga0207690_10166105 3300025932 Bacteria 1649
246 Ga0207706_10334375 3300025933 Unclassified 1318
247 Ga0207706_10373711 3300025933 Unclassified 1238
248 Ga0207686_10340996 3300025934 Bacteria 1125
249 Ga0207709_10274742 3300025935 Bacteria 1242
250 Ga0207670_10181069 3300025936 Unclassified 1587
251 Ga0207691_10010524 3300025940 Bacteria 8877
252 Ga0207691_10035245 3300025940 Bacteria 4647
253 Ga0207691_10934904 3300025940 Unclassified 725
254 Ga0207711_10499914 3300025941 Unclassified 1133
255 Ga0207689_10091644 3300025942 Bacteria 2497
256 Ga0207679_10010677 3300025945 Bacteria 5920
257 Ga0207651_10121224 3300025960 Bacteria 1983
258 Ga0207712_10115092 3300025961 Bacteria 2024
259 Ga0207712_10135770 3300025961 Bacteria 1881
260 Ga0207668_10086619 3300025972 Bacteria 2289
261 Ga0207677_10145337 3300026023 Bacteria 1821
262 Ga0207708_10086171 3300026075 Bacteria 2417
263 Ga0207648_10082063 3300026089 Bacteria 2811
264 Ga0207648_10091646 3300026089 Bacteria 2657
265 Ga0207648_10129111 3300026089 Bacteria 2224
266 Ga0207676_10062298 3300026095 Bacteria 2958
267 Ga0207674_10185820 3300026116 Bacteria 2029
268 Ga0207674_10231648 3300026116 Unclassified 1795
269 Ga0207675_100012281 3300026118 Bacteria 8002
270 Ga0207675_100033594 3300026118 Bacteria 4779
271 Ga0207675_100404881 3300026118 Bacteria 1345
272 Ga0207683_10007833 3300026121 Bacteria 9145
273 Ga0207698_11899713 3300026142 Unclassified 610
274 Ga0210002_1033299 3300027617 Unclassified 862
275 Ga0209971_1099388 3300027682 Bacteria 712
276 Ga0209974_10029136 3300027876 Bacteria 1829
277 Ga0207428_10000027 3300027907 Bacteria 250186
278 Ga0207428_10008043 3300027907 Bacteria 9569
279 Ga0207428_10020343 3300027907 Bacteria 5639
280 Ga0207428_10148466 3300027907 Unclassified 1786
281 Ga0268265_10031665 3300028380 Bacteria 3821
282 Ga0268265_10213693 3300028380 Bacteria 1682
283 Ga0268265_10322867 3300028380 Bacteria 1399
284 Ga0268264_10323716 3300028381 Bacteria 1458
285 Ga0307408_100023380 3300031548 Bacteria 4209
286 Ga0307408_100054771 3300031548 Bacteria 2885
287 Ga0307408_100507328 3300031548 Bacteria 1057
288 Ga0307405_10892239 3300031731 Unclassified 751
289 Ga0307413_10425550 3300031824 Bacteria 1047
290 Ga0307406_10341647 3300031901 Bacteria 1166
291 Ga0307407_10043399 3300031903 Bacteria 2528
292 Ga0307409_100106896 3300031995 Bacteria 2337
293 Ga0307415_100321864 3300032126 Unclassified 1290
294 Ga0373928_0106101 3300035084 Unclassified 738
295 Ga0373940_0163321 3300035088 Bacteria 716
296 Ga0373949_0115688 3300035090 Unclassified 748
297 Ga0373951_0034593 3300035091 Bacteria 1200
298 Ga0373932_0037407 3300035112 Unclassified 1383
299 Ga0373932_0156615 3300035112 Bacteria 785
300 Ga0373939_0044598 3300035114 Bacteria 1350
301 Ga0373941_0081587 3300035115 Bacteria 1093
302 Ga0395899_0171878 3300037312 Bacteria 1526
303 Ga0395900_0068642 3300037418 Bacteria 3643
304 Ga0395905_0017487 3300037471 Bacteria 6807
305 Ga0395905_0207808 3300037471 Bacteria 1835
306 Ga0395905_0266452 3300037471 Bacteria 1599
307 Ga0395901_0138497 3300038443 Bacteria 2558
308 Ga0439464_0200917 3300042439 Unclassified 636
309 Ga0439460_0010314 3300042461 Bacteria 2388
310 Ga0451577_0206872 3300042876 Bacteria 1772
311 Ga0451577_0481095 3300042876 Bacteria 1127
312 Ga0451577_0583369 3300042876 Bacteria 1015
313 Ga0453683_0215319 3300044673 Bacteria 1221
314 Ga0451576_0259685 3300045051 Bacteria 1815
315 Ga0451576_0884149 3300045051 Bacteria 937
316 Ga0495594_0293017 3300046499 Unclassified 927
317 Ga0495642_0190316 3300046528 Unclassified 894
318 Ga0495656_0261984 3300046615 Unclassified 876
319 Ga0495659_0056330 3300046664 Bacteria 1443
320 Ga0495669_0046196 3300046684 Bacteria 1943
321 Ga0495669_0098589 3300046684 Bacteria 1356
322 Ga0495636_0151104 3300047318 Bacteria 1042
323 Ga0496100_0873433 3300048903 Bacteria 706
324 Ga0496102_0069075 3300048905 Bacteria 3243
325 Ga0496106_0064340 3300048909 Bacteria 2790
326 Ga0496110_0106836 3300048913 Bacteria 2512
327 Ga0496110_0799554 3300048913 Bacteria 847
328 Ga0501031_0220394 3300049568 Bacteria 1235
329 Ga0501036_0365083 3300049572 Bacteria 1205
330 Ga0501037_0621463 3300049573 Bacteria 724
331 Ga0501038_0205571 3300049574 Bacteria 1578
332 Ga0501038_0359531 3300049574 Bacteria 1132
333 Ga0501038_0429782 3300049574 Bacteria 1018
334 Ga0501039_0300696 3300049575 Bacteria 1261
335 Ga0501039_0435642 3300049575 Bacteria 1029
336 Ga0501039_0724611 3300049575 Bacteria 777
337 Ga0501040_0002340 3300049576 Bacteria 12167
338 Ga0501040_0097993 3300049576 Bacteria 2043
339 Ga0501040_0140618 3300049576 Bacteria 1700
340 Ga0501040_0266024 3300049576 Bacteria 1224
341 Ga0501041_0030643 3300049577 Bacteria 3247
342 Ga0501041_0093500 3300049577 Bacteria 1857
343 Ga0501042_0208829 3300049578 Bacteria 1408
344 Ga0501042_0252260 3300049578 Bacteria 1273
345 Ga0501043_0097849 3300049579 Bacteria 2307
346 Ga0501043_0269215 3300049579 Bacteria 1308
347 Ga0501046_0149702 3300049580 Bacteria 1761
348 Ga0501046_0299193 3300049580 Bacteria 1175
349 Ga0501046_0316460 3300049580 Bacteria 1138
350 Ga0501046_0691557 3300049580 Archaea 719
351 Ga0501048_0050021 3300049582 Bacteria 2977
352 Ga0501048_0112241 3300049582 Bacteria 1925
353 Ga0501048_0239954 3300049582 Bacteria 1286
354 Ga0501067_0009738 3300049583 Bacteria 5319
355 Ga0501068_0395256 3300049584 Bacteria 891
356 Ga0501068_0652391 3300049584 Bacteria 687
357 Ga0501071_0079021 3300049587 Bacteria 2405
358 Ga0501071_0174418 3300049587 Bacteria 1610
359 Ga0501071_0355806 3300049587 Unclassified 1115
360 Ga0501072_0019990 3300049588 Bacteria 5185
361 Ga0501072_0060057 3300049588 Bacteria 2998
362 Ga0501072_0676199 3300049588 Bacteria 812
363 Ga0501072_0787069 3300049588 Unclassified 745
364 Ga0501073_0264986 3300049589 Bacteria 1186
365 Ga0501074_0044826 3300049590 Bacteria 3200
366 Ga0501074_0310999 3300049590 Bacteria 1119
367 Ga0501074_0405515 3300049590 Unclassified 967
368 Ga0501075_0011903 3300049591 Bacteria 6171
369 Ga0501075_0088260 3300049591 Bacteria 2351
370 Ga0501075_0099850 3300049591 Bacteria 2204
371 Ga0501075_0239742 3300049591 Bacteria 1382
372 Ga0501075_0405274 3300049591 Bacteria 1040
373 Ga0501075_0538506 3300049591 Unclassified 891
374 Ga0501076_0000831 3300049592 Bacteria 20044
375 Ga0501076_0003944 3300049592 Bacteria 10472
376 Ga0501076_0067189 3300049592 Bacteria 2862
377 Ga0501076_0195477 3300049592 Bacteria 1651
378 Ga0501076_0217123 3300049592 Bacteria 1563
379 Ga0501076_0320915 3300049592 Bacteria 1270
380 Ga0501076_0683595 3300049592 Unclassified 847
381 Ga0501077_0007379 3300049593 Bacteria 6777
382 Ga0501077_0183728 3300049593 Unclassified 1329
383 Ga0501077_0186395 3300049593 Bacteria 1318
384 Ga0501225_0102149 3300049705 Bacteria 839
385 Ga0501079_0011626 3300049741 Bacteria 6722
386 Ga0501079_0084525 3300049741 Bacteria 2455
387 Ga0501079_0165012 3300049741 Bacteria 1727
388 Ga0501079_0183887 3300049741 Bacteria 1631
389 Ga0501080_0104354 3300049742 Bacteria 2629
390 Ga0501080_0118634 3300049742 Bacteria 2453
391 Ga0501080_0161938 3300049742 Bacteria 2066
392 Ga0501080_0227900 3300049742 Bacteria 1704
393 Ga0501080_0529376 3300049742 Unclassified 1051
394 Ga0501081_0001826 3300049743 Bacteria 13182
395 Ga0501081_0002472 3300049743 Bacteria 11652
396 Ga0501081_0010638 3300049743 Bacteria 6009
397 Ga0501081_0218749 3300049743 Bacteria 1385
398 Ga0501081_0713618 3300049743 Unclassified 753
399 Ga0501083_0132646 3300049744 Bacteria 1633
400 Ga0501045_0008724 3300049824 Bacteria 7071
401 Ga0501045_0079400 3300049824 Bacteria 2419
402 Ga0501045_0170891 3300049824 Bacteria 1619
403 Ga0501045_0196184 3300049824 Bacteria 1504
404 Ga0501045_0244054 3300049824 Bacteria 1337
405 Ga0501045_0725249 3300049824 Bacteria 733
406 nmdc:mga05p37_115985_c1 3300050507 Bacteria 3292
407 nmdc:mga05p37_1245076_c1 3300050507 Unclassified 764
408 nmdc:mga05p37_155861_c1 3300050507 Bacteria 2791
409 nmdc:mga05p37_17395_c1 3300050507 Bacteria 8675
410 nmdc:mga05p37_1821_c1 3300050507 Bacteria 24853
411 nmdc:mga05p37_2476_c1 3300050507 Bacteria 21484
412 nmdc:mga05p37_30883_c1 3300050507 Bacteria 6539
413 nmdc:mga05p37_398270_c1 3300050507 Bacteria 1608
414 nmdc:mga05p37_42435_c1 3300050507 Bacteria 5589
415 nmdc:mga05p37_547764_c1 3300050507 Bacteria 1318
416 nmdc:mga05p37_7406_c1 3300050507 Bacteria 12949
417 nmdc:mga05p37_769_c1 3300050507 Bacteria 35683
418 nmdc:mga05p37_92449_c1 3300050507 Bacteria 3727
419 nmdc:mga05p37_95179_c1 3300050507 Bacteria 1899
420 nmdc:mga05p37_96499_c1 3300050507 Bacteria 3642
421 nmdc:mga09592_144854_c1 3300050508 Bacteria 2048
422 nmdc:mga09592_14652_c1 3300050508 Bacteria 6397
423 nmdc:mga09592_1944_c1 3300050508 Bacteria 16641
424 nmdc:mga09592_218704_c1 3300050508 Bacteria 1651
425 nmdc:mga09592_226520_c1 3300050508 Bacteria 1620
426 nmdc:mga09592_2581_c1 3300050508 Bacteria 14667
427 nmdc:mga09592_3878_c1 3300050508 Bacteria 12046
428 nmdc:mga09592_5317_c1 3300050508 Bacteria 10464
429 nmdc:mga09592_54900_c1 3300050508 Bacteria 3366
430 nmdc:mga0qj67_1433_c1 3300050509 Bacteria 16698
431 nmdc:mga0qj67_291779_c1 3300050509 Bacteria 1322
432 nmdc:mga0qj67_379638_c1 3300050509 Bacteria 1141
433 nmdc:mga0qj67_541015_c1 3300050509 Bacteria 935
434 nmdc:mga0qj67_60996_c1 3300050509 Bacteria 2994
435 nmdc:mga0qj67_7809_c1 3300050509 Bacteria 7907
436 nmdc:mga06r32_203185_c1 3300050510 Bacteria 1969
437 nmdc:mga06r32_225659_c1 3300050510 Bacteria 1862
438 nmdc:mga06r32_2396_c1 3300050510 Bacteria 16781
439 nmdc:mga06r32_313253_c1 3300050510 Bacteria 1555
440 nmdc:mga06r32_3786_c1 3300050510 Bacteria 13535
441 nmdc:mga06r32_443267_c1 3300050510 Bacteria 1278
442 nmdc:mga06r32_5775_c1 3300050510 Bacteria 11151
443 nmdc:mga06r32_68349_c1 3300050510 Bacteria 3432
444 nmdc:mga06r32_6924_c1 3300050510 Bacteria 10194
445 nmdc:mga06r32_70286_c1 3300050510 Bacteria 3385
446 nmdc:mga06r32_7977_c1 3300050510 Bacteria 9516
447 nmdc:mga06r32_931185_c1 3300050510 Bacteria 824
448 nmdc:mga08y16_1110536_c1 3300050511 Unclassified 765
449 nmdc:mga08y16_123507_c1 3300050511 Bacteria 2694
450 nmdc:mga08y16_149523_c1 3300050511 Bacteria 2428
451 nmdc:mga08y16_17787_c1 3300050511 Bacteria 7488
452 nmdc:mga08y16_243078_c1 3300050511 Bacteria 1860
453 nmdc:mga08y16_390636_c1 3300050511 Bacteria 1425
454 nmdc:mga08y16_49615_c1 3300050511 Bacteria 4393
455 nmdc:mga08y16_83078_c1 3300050511 Bacteria 3338
456 nmdc:mga0n895_1024627_c1 3300050512 Bacteria 806
457 nmdc:mga0n895_109152_c1 3300050512 Bacteria 2782
458 nmdc:mga0n895_1214_c1 3300050512 Bacteria 19023
459 nmdc:mga0n895_20754_c1 3300050512 Bacteria 6133
460 nmdc:mga0n895_232758_c1 3300050512 Bacteria 1870
461 nmdc:mga0n895_46940_c1 3300050512 Bacteria 4222
462 nmdc:mga0n895_60106_c1 3300050512 Bacteria 3750
463 nmdc:mga0n895_86246_c1 3300050512 Bacteria 3136
464 nmdc:mga0rr50_118551_c1 3300050513 Bacteria 2103
465 nmdc:mga0rr50_13734_c1 3300050513 Bacteria 5286
466 nmdc:mga0rr50_46560_c1 3300050513 Bacteria 3194
467 nmdc:mga0rr50_549_c1 3300050513 Bacteria 20121
468 nmdc:mga08x19_16828_c1 3300050514 Bacteria 4465
469 nmdc:mga08x19_1724_c1 3300050514 Bacteria 13452
470 nmdc:mga08x19_174249_c1 3300050514 Unclassified 1466
471 nmdc:mga0a205_106355_c1 3300050515 Bacteria 2704
472 nmdc:mga0a205_1170_c1 3300050515 Bacteria 21857
473 nmdc:mga0a205_1627_c1 3300050515 Bacteria 19317
474 nmdc:mga0a205_227_c1 3300050515 Bacteria 39744
475 nmdc:mga0a205_289101_c1 3300050515 Bacteria 1514
476 nmdc:mga0a205_336025_c1 3300050515 Bacteria 1380
477 nmdc:mga0a205_56926_c1 3300050515 Bacteria 3775
478 nmdc:mga0a205_6155_c1 3300050515 Bacteria 3270
479 nmdc:mga0a205_68336_c1 3300050515 Bacteria 3432
480 nmdc:mga0a205_8978_c1 3300050515 Bacteria 9109
481 Ga0501084_0021862 3300054114 Bacteria 5334
482 Ga0501084_0023135 3300054114 Bacteria 5187
483 Ga0501084_0026115 3300054114 Bacteria 4872
484 Ga0501084_0066027 3300054114 Bacteria 3027
485 Ga0501082_0003845 3300060353 Bacteria 13129
486 Ga0501082_0155650 3300060353 Bacteria 1986
487 Ga0530510_0012598 3300061734 Bacteria 5944
488 Ga0530510_0022860 3300061734 Bacteria 4456
489 Ga0530510_0098316 3300061734 Bacteria 2140
490 Ga0530510_0325754 3300061734 Bacteria 1152
491 Ga0530510_0647978 3300061734 Bacteria 804
492 Ga0075431_100001270
493 JGI24746J21847_1001951
494 JGI24745J21846_1010929
495 JGI24035J26624_1021093
496 JGI25406J46586_10011300
497 Ga0065715_10162957
498 Ga0065707_10390774
499 Ga0070676_10074028
500 Ga0070690_100082077
501 Ga0070690_101094629
502 Ga0070677_10002331
503 Ga0068869_100258101
504 Ga0070666_10029185
505 Ga0070680_100411165
506 Ga0070689_100179427
507 Ga0070687_100015745
508 Ga0070668_100021604
509 Ga0070668_100044110
510 Ga0070669_100012365
511 Ga0070669_100031693
512 Ga0070675_100252044
513 Ga0070675_100565990
514 Ga0070673_100124601
515 Ga0070688_100048283
516 Ga0070659_100102975
517 Ga0070667_100034478
518 Ga0070701_10038494
519 Ga0070705_100195712
520 Ga0070705_100218810
521 Ga0070708_100042179
522 Ga0070708_100086704
523 Ga0070708_100329876
524 Ga0070708_100996774
525 Ga0070678_100016025
526 Ga0070662_100006443
527 Ga0070662_101017438
528 Ga0068867_100030066
529 Ga0068867_100897905
530 Ga0070685_10045159
531 Ga0070706_100008450
532 Ga0070706_100577870
533 Ga0070706_100620262
534 Ga0070707_100000729
535 Ga0070707_100045468
536 Ga0070707_100077890
537 Ga0070707_100138098
538 Ga0070707_100603894
539 Ga0070698_100004426
540 Ga0070698_100282480
541 Ga0070699_100000534
542 Ga0070699_100003941
543 Ga0070699_100080194
544 Ga0070699_100174329
545 Ga0070699_100234239
546 Ga0070699_100509393
547 Ga0070699_100583625
548 Ga0070699_100893964
549 Ga0070679_100158348
550 Ga0070684_100829224
551 Ga0070697_100001086
552 Ga0070697_100047520
553 Ga0070697_100048568
554 Ga0070697_100099340
555 Ga0070697_100274192
556 Ga0070697_100294054
557 Ga0068853_100601448
558 Ga0070672_100014619
559 Ga0070672_100049360
560 Ga0070686_100116357
561 Ga0070695_100063589
562 Ga0070696_100018685
563 Ga0070696_100092008
564 Ga0070696_100544939
565 Ga0070693_100074595
566 Ga0070704_100043338
567 Ga0070704_100118148
568 Ga0070704_100224808
569 Ga0070704_100307111
570 Ga0070664_100024184
571 Ga0068854_100279027
572 Ga0068852_101182625
573 Ga0068859_100065876
574 Ga0068859_100524987
575 Ga0068864_100170777
576 Ga0068866_10303690
577 Ga0068861_100096593
578 Ga0068861_100178774
579 Ga0068861_100548868
580 Ga0068870_10002979
581 Ga0068863_100025327
582 Ga0068863_100873616
583 Ga0068858_100034467
584 Ga0068860_100083585
585 Ga0068860_100159168
586 Ga0068862_100039181
587 Ga0068862_100182182
588 Ga0068862_100558532
589 Ga0068862_100595566
590 Ga0081455_10064100
591 Ga0081538_10003260
592 Ga0081540_1019869
593 Ga0081539_10000454
594 Ga0097621_100070646
595 Ga0068871_100200215
596 Ga0068871_100991748
597 Ga0075428_100004648
598 Ga0075428_100006929
599 Ga0075428_100123681
600 Ga0075428_100197201
601 Ga0075428_100336358
602 Ga0075428_100446829
603 Ga0075428_100842536
604 Ga0075430_100003492
605 Ga0075430_100012886
606 Ga0075430_100019472
607 Ga0075430_100028925
608 Ga0075430_100029617
609 Ga0075430_100032620
610 Ga0075430_100188262
611 Ga0075430_100345004
612 Ga0075431_100000082
613 Ga0075431_100000455
614 Ga0075431_100001687
615 Ga0075431_100001936
616 Ga0075431_100052800
617 Ga0075431_100227399
618 Ga0075431_100759265
619 Ga0075431_101011398
620 Ga0075433_10000061
621 Ga0075433_10000427
622 Ga0075433_10005550
623 Ga0075433_10059591
624 Ga0075433_10181580
625 Ga0075433_10258382
626 Ga0075433_10270537
627 Ga0075433_10337826
628 Ga0075433_10358774
629 Ga0075433_10807578
630 Ga0075433_11104542
631 Ga0075434_100000180
632 Ga0075434_100017104
633 Ga0075434_100040188
634 Ga0075434_100073024
635 Ga0075434_100085881
636 Ga0075434_100094218
637 Ga0075434_100119131
638 Ga0075434_100165276
639 Ga0075434_100309702
640 Ga0075434_100451075
641 Ga0075429_100002106
642 Ga0075429_100002213
643 Ga0075429_100002798
644 Ga0075429_100002856
645 Ga0075429_100023887
646 Ga0075429_100064236
647 Ga0075429_100181246
648 Ga0075429_100197369
649 Ga0075429_100803774
650 Ga0075429_100874527
651 Ga0068865_100100613
652 Ga0068865_100219178
653 Ga0068865_100919620
654 Ga0075436_100002146
655 Ga0075436_100144567
656 Ga0097620_100065876
657 Ga0097620_100524995
658 Ga0075435_100017542
659 Ga0075435_100051710
660 Ga0075435_100063505
661 Ga0075435_100099992
662 Ga0075435_100333209
663 Ga0075435_100387527
664 Ga0111539_10006594
665 Ga0111539_10012644
666 Ga0111539_10250103
667 Ga0111539_11218257
668 Ga0114129_10000110
669 Ga0114129_10000936
670 Ga0114129_10002179
671 Ga0114129_10013658
672 Ga0114129_10020399
673 Ga0114129_10044379
674 Ga0114129_10085483
675 Ga0114129_10114857
676 Ga0114129_10211158
677 Ga0114129_10413676
678 Ga0114129_10445810
679 Ga0114129_10735289
680 Ga0114129_10750296
681 Ga0114129_10797536
682 Ga0114129_11037305
683 Ga0114129_11340586
684 Ga0105243_10016133
685 Ga0105241_10041676
686 Ga0105242_10344983
687 Ga0105248_10194352
688 Ga0105248_10395701
689 Ga0105248_10463107
690 Ga0105249_10008153
691 Ga0105249_10732399
692 Ga0105239_10612823
693 Ga0157378_10060912
694 Ga0157378_10972879
695 Ga0163162_10055861
696 Ga0163162_10103890
697 Ga0163162_10672215
698 Ga0157375_10137022
699 Ga0157375_10374942
700 Ga0157380_10003226
701 Ga0157377_10005724
702 Ga0157379_10181268
703 Ga0157379_10433169
704 Ga0157376_10435855
705 Ga0163161_10104805
706 Ga0163161_10120352
707 Ga0207673_1012930
708 Ga0207697_10001435
709 Ga0207682_10003116
710 Ga0207688_10001607
711 Ga0207680_10023261
712 Ga0207645_10008679
713 Ga0207643_10000732
714 Ga0207643_10016950
715 Ga0207643_10155728
716 Ga0207684_10000279
717 Ga0207684_10018762
718 Ga0207684_10270741
719 Ga0207684_10319722
720 Ga0207684_10474242
721 Ga0207654_10058214
722 Ga0207663_10241733
723 Ga0207660_10318513
724 Ga0207662_10039826
725 Ga0207649_10041050
726 Ga0207646_10001682
727 Ga0207646_10027725
728 Ga0207646_10039239
729 Ga0207646_10063999
730 Ga0207646_10284741
731 Ga0207646_10340453
732 Ga0207681_10008334
733 Ga0207681_10294417
734 Ga0207659_10071452
735 Ga0207644_10087713
736 Ga0207690_10166105
737 Ga0207706_10334375
738 Ga0207706_10373711
739 Ga0207686_10340996
740 Ga0207709_10274742
741 Ga0207670_10181069
742 Ga0207691_10010524
743 Ga0207691_10035245
744 Ga0207691_10934904
745 Ga0207711_10499914
746 Ga0207689_10091644
747 Ga0207679_10010677
748 Ga0207651_10121224
749 Ga0207712_10115092
750 Ga0207712_10135770
751 Ga0207668_10086619
752 Ga0207677_10145337
753 Ga0207708_10086171
754 Ga0207648_10082063
755 Ga0207648_10091646
756 Ga0207648_10129111
757 Ga0207676_10062298
758 Ga0207674_10185820
759 Ga0207674_10231648
760 Ga0207675_100012281
761 Ga0207675_100033594
762 Ga0207675_100404881
763 Ga0207683_10007833
764 Ga0207698_11899713
765 Ga0210002_1033299
766 Ga0209971_1099388
767 Ga0209974_10029136
768 Ga0207428_10000027
769 Ga0207428_10008043
770 Ga0207428_10020343
771 Ga0207428_10148466
772 Ga0268265_10031665
773 Ga0268265_10213693
774 Ga0268265_10322867
775 Ga0268264_10323716
776 Ga0307408_100023380
777 Ga0307408_100054771
778 Ga0307408_100507328
779 Ga0307405_10892239
780 Ga0307413_10425550
781 Ga0307406_10341647
782 Ga0307407_10043399
783 Ga0307409_100106896
784 Ga0307415_100321864
785 Ga0373928_0106101
786 Ga0373940_0163321
787 Ga0373949_0115688
788 Ga0373951_0034593
789 Ga0373932_0037407
790 Ga0373932_0156615
791 Ga0373939_0044598
792 Ga0373941_0081587
793 Ga0395899_0171878
794 Ga0395900_0068642
795 Ga0395905_0017487
796 Ga0395905_0207808
797 Ga0395905_0266452
798 Ga0395901_0138497
799 Ga0439464_0200917
800 Ga0439460_0010314
801 Ga0451577_0206872
802 Ga0451577_0481095
803 Ga0451577_0583369
804 Ga0453683_0215319
805 Ga0451576_0259685
806 Ga0451576_0884149
807 Ga0495594_0293017
808 Ga0495642_0190316
809 Ga0495656_0261984
810 Ga0495659_0056330
811 Ga0495669_0046196
812 Ga0495669_0098589
813 Ga0495636_0151104
814 Ga0496100_0873433
815 Ga0496102_0069075
816 Ga0496106_0064340
817 Ga0496110_0106836
818 Ga0496110_0799554
819 Ga0501031_0220394
820 Ga0501036_0365083
821 Ga0501037_0621463
822 Ga0501038_0205571
823 Ga0501038_0359531
824 Ga0501038_0429782
825 Ga0501039_0300696
826 Ga0501039_0435642
827 Ga0501039_0724611
828 Ga0501040_0002340
829 Ga0501040_0097993
830 Ga0501040_0140618
831 Ga0501040_0266024
832 Ga0501041_0030643
833 Ga0501041_0093500
834 Ga0501042_0208829
835 Ga0501042_0252260
836 Ga0501043_0097849
837 Ga0501043_0269215
838 Ga0501046_0149702
839 Ga0501046_0299193
840 Ga0501046_0316460
841 Ga0501046_0691557
842 Ga0501048_0050021
843 Ga0501048_0112241
844 Ga0501048_0239954
845 Ga0501067_0009738
846 Ga0501068_0395256
847 Ga0501068_0652391
848 Ga0501071_0079021
849 Ga0501071_0174418
850 Ga0501071_0355806
851 Ga0501072_0019990
852 Ga0501072_0060057
853 Ga0501072_0676199
854 Ga0501072_0787069
855 Ga0501073_0264986
856 Ga0501074_0044826
857 Ga0501074_0310999
858 Ga0501074_0405515
859 Ga0501075_0011903
860 Ga0501075_0088260
861 Ga0501075_0099850
862 Ga0501075_0239742
863 Ga0501075_0405274
864 Ga0501075_0538506
865 Ga0501076_0000831
866 Ga0501076_0003944
867 Ga0501076_0067189
868 Ga0501076_0195477
869 Ga0501076_0217123
870 Ga0501076_0320915
871 Ga0501076_0683595
872 Ga0501077_0007379
873 Ga0501077_0183728
874 Ga0501077_0186395
875 Ga0501225_0102149
876 Ga0501079_0011626
877 Ga0501079_0084525
878 Ga0501079_0165012
879 Ga0501079_0183887
880 Ga0501080_0104354
881 Ga0501080_0118634
882 Ga0501080_0161938
883 Ga0501080_0227900
884 Ga0501080_0529376
885 Ga0501081_0001826
886 Ga0501081_0002472
887 Ga0501081_0010638
888 Ga0501081_0218749
889 Ga0501081_0713618
890 Ga0501083_0132646
891 Ga0501045_0008724
892 Ga0501045_0079400
893 Ga0501045_0170891
894 Ga0501045_0196184
895 Ga0501045_0244054
896 Ga0501045_0725249
897 nmdc:mga05p37_115985_c1
898 nmdc:mga05p37_1245076_c1
899 nmdc:mga05p37_155861_c1
900 nmdc:mga05p37_17395_c1
901 nmdc:mga05p37_1821_c1
902 nmdc:mga05p37_2476_c1
903 nmdc:mga05p37_30883_c1
904 nmdc:mga05p37_398270_c1
905 nmdc:mga05p37_42435_c1
906 nmdc:mga05p37_547764_c1
907 nmdc:mga05p37_7406_c1
908 nmdc:mga05p37_769_c1
909 nmdc:mga05p37_92449_c1
910 nmdc:mga05p37_95179_c1
911 nmdc:mga05p37_96499_c1
912 nmdc:mga09592_144854_c1
913 nmdc:mga09592_14652_c1
914 nmdc:mga09592_1944_c1
915 nmdc:mga09592_218704_c1
916 nmdc:mga09592_226520_c1
917 nmdc:mga09592_2581_c1
918 nmdc:mga09592_3878_c1
919 nmdc:mga09592_5317_c1
920 nmdc:mga09592_54900_c1
921 nmdc:mga0qj67_1433_c1
922 nmdc:mga0qj67_291779_c1
923 nmdc:mga0qj67_379638_c1
924 nmdc:mga0qj67_541015_c1
925 nmdc:mga0qj67_60996_c1
926 nmdc:mga0qj67_7809_c1
927 nmdc:mga06r32_203185_c1
928 nmdc:mga06r32_225659_c1
929 nmdc:mga06r32_2396_c1
930 nmdc:mga06r32_313253_c1
931 nmdc:mga06r32_3786_c1
932 nmdc:mga06r32_443267_c1
933 nmdc:mga06r32_5775_c1
934 nmdc:mga06r32_68349_c1
935 nmdc:mga06r32_6924_c1
936 nmdc:mga06r32_70286_c1
937 nmdc:mga06r32_7977_c1
938 nmdc:mga06r32_931185_c1
939 nmdc:mga08y16_1110536_c1
940 nmdc:mga08y16_123507_c1
941 nmdc:mga08y16_149523_c1
942 nmdc:mga08y16_17787_c1
943 nmdc:mga08y16_243078_c1
944 nmdc:mga08y16_390636_c1
945 nmdc:mga08y16_49615_c1
946 nmdc:mga08y16_83078_c1
947 nmdc:mga0n895_1024627_c1
948 nmdc:mga0n895_109152_c1
949 nmdc:mga0n895_1214_c1
950 nmdc:mga0n895_20754_c1
951 nmdc:mga0n895_232758_c1
952 nmdc:mga0n895_46940_c1
953 nmdc:mga0n895_60106_c1
954 nmdc:mga0n895_86246_c1
955 nmdc:mga0rr50_118551_c1
956 nmdc:mga0rr50_13734_c1
957 nmdc:mga0rr50_46560_c1
958 nmdc:mga0rr50_549_c1
959 nmdc:mga08x19_16828_c1
960 nmdc:mga08x19_1724_c1
961 nmdc:mga08x19_174249_c1
962 nmdc:mga0a205_106355_c1
963 nmdc:mga0a205_1170_c1
964 nmdc:mga0a205_1627_c1
965 nmdc:mga0a205_227_c1
966 nmdc:mga0a205_289101_c1
967 nmdc:mga0a205_336025_c1
968 nmdc:mga0a205_56926_c1
969 nmdc:mga0a205_6155_c1
970 nmdc:mga0a205_68336_c1
971 nmdc:mga0a205_8978_c1
972 Ga0501084_0021862
973 Ga0501084_0023135
974 Ga0501084_0026115
975 Ga0501084_0066027
976 Ga0501082_0003845
977 Ga0501082_0155650
978 Ga0530510_0012598
979 Ga0530510_0022860
980 Ga0530510_0098316
981 Ga0530510_0325754
982 Ga0530510_0647978

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map