F454036

General Info

Members Datasets Scaffolds Average Seq Length
491 295 464 353

Family's Representative Sequence

Representative Sequence 3300000549|LJQas_1000586|LJQas_10005867
Length 405
Sequence LTASWTRRRPVSRGNRPKPGWSEQNGTVMPEQMSQHTSVFSGQRRQTQKLRAHPGEPSHGPLTAEELQLAVRNHSMPLEALRSDITPPGLHYLLTHFDIPFIDADHWHLRIGGAVQRSLELSLRALRRAPSISVPVTLECGGNGRSLLRPRPLSQPWMLEGVGTATWTGVPLAYLLAQARVDDDAVEVVFTGADTGIQGGVRQQYARSLPIAEALRPDVVLAYRMNDSDLPPQHGYPLRLVVPGWYGMASVKWLSSVKVVTKPFDGFQQSVAYRYQQDADDAGTPVTWIKVRSLMIPPGVPDFFTRRRILPAGPVMLRGRAWSGEGAVQRVDVGIDGKWAPAHLEHPAAPFAWCAWTIPWVADPGEHELSCRATDASGAVQPLEPVWNYQGVGNNVVQRVKVSVE

Samples

Sample ID Description Type Environment
1 2690315906 Arthrobacter sp. OY3WO11 Isolate Unclassified
2 2808606357 Arthrobacter sp. SLBN-122 Isolate Unclassified
3 2808606360 Arthrobacter sp. SLBN-112 Isolate Unclassified
4 2808606366 Arthrobacter sp. SLBN-83 Isolate Unclassified
5 2808606370 Arthrobacter sp. SLBN-100 Isolate Unclassified
6 2808606371 Arthrobacter sp. SLBN-53 Isolate Unclassified
7 2811994871 Arthrobacter sp. SLBN-179 Isolate Unclassified
8 2857740372 Paenarthrobacter sp. R-74611 Isolate Unclassified
9 2904497146 Arthrobacter sp. 1276 Isolate Rhizosphere
10 2904776348 Paenarthrobacter sp. 1092 Isolate Rhizosphere
11 2910809715 Paenarthrobacter sp. CM16 Isolate Unclassified
12 2919034639 Paenarthrobacter nitroguajacolicus 247 Isolate Rhizosphere
13 2919059106 Arthrobacter sp. 1088 Isolate Rhizosphere
14 2919391150 Arthrobacter ipis 2973 Isolate Unclassified
15 2919538618 Paenarthrobacter nitroguajacolicus 3945 Isolate Unclassified
16 2932426870 Paenarthrobacter sp. 4246 Isolate Rhizosphere
17 2939598168 Arthrobacter sp. 754 Isolate Rhizosphere
18 2939647034 Arthrobacter sp. 2762 Isolate Rhizosphere
19 2939674588 Arthrobacter bambusae 3552 Isolate Rhizosphere
20 2945916053 Arthrobacter ulcerisalmonis W1I2 Isolate Rhizosphere
21 2945941187 Arthrobacter pascens W1I14 Isolate Rhizosphere
22 2945956166 Arthrobacter globiformus W2I3 Isolate Rhizosphere
23 2946037020 Arthrobacter sp. W4I7 Isolate Rhizosphere
24 2946059875 Arthrobacter sp. SLBN-112 Isolate Rhizosphere
25 2953998280 Pseudarthrobacter sp. W1I19 Isolate Rhizosphere
26 2974302888 Pseudarthrobacter sp. SORGH_AS 212 Isolate Unclassified
27 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
28 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
29 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
30 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
31 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
32 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
33 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
34 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
35 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
36 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
37 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
38 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
39 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
40 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
41 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
42 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
43 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
44 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
45 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
46 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
47 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
48 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
49 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
50 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
51 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
52 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
53 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
54 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
55 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
56 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
57 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
58 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
59 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
60 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
61 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
62 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
63 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
64 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
65 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
72 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
73 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
74 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
75 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
76 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
77 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
79 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
80 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
81 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
82 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
83 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
84 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
85 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
86 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
87 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
89 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
90 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
91 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
93 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
95 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
96 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
97 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
98 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
99 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
100 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
101 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
102 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
103 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
104 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
105 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
106 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
107 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
108 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
109 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
146 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
149 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
150 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
151 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
152 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
153 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
154 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
155 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
156 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
157 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
158 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
159 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
160 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
161 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
162 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
163 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
164 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
165 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
166 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
167 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
168 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
169 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
170 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
171 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
172 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
173 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
174 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
175 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
176 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
177 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
178 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
179 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
180 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
181 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
182 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
183 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
184 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
185 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
186 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
187 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
188 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
189 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
190 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
191 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
192 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
193 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
194 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
195 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
196 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
197 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
198 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
199 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
200 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
201 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
202 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
203 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
204 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
205 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
206 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
207 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
208 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
209 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
210 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
211 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
212 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
213 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
214 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
215 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
216 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
217 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
218 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
219 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
220 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
221 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
222 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
223 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
224 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
225 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
226 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
227 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
228 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
229 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
230 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
231 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
232 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
233 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
234 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
235 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
236 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
237 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
238 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
239 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
240 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
241 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
242 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
243 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
244 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
245 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
246 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
247 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
248 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
249 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
250 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
251 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
252 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
253 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
254 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
255 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
256 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
257 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
258 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
259 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
264 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
267 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
270 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
271 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
272 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
273 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
274 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
275 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
276 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
277 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
278 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
279 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
280 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
281 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
282 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
283 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
284 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
285 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
286 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
287 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
288 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
289 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
290 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
291 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
292 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
293 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
294 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
295 8054107350 Arthrobacter rhizosphaerae CCNWLXL 1-35 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.5
Metatranscriptomes 0
Isolates 5.5

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.41
Nodule 0
Rhizoplane 5.5
Rhizosphere 91.04
Stem 0
Stem Tuber 0
Unclassified 3.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1000586 3300000549 Bacteria 5913
2 rootH2_10130506 3300003320 Bacteria 2095
3 rootH2_10144228 3300003320 Bacteria 2523
4 Ga0070670_100024368 3300005331 Bacteria 5203
5 Ga0070677_10026182 3300005333 Bacteria 2184
6 Ga0068869_100005227 3300005334 Bacteria 8153
7 Ga0070666_10048583 3300005335 Bacteria 2851
8 Ga0070680_100001936 3300005336 Bacteria 15218
9 Ga0070682_100001084 3300005337 Bacteria 15675
10 Ga0068868_100003103 3300005338 Bacteria 11561
11 Ga0070689_100000317 3300005340 Bacteria 28150
12 Ga0070689_100124432 3300005340 Bacteria 2062
13 Ga0070691_10000355 3300005341 Bacteria 16420
14 Ga0070687_100000251 3300005343 Bacteria 18294
15 Ga0070692_10019493 3300005345 Bacteria 3273
16 Ga0070675_100157289 3300005354 Bacteria 1952
17 Ga0070671_100269501 3300005355 Bacteria 1447
18 Ga0070667_100097731 3300005367 Bacteria 2533
19 Ga0070703_10012155 3300005406 Bacteria 2438
20 Ga0070701_10000853 3300005438 Bacteria 10941
21 Ga0070705_100000115 3300005440 Bacteria 45886
22 Ga0070700_100000903 3300005441 Bacteria 14651
23 Ga0070694_100000066 3300005444 Bacteria 49292
24 Ga0070694_100064230 3300005444 Bacteria 2512
25 Ga0070694_100160928 3300005444 Bacteria 1647
26 Ga0070708_100002210 3300005445 Bacteria 15041
27 Ga0070708_100008673 3300005445 Bacteria 8169
28 Ga0070708_100032831 3300005445 Bacteria 4505
29 Ga0070708_100278160 3300005445 Bacteria 1575
30 Ga0070678_100056995 3300005456 Bacteria 2860
31 Ga0068867_100000422 3300005459 Bacteria 28308
32 Ga0070706_100000036 3300005467 Bacteria 151766
33 Ga0070706_100040024 3300005467 Bacteria 4327
34 Ga0070706_100085561 3300005467 Bacteria 2922
35 Ga0070707_100008469 3300005468 Bacteria 9553
36 Ga0070707_100027499 3300005468 Bacteria 5411
37 Ga0070707_100093590 3300005468 Bacteria 2909
38 Ga0070707_100402173 3300005468 Bacteria 1329
39 Ga0070707_100423806 3300005468 Bacteria 1291
40 Ga0070698_100000198 3300005471 Bacteria 57734
41 Ga0070698_100038027 3300005471 Bacteria 4960
42 Ga0070699_100000052 3300005518 Bacteria 111597
43 Ga0070679_100041110 3300005530 Bacteria 4603
44 Ga0070697_100008358 3300005536 Bacteria 8076
45 Ga0070697_100008599 3300005536 Bacteria 7971
46 Ga0070697_100011227 3300005536 Bacteria 7001
47 Ga0070697_100017456 3300005536 Bacteria 5647
48 Ga0070697_100084088 3300005536 Bacteria 2624
49 Ga0070697_100179746 3300005536 Bacteria 1793
50 Ga0070672_100101753 3300005543 Bacteria 2331
51 Ga0070686_100000167 3300005544 Bacteria 45886
52 Ga0070695_100000164 3300005545 Bacteria 31583
53 Ga0070695_100007139 3300005545 Bacteria 6622
54 Ga0070695_100078205 3300005545 Bacteria 2181
55 Ga0070696_100000739 3300005546 Bacteria 20870
56 Ga0070696_100000933 3300005546 Bacteria 18945
57 Ga0070693_100000323 3300005547 Bacteria 22003
58 Ga0070704_100000093 3300005549 Bacteria 30795
59 Ga0068855_100005066 3300005563 Bacteria 16071
60 Ga0068854_100025736 3300005578 Bacteria 4037
61 Ga0070702_100003437 3300005615 Bacteria 7084
62 Ga0068859_100013618 3300005617 Bacteria 8153
63 Ga0068859_100070993 3300005617 Bacteria 3518
64 Ga0068864_100011897 3300005618 Bacteria 7185
65 Ga0068858_100005171 3300005842 Bacteria 12778
66 Ga0068860_100003453 3300005843 Bacteria 16255
67 Ga0068862_100001425 3300005844 Bacteria 22156
68 Ga0081455_10042572 3300005937 Bacteria 3981
69 Ga0081538_10005326 3300005981 Bacteria 11582
70 Ga0070717_10000105 3300006028 Bacteria 66343
71 Ga0070717_10042070 3300006028 Bacteria 3727
72 Ga0075365_10008218 3300006038 Bacteria 5905
73 Ga0075432_10018835 3300006058 Bacteria 2356
74 Ga0070716_100034944 3300006173 Bacteria 2760
75 Ga0097621_100003699 3300006237 Bacteria 10581
76 Ga0068871_100000965 3300006358 Bacteria 19218
77 Ga0075428_100000502 3300006844 Bacteria 39707
78 Ga0075428_100071259 3300006844 Bacteria 3799
79 Ga0075428_100141150 3300006844 Bacteria 2619
80 Ga0075428_100336606 3300006844 Bacteria 1621
81 Ga0075430_100000620 3300006846 Bacteria 27115
82 Ga0075430_100008701 3300006846 Bacteria 8565
83 Ga0075430_100053261 3300006846 Bacteria 3407
84 Ga0075431_100007715 3300006847 Bacteria 10716
85 Ga0075431_100220054 3300006847 Bacteria 1937
86 Ga0075433_10000611 3300006852 Bacteria 23830
87 Ga0075433_10008931 3300006852 Bacteria 8001
88 Ga0075433_10015296 3300006852 Bacteria 6288
89 Ga0075433_10068436 3300006852 Bacteria 3117
90 Ga0075433_10248490 3300006852 Bacteria 1578
91 Ga0075433_10343031 3300006852 Bacteria 1320
92 Ga0075434_100000406 3300006871 Bacteria 31740
93 Ga0075434_100000420 3300006871 Bacteria 31423
94 Ga0075434_100001960 3300006871 Bacteria 17843
95 Ga0075434_100004191 3300006871 Bacteria 12920
96 Ga0075434_100037772 3300006871 Bacteria 4781
97 Ga0075434_100154967 3300006871 Bacteria 2311
98 Ga0075434_100156318 3300006871 Unclassified 2299
99 Ga0075429_100006458 3300006880 Bacteria 10155
100 Ga0068865_100000043 3300006881 Bacteria 70962
101 Ga0075436_100000513 3300006914 Bacteria 25110
102 Ga0075436_100251135 3300006914 Bacteria 1259
103 Ga0097620_100013618 3300006931 Bacteria 8153
104 Ga0097620_100070993 3300006931 Bacteria 3518
105 Ga0075435_100000668 3300007076 Bacteria 21181
106 Ga0075435_100022097 3300007076 Bacteria 4905
107 Ga0075435_100023865 3300007076 Bacteria 4738
108 Ga0075435_100025101 3300007076 Bacteria 4636
109 Ga0075435_100059147 3300007076 Bacteria 3106
110 Ga0075435_100088147 3300007076 Bacteria 2557
111 Ga0105251_10057927 3300009011 Bacteria 1830
112 Ga0105244_10011440 3300009036 Bacteria 5321
113 Ga0111539_10025953 3300009094 Bacteria 7173
114 Ga0111539_10033795 3300009094 Bacteria 6206
115 Ga0105245_10002730 3300009098 Bacteria 15887
116 Ga0105245_10021533 3300009098 Bacteria 5657
117 Ga0114129_10000393 3300009147 Bacteria 51077
118 Ga0114129_10017768 3300009147 Bacteria 10127
119 Ga0114129_10101226 3300009147 Bacteria 3987
120 Ga0114129_10102635 3300009147 Bacteria 3955
121 Ga0114129_10666112 3300009147 Bacteria 1341
122 Ga0105243_10002483 3300009148 Bacteria 15383
123 Ga0105243_10066999 3300009148 Bacteria 2889
124 Ga0105243_10086908 3300009148 Bacteria 2565
125 Ga0105241_10060798 3300009174 Bacteria 2907
126 Ga0105242_10000296 3300009176 Bacteria 39554
127 Ga0105248_10058291 3300009177 Bacteria 4337
128 Ga0105248_10155338 3300009177 Bacteria 2582
129 Ga0105249_10013242 3300009553 Bacteria 7279
130 Ga0105239_10100776 3300010375 Bacteria 3195
131 Ga0105246_10012860 3300011119 Bacteria 5234
132 Ga0105246_10013182 3300011119 Bacteria 5176
133 Ga0157371_10042930 3300013102 Bacteria 3222
134 Ga0157369_10118773 3300013105 Bacteria 2806
135 Ga0157369_10151684 3300013105 Bacteria 2449
136 Ga0157378_10000140 3300013297 Bacteria 67335
137 Ga0157378_10065443 3300013297 Bacteria 3254
138 Ga0163162_10034362 3300013306 Bacteria 5046
139 Ga0157375_10148212 3300013308 Bacteria 2479
140 Ga0163163_10092245 3300014325 Bacteria 3043
141 Ga0163163_10167940 3300014325 Bacteria 2240
142 Ga0157379_10136603 3300014968 Bacteria 2209
143 Ga0157376_10001393 3300014969 Bacteria 15896
144 Ga0209051_1008918 3300025303 Bacteria 5239
145 Ga0207697_10001206 3300025315 Bacteria 14167
146 Ga0207697_10006018 3300025315 Bacteria 5551
147 Ga0207655_1013460 3300025728 Bacteria 4696
148 Ga0207655_1036831 3300025728 Bacteria 2164
149 Ga0207655_1040046 3300025728 Bacteria 2028
150 Ga0207653_10004260 3300025885 Bacteria 4494
151 Ga0207682_10000126 3300025893 Bacteria 34447
152 Ga0207642_10002243 3300025899 Bacteria 6005
153 Ga0207680_10104690 3300025903 Bacteria 1824
154 Ga0207645_10008636 3300025907 Bacteria 7094
155 Ga0207643_10077588 3300025908 Bacteria 1921
156 Ga0207684_10000020 3300025910 Bacteria 342787
157 Ga0207684_10000441 3300025910 Bacteria 55041
158 Ga0207684_10007210 3300025910 Bacteria 10047
159 Ga0207684_10017186 3300025910 Bacteria 6207
160 Ga0207662_10000024 3300025918 Bacteria 70677
161 Ga0207652_10029903 3300025921 Bacteria 4559
162 Ga0207646_10001140 3300025922 Bacteria 33868
163 Ga0207646_10002272 3300025922 Bacteria 22859
164 Ga0207646_10003775 3300025922 Bacteria 16875
165 Ga0207646_10034128 3300025922 Bacteria 4598
166 Ga0207650_10004213 3300025925 Bacteria 9820
167 Ga0207659_10014866 3300025926 Bacteria 5030
168 Ga0207687_10026914 3300025927 Bacteria 3854
169 Ga0207700_10165307 3300025928 Bacteria 1841
170 Ga0207686_10001122 3300025934 Bacteria 15496
171 Ga0207709_10006556 3300025935 Bacteria 6536
172 Ga0207670_10080441 3300025936 Bacteria 2278
173 Ga0207704_10058283 3300025938 Bacteria 2377
174 Ga0207665_10028280 3300025939 Bacteria 3703
175 Ga0207691_10115023 3300025940 Bacteria 2389
176 Ga0207711_10281591 3300025941 Bacteria 1531
177 Ga0207689_10000162 3300025942 Bacteria 57621
178 Ga0207689_10019504 3300025942 Bacteria 5715
179 Ga0207667_10005789 3300025949 Bacteria 15080
180 Ga0207651_10012861 3300025960 Bacteria 4758
181 Ga0207651_10171775 3300025960 Bacteria 1710
182 Ga0207640_10018355 3300025981 Bacteria 4110
183 Ga0207677_10000875 3300026023 Bacteria 17082
184 Ga0207703_10029263 3300026035 Bacteria 4345
185 Ga0207708_10001467 3300026075 Bacteria 17645
186 Ga0207702_10127613 3300026078 Bacteria 2286
187 Ga0207702_10374748 3300026078 Bacteria 1367
188 Ga0207648_10000147 3300026089 Bacteria 70420
189 Ga0207676_10094070 3300026095 Bacteria 2469
190 Ga0207676_10194056 3300026095 Bacteria 1789
191 Ga0207675_100000104 3300026118 Bacteria 67261
192 Ga0207675_100005042 3300026118 Bacteria 12711
193 Ga0207683_10003489 3300026121 Bacteria 13724
194 Ga0207428_10000591 3300027907 Bacteria 42796
195 Ga0207428_10009302 3300027907 Bacteria 8817
196 Ga0207428_10019358 3300027907 Bacteria 5805
197 Ga0268265_10000875 3300028380 Bacteria 28237
198 Ga0268264_10000841 3300028381 Bacteria 32855
199 Ga0265319_1003152 3300028563 Bacteria 8687
200 Ga0265334_10016102 3300028573 Bacteria 3095
201 Ga0265324_10042953 3300029957 Bacteria 1561
202 Ga0265320_10011874 3300031240 Bacteria 5103
203 Ga0265340_10015242 3300031247 Bacteria 3998
204 Ga0265316_10011245 3300031344 Bacteria 8093
205 Ga0307408_100021476 3300031548 Bacteria 4368
206 Ga0307408_100039793 3300031548 Bacteria 3326
207 Ga0307408_100170101 3300031548 Bacteria 1739
208 Ga0265314_10045828 3300031711 Bacteria 3089
209 Ga0307405_10008040 3300031731 Bacteria 5320
210 Ga0307405_10013234 3300031731 Bacteria 4397
211 Ga0307405_10014199 3300031731 Bacteria 4274
212 Ga0307405_10120341 3300031731 Bacteria 1795
213 Ga0307413_10038462 3300031824 Bacteria 2773
214 Ga0307413_10041989 3300031824 Bacteria 2683
215 Ga0307413_10068560 3300031824 Bacteria 2222
216 Ga0307413_10119284 3300031824 Bacteria 1783
217 Ga0307413_10151139 3300031824 Bacteria 1618
218 Ga0307410_10033515 3300031852 Bacteria 3316
219 Ga0307410_10045226 3300031852 Bacteria 2930
220 Ga0307410_10056489 3300031852 Bacteria 2669
221 Ga0307410_10115872 3300031852 Bacteria 1946
222 Ga0307410_10137383 3300031852 Bacteria 1803
223 Ga0307410_10151640 3300031852 Bacteria 1726
224 Ga0307406_10026807 3300031901 Bacteria 3465
225 Ga0307406_10034961 3300031901 Bacteria 3086
226 Ga0307406_10046104 3300031901 Bacteria 2741
227 Ga0307406_10234931 3300031901 Bacteria 1371
228 Ga0307407_10016419 3300031903 Bacteria 3686
229 Ga0307407_10043578 3300031903 Bacteria 2523
230 Ga0307407_10076792 3300031903 Bacteria 2006
231 Ga0307412_10048946 3300031911 Bacteria 2782
232 Ga0307412_10069772 3300031911 Bacteria 2393
233 Ga0307412_10087338 3300031911 Bacteria 2172
234 Ga0307409_100038141 3300031995 Bacteria 3550
235 Ga0307416_100005550 3300032002 Bacteria 7763
236 Ga0307416_100162820 3300032002 Bacteria 2064
237 Ga0307416_100218289 3300032002 Bacteria 1826
238 Ga0307416_100249971 3300032002 Bacteria 1725
239 Ga0307416_100255894 3300032002 Bacteria 1707
240 Ga0307416_100294042 3300032002 Bacteria 1610
241 Ga0307416_100335649 3300032002 Bacteria 1521
242 Ga0307414_10192179 3300032004 Bacteria 1653
243 Ga0307414_10264215 3300032004 Bacteria 1438
244 Ga0307411_10029162 3300032005 Bacteria 3365
245 Ga0307415_100068238 3300032126 Bacteria 2488
246 Ga0307415_100378542 3300032126 Bacteria 1201
247 Ga0373948_0004509 3300034817 Bacteria 2208
248 Ga0373926_0000374 3300035083 Bacteria 11463
249 Ga0373928_0001441 3300035084 Bacteria 4620
250 Ga0373940_0008080 3300035088 Bacteria 2401
251 Ga0373952_0003435 3300035092 Bacteria 2858
252 Ga0373932_0002228 3300035112 Bacteria 4982
253 Ga0373939_0000980 3300035114 Bacteria 7091
254 Ga0373941_0040190 3300035115 Bacteria 1441
255 Ga0373946_0057869 3300035171 Unclassified 1640
256 Ga0373961_0022590 3300035241 Bacteria 1684
257 Ga0373962_0003422 3300035242 Bacteria 3813
258 Ga0373931_0000177 3300035691 Bacteria 27824
259 Ga0373927_0019415 3300035695 Bacteria 4457
260 Ga0373925_0072097 3300037068 Bacteria 2613
261 Ga0395899_0001483 3300037312 Bacteria 19971
262 Ga0395899_0013365 3300037312 Bacteria 6280
263 Ga0395899_0103433 3300037312 Bacteria 2054
264 Ga0395900_0056857 3300037418 Bacteria 4027
265 Ga0395898_0075975 3300037466 Bacteria 3244
266 Ga0395898_0245901 3300037466 Bacteria 1706
267 Ga0395905_0250671 3300037471 Bacteria 1654
268 Ga0395901_0008604 3300038443 Bacteria 10316
269 Ga0395901_0321686 3300038443 Bacteria 1600
270 Ga0436363_1309023 3300039450 Bacteria 2605
271 Ga0436362_0909728 3300039453 Bacteria 1397
272 Ga0439436_0004373 3300041404 Bacteria 4328
273 Ga0439438_024979 3300041405 Bacteria 1632
274 Ga0439439_0007543 3300041406 Bacteria 2548
275 Ga0439461_0000481 3300041410 Bacteria 5761
276 Ga0439466_0002744 3300041411 Bacteria 6893
277 Ga0439466_0041154 3300041411 Bacteria 1543
278 Ga0439433_0004374 3300041999 Bacteria 3046
279 Ga0439433_0041875 3300041999 Bacteria 1067
280 Ga0439441_009392 3300042001 Bacteria 1618
281 Ga0439442_001374 3300042002 Bacteria 4817
282 Ga0439442_002583 3300042002 Bacteria 3552
283 Ga0439449_0001865 3300042007 Bacteria 8296
284 Ga0439462_0016256 3300042015 Bacteria 1922
285 Ga0450920_000526 3300042122 Bacteria 6042
286 Ga0450920_003839 3300042122 Bacteria 2616
287 Ga0450920_012382 3300042122 Bacteria 1600
288 Ga0450907_000584 3300042146 Bacteria 9809
289 Ga0450910_001694 3300042147 Bacteria 2827
290 Ga0439434_0009163 3300042435 Bacteria 2910
291 Ga0439434_0016708 3300042435 Bacteria 2193
292 Ga0439435_0001815 3300042436 Bacteria 4072
293 Ga0450918_001097 3300042531 Bacteria 5566
294 Ga0466963_0022653 3300044694 Bacteria 3981
295 Ga0451576_0009298 3300045051 Bacteria 11411
296 Ga0451576_0020809 3300045051 Bacteria 7139
297 Ga0451576_0047301 3300045051 Bacteria 4523
298 Ga0466967_0109340 3300045976 Bacteria 2538
299 Ga0495653_0009296 3300046463 Bacteria 8042
300 Ga0495580_0008764 3300046472 Bacteria 8012
301 Ga0495582_0019386 3300046473 Bacteria 3718
302 Ga0495639_0014771 3300046475 Bacteria 3383
303 Ga0495639_0028944 3300046475 Bacteria 2456
304 Ga0495662_0002526 3300046476 Bacteria 9225
305 Ga0495594_0064603 3300046499 Bacteria 2029
306 Ga0495630_0016327 3300046517 Bacteria 5424
307 Ga0495631_0030681 3300046518 Bacteria 2437
308 Ga0495643_0071739 3300046522 Bacteria 1817
309 Ga0495666_0007281 3300046526 Bacteria 5552
310 Ga0495642_0055796 3300046528 Bacteria 1631
311 Ga0495654_0079682 3300046530 Bacteria 1538
312 Ga0495665_0000983 3300046531 Bacteria 15128
313 Ga0495665_0069990 3300046531 Bacteria 1849
314 Ga0495586_0004594 3300046535 Bacteria 7380
315 Ga0495586_0018559 3300046535 Bacteria 3704
316 Ga0495586_0033812 3300046535 Bacteria 2744
317 Ga0495586_0052936 3300046535 Bacteria 2198
318 Ga0495587_0001116 3300046536 Bacteria 17582
319 Ga0495598_0008773 3300046537 Bacteria 2365
320 Ga0495633_0046004 3300046558 Bacteria 2065
321 Ga0495667_0002674 3300046559 Bacteria 11911
322 Ga0495656_0004238 3300046615 Bacteria 4895
323 Ga0495635_0053108 3300046663 Bacteria 2792
324 Ga0495659_0010181 3300046664 Bacteria 3013
325 Ga0495588_0017710 3300046674 Bacteria 3464
326 Ga0495588_0040433 3300046674 Bacteria 2378
327 Ga0495588_0099094 3300046674 Bacteria 1530
328 Ga0495657_0061571 3300046675 Bacteria 2482
329 Ga0495623_0023875 3300046679 Bacteria 3945
330 Ga0495647_0001798 3300046681 Bacteria 6626
331 Ga0495658_0025915 3300046683 Bacteria 3138
332 Ga0495613_0216083 3300046689 Bacteria 1347
333 Ga0495670_0000338 3300046691 Bacteria 22344
334 Ga0495670_0062159 3300046691 Bacteria 1878
335 Ga0495670_0067613 3300046691 Bacteria 1804
336 Ga0495600_0128663 3300046809 Bacteria 1646
337 Ga0495600_0171866 3300046809 Bacteria 1398
338 Ga0495581_0002780 3300047315 Bacteria 9976
339 Ga0495604_0087319 3300047317 Bacteria 2323
340 Ga0495636_0005293 3300047318 Bacteria 5067
341 Ga0495636_0030359 3300047318 Bacteria 2210
342 Ga0495680_0007190 3300047322 Bacteria 10255
343 Ga0495675_0012523 3300047444 Bacteria 5339
344 Ga0495681_0037248 3300047470 Bacteria 2398
345 Ga0495684_0055510 3300047471 Bacteria 3021
346 Ga0495593_0009654 3300047673 Bacteria 5600
347 Ga0496100_0003367 3300048903 Bacteria 8324
348 Ga0496102_0077871 3300048905 Bacteria 3051
349 Ga0496102_0083209 3300048905 Bacteria 2952
350 Ga0496102_0537528 3300048905 Bacteria 1091
351 Ga0496103_0010898 3300048906 Bacteria 5380
352 Ga0496103_0017766 3300048906 Bacteria 4260
353 Ga0496103_0160284 3300048906 Bacteria 1443
354 Ga0496104_0008368 3300048907 Bacteria 9193
355 Ga0496104_0080987 3300048907 Bacteria 3095
356 Ga0496105_0002859 3300048908 Bacteria 12642
357 Ga0496106_0004267 3300048909 Bacteria 10633
358 Ga0496106_0010677 3300048909 Bacteria 6787
359 Ga0496107_0000513 3300048910 Bacteria 21539
360 Ga0496107_0028931 3300048910 Bacteria 3940
361 Ga0496107_0048708 3300048910 Bacteria 3054
362 Ga0496107_0136431 3300048910 Bacteria 1812
363 Ga0496108_0000674 3300048911 Bacteria 26407
364 Ga0496108_0196963 3300048911 Bacteria 1747
365 Ga0496109_0015359 3300048912 Bacteria 6671
366 Ga0496109_0118589 3300048912 Bacteria 2464
367 Ga0496110_0006729 3300048913 Bacteria 9137
368 Ga0496110_0072716 3300048913 Bacteria 3051
369 Ga0496110_0340159 3300048913 Bacteria 1367
370 Ga0496111_0049095 3300048914 Bacteria 3042
371 Ga0496112_0047202 3300048915 Bacteria 4225
372 Ga0496112_0369677 3300048915 Bacteria 1375
373 Ga0496113_0259648 3300048916 Bacteria 1388
374 Ga0501031_0074093 3300049568 Bacteria 2217
375 Ga0501032_0007511 3300049569 Bacteria 7962
376 Ga0501032_0033530 3300049569 Bacteria 3517
377 Ga0501034_0001687 3300049571 Bacteria 28468
378 Ga0501036_0182535 3300049572 Bacteria 1766
379 Ga0501037_0005772 3300049573 Bacteria 9038
380 Ga0501037_0016066 3300049573 Bacteria 5508
381 Ga0501037_0170685 3300049573 Bacteria 1546
382 Ga0501037_0207075 3300049573 Bacteria 1384
383 Ga0501038_0005777 3300049574 Bacteria 11459
384 Ga0501038_0012593 3300049574 Bacteria 7730
385 Ga0501038_0022914 3300049574 Bacteria 5590
386 Ga0501039_0006182 3300049575 Bacteria 9091
387 Ga0501039_0022288 3300049575 Bacteria 4863
388 Ga0501039_0031851 3300049575 Bacteria 4065
389 Ga0501040_0014901 3300049576 Bacteria 5132
390 Ga0501040_0051796 3300049576 Bacteria 2808
391 Ga0501041_0016627 3300049577 Bacteria 4377
392 Ga0501041_0022257 3300049577 Bacteria 3794
393 Ga0501041_0090146 3300049577 Bacteria 1893
394 Ga0501041_0125289 3300049577 Bacteria 1599
395 Ga0501042_0011314 3300049578 Bacteria 6016
396 Ga0501043_0080907 3300049579 Bacteria 2552
397 Ga0501046_0035200 3300049580 Bacteria 4036
398 Ga0501070_0076389 3300049586 Bacteria 2773
399 Ga0501070_0088447 3300049586 Bacteria 2564
400 Ga0501071_0159674 3300049587 Bacteria 1684
401 Ga0501072_0000720 3300049588 Bacteria 24044
402 Ga0501072_0022288 3300049588 Bacteria 4914
403 Ga0501072_0104297 3300049588 Bacteria 2254
404 Ga0501073_0011928 3300049589 Bacteria 6344
405 Ga0501074_0098925 3300049590 Bacteria 2088
406 Ga0501075_0016542 3300049591 Bacteria 5315
407 Ga0501075_0060226 3300049591 Bacteria 2861
408 Ga0501075_0149405 3300049591 Bacteria 1781
409 Ga0501075_0195336 3300049591 Unclassified 1543
410 Ga0501076_0003881 3300049592 Bacteria 10528
411 Ga0501076_0014654 3300049592 Bacteria 5909
412 Ga0501077_0021673 3300049593 Bacteria 4067
413 Ga0501077_0024362 3300049593 Bacteria 3843
414 Ga0501079_0006150 3300049741 Bacteria 9005
415 Ga0501079_0018197 3300049741 Bacteria 5366
416 Ga0501080_0022576 3300049742 Bacteria 5830
417 Ga0501080_0030502 3300049742 Bacteria 5023
418 Ga0501081_0026187 3300049743 Bacteria 3930
419 Ga0501081_0141851 3300049743 Bacteria 1722
420 Ga0501279_002083 3300049775 Bacteria 2650
421 Ga0501045_0010278 3300049824 Bacteria 6555
422 Ga0501045_0097276 3300049824 Bacteria 2178
423 nmdc:mga05p37_105338_c1 3300050507 Bacteria 3470
424 nmdc:mga05p37_10710_c1 3300050507 Bacteria 10884
425 nmdc:mga05p37_382184_c1 3300050507 Bacteria 1650
426 nmdc:mga05p37_775_c1 3300050507 Bacteria 35507
427 nmdc:mga09592_148_c1 3300050508 Bacteria 47706
428 nmdc:mga0qj67_315226_c1 3300050509 Bacteria 1266
429 nmdc:mga0qj67_48546_c1 3300050509 Bacteria 3353
430 nmdc:mga0qj67_740_c1 3300050509 Bacteria 22151
431 nmdc:mga06r32_2241_c1 3300050510 Bacteria 17309
432 nmdc:mga08y16_27884_c1 3300050511 Bacteria 5954
433 nmdc:mga08y16_6707_c1 3300050511 Bacteria 12072
434 nmdc:mga0n895_258674_c1 3300050512 Bacteria 1767
435 nmdc:mga0n895_26762_c1 3300050512 Bacteria 5469
436 nmdc:mga0n895_37609_c1 3300050512 Bacteria 4684
437 nmdc:mga0n895_39167_c1 3300050512 Bacteria 4597
438 nmdc:mga0n895_42377_c1 3300050512 Bacteria 4428
439 nmdc:mga0n895_924_c1 3300050512 Bacteria 21172
440 nmdc:mga0rr50_118081_c1 3300050513 Bacteria 2107
441 nmdc:mga0rr50_13072_c1 3300050513 Bacteria 5390
442 nmdc:mga0rr50_1686_c1 3300050513 Bacteria 12197
443 nmdc:mga0rr50_31547_c1 3300050513 Bacteria 3764
444 nmdc:mga0rr50_31752_c1 3300050513 Bacteria 3756
445 nmdc:mga08x19_22448_c1 3300050514 Bacteria 3909
446 nmdc:mga08x19_834_c1 3300050514 Bacteria 19567
447 nmdc:mga0a205_10857_c1 3300050515 Bacteria 8378
448 nmdc:mga0a205_121786_c1 3300050515 Bacteria 2508
449 nmdc:mga0a205_236717_c1 3300050515 Bacteria 1708
450 nmdc:mga0a205_268935_c1 3300050515 Bacteria 1582
451 nmdc:mga0a205_28573_c1 3300050515 Bacteria 5333
452 nmdc:mga0a205_45087_c1 3300050515 Bacteria 4252
453 nmdc:mga0a205_72547_c1 3300050515 Bacteria 3326
454 nmdc:mga0a205_821_c1 3300050515 Bacteria 25293
455 Ga0495595_0044077 3300053084 Bacteria 2049
456 Ga0501084_0095082 3300054114 Bacteria 2502
457 Ga0501084_0126519 3300054114 Bacteria 2150
458 Ga0501084_0236428 3300054114 Viruses 1542
459 Ga0501082_0015226 3300060353 Bacteria 6624
460 Ga0501082_0040627 3300060353 Bacteria 4011
461 Ga0501082_0422247 3300060353 Bacteria 1164
462 Ga0530510_0000042 3300061734 Bacteria 58436
463 Ga0530510_0014848 3300061734 Bacteria 5499
464 Ga0530510_0195608 3300061734 Bacteria 1501

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048905 Ga0496102_0537528 Ga0496102_0537528_10_903 283
2 3300005340 Ga0070689_100124432 Ga0070689_1001244323 304
3 3300005617 Ga0068859_100070993 Ga0068859_1000709934 304
4 3300006852 Ga0075433_10000611 Ga0075433_1000061118 304
5 3300006871 Ga0075434_100000406 Ga0075434_10000040620 304
6 3300006914 Ga0075436_100000513 Ga0075436_10000051310 304
7 3300006931 Ga0097620_100070993 Ga0097620_1000709934 304
8 3300007076 Ga0075435_100000668 Ga0075435_10000066815 304
9 3300025936 Ga0207670_10080441 Ga0207670_100804412 304
10 3300025960 Ga0207651_10171775 Ga0207651_101717752 304
11 3300026095 Ga0207676_10094070 Ga0207676_100940703 304
12 3300009094 Ga0111539_10033795 Ga0111539_100337954 308
13 3300050511 nmdc:mga08y16_27884_c1 nmdc:mga08y16_27884_c1_2444_3559 308
14 3300050512 nmdc:mga0n895_924_c1 nmdc:mga0n895_924_c1_9953_11068 308
15 3300050513 nmdc:mga0rr50_1686_c1 nmdc:mga0rr50_1686_c1_6070_7185 308
16 3300050514 nmdc:mga08x19_834_c1 nmdc:mga08x19_834_c1_3873_4988 308
17 3300050515 nmdc:mga0a205_821_c1 nmdc:mga0a205_821_c1_13645_14760 308
18 3300006852 Ga0075433_10008931 Ga0075433_100089318 321
19 3300006871 Ga0075434_100001960 Ga0075434_10000196016 321
20 3300007076 Ga0075435_100025101 Ga0075435_1000251013 321
21 3300009147 Ga0114129_10017768 Ga0114129_100177681 321
22 3300050507 nmdc:mga05p37_10710_c1 nmdc:mga05p37_10710_c1_8722_9792 321
23 3300050512 nmdc:mga0n895_258674_c1 nmdc:mga0n895_258674_c1_53_1123 321
24 3300050513 nmdc:mga0rr50_31547_c1 nmdc:mga0rr50_31547_c1_1349_2419 321
25 3300050515 nmdc:mga0a205_10857_c1 nmdc:mga0a205_10857_c1_6610_7680 321
26 3300039453 Ga0436362_0909728 Ga0436362_0909728_104_1120 322
27 3300046463 Ga0495653_0009296 Ga0495653_0009296_4085_5095 322
28 3300046476 Ga0495662_0002526 Ga0495662_0002526_4538_5548 322
29 3300046517 Ga0495630_0016327 Ga0495630_0016327_3179_4189 322
30 3300046531 Ga0495665_0000983 Ga0495665_0000983_8902_9912 322
31 3300046536 Ga0495587_0001116 Ga0495587_0001116_2814_3824 322
32 3300046559 Ga0495667_0002674 Ga0495667_0002674_225_1235 322
33 3300046663 Ga0495635_0053108 Ga0495635_0053108_38_1048 322
34 3300046675 Ga0495657_0061571 Ga0495657_0061571_1366_2376 322
35 3300046679 Ga0495623_0023875 Ga0495623_0023875_2694_3704 322
36 3300046689 Ga0495613_0216083 Ga0495613_0216083_167_1177 322
37 3300046809 Ga0495600_0171866 Ga0495600_0171866_337_1347 322
38 3300047315 Ga0495581_0002780 Ga0495581_0002780_7424_8434 322
39 3300047317 Ga0495604_0087319 Ga0495604_0087319_978_1988 322
40 3300047322 Ga0495680_0007190 Ga0495680_0007190_8910_9920 322
41 3300047444 Ga0495675_0012523 Ga0495675_0012523_411_1421 322
42 3300047471 Ga0495684_0055510 Ga0495684_0055510_1419_2429 322
43 3300039450 Ga0436363_1309023 Ga0436363_1309023_632_1648 323
44 iso_pu_bacteria 2904497146 2904499135 326
45 3300003320 rootH2_10144228 rootH2_101442283 329
46 3300009553 Ga0105249_10013242 Ga0105249_100132424 329
47 3300037312 Ga0395899_0013365 Ga0395899_0013365_4837_5826 329
48 3300037466 Ga0395898_0075975 Ga0395898_0075975_1700_2689 329
49 3300038443 Ga0395901_0008604 Ga0395901_0008604_3514_4503 329
50 3300045051 Ga0451576_0009298 Ga0451576_0009298_4908_5975 329
51 3300050512 nmdc:mga0n895_39167_c1 nmdc:mga0n895_39167_c1_3008_4015 329
52 3300050515 nmdc:mga0a205_236717_c1 nmdc:mga0a205_236717_c1_594_1601 329
53 3300005331 Ga0070670_100024368 Ga0070670_1000243683 330
54 3300005333 Ga0070677_10026182 Ga0070677_100261822 330
55 3300005334 Ga0068869_100005227 Ga0068869_1000052274 330
56 3300005335 Ga0070666_10048583 Ga0070666_100485832 330
57 3300005336 Ga0070680_100001936 Ga0070680_10000193615 330
58 3300005337 Ga0070682_100001084 Ga0070682_10000108415 330
59 3300005338 Ga0068868_100003103 Ga0068868_1000031034 330
60 3300005340 Ga0070689_100000317 Ga0070689_1000003174 330
61 3300005341 Ga0070691_10000355 Ga0070691_100003554 330
62 3300005343 Ga0070687_100000251 Ga0070687_10000025116 330
63 3300005345 Ga0070692_10019493 Ga0070692_100194931 330
64 3300005355 Ga0070671_100269501 Ga0070671_1002695012 330
65 3300005367 Ga0070667_100097731 Ga0070667_1000977312 330
66 3300005406 Ga0070703_10012155 Ga0070703_100121554 330
67 3300005438 Ga0070701_10000853 Ga0070701_1000085311 330
68 3300005440 Ga0070705_100000115 Ga0070705_10000011544 330
69 3300005441 Ga0070700_100000903 Ga0070700_1000009034 330
70 3300005444 Ga0070694_100000066 Ga0070694_10000006646 330
71 3300005456 Ga0070678_100056995 Ga0070678_1000569952 330
72 3300005459 Ga0068867_100000422 Ga0068867_1000004224 330
73 3300005467 Ga0070706_100000036 Ga0070706_10000003655 330
74 3300005468 Ga0070707_100008469 Ga0070707_1000084692 330
75 3300005530 Ga0070679_100041110 Ga0070679_1000411104 330
76 3300005536 Ga0070697_100008358 Ga0070697_1000083588 330
77 3300005536 Ga0070697_100179746 Ga0070697_1001797462 330
78 3300005544 Ga0070686_100000167 Ga0070686_10000016744 330
79 3300005545 Ga0070695_100000164 Ga0070695_1000001644 330
80 3300005546 Ga0070696_100000933 Ga0070696_1000009335 330
81 3300005547 Ga0070693_100000323 Ga0070693_10000032322 330
82 3300005549 Ga0070704_100000093 Ga0070704_10000009320 330
83 3300005563 Ga0068855_100005066 Ga0068855_10000506615 330
84 3300005578 Ga0068854_100025736 Ga0068854_1000257363 330
85 3300005615 Ga0070702_100003437 Ga0070702_1000034376 330
86 3300005617 Ga0068859_100013618 Ga0068859_1000136184 330
87 3300005842 Ga0068858_100005171 Ga0068858_1000051714 330
88 3300005843 Ga0068860_100003453 Ga0068860_10000345315 330
89 3300005844 Ga0068862_100001425 Ga0068862_10000142522 330
90 3300006237 Ga0097621_100003699 Ga0097621_1000036994 330
91 3300006358 Ga0068871_100000965 Ga0068871_10000096521 330
92 3300006881 Ga0068865_100000043 Ga0068865_10000004369 330
93 3300006914 Ga0075436_100251135 Ga0075436_1002511351 330
94 3300006931 Ga0097620_100013618 Ga0097620_1000136187 330
95 3300009011 Ga0105251_10057927 Ga0105251_100579271 330
96 3300009036 Ga0105244_10011440 Ga0105244_100114406 330
97 3300009098 Ga0105245_10002730 Ga0105245_100027304 330
98 3300009098 Ga0105245_10021533 Ga0105245_100215332 330
99 3300009148 Ga0105243_10002483 Ga0105243_1000248315 330
100 3300009174 Ga0105241_10060798 Ga0105241_100607983 330
101 3300009176 Ga0105242_10000296 Ga0105242_1000029627 330
102 3300009177 Ga0105248_10058291 Ga0105248_100582914 330
103 3300009177 Ga0105248_10155338 Ga0105248_101553381 330
104 3300010375 Ga0105239_10100776 Ga0105239_101007763 330
105 3300013102 Ga0157371_10042930 Ga0157371_100429304 330
106 3300013297 Ga0157378_10000140 Ga0157378_1000014068 330
107 3300013306 Ga0163162_10034362 Ga0163162_100343622 330
108 3300014968 Ga0157379_10136603 Ga0157379_101366034 330
109 3300014969 Ga0157376_10001393 Ga0157376_100013934 330
110 3300025315 Ga0207697_10001206 Ga0207697_100012067 330
111 3300025728 Ga0207655_1036831 Ga0207655_10368311 330
112 3300025885 Ga0207653_10004260 Ga0207653_100042604 330
113 3300025893 Ga0207682_10000126 Ga0207682_1000012613 330
114 3300025899 Ga0207642_10002243 Ga0207642_100022434 330
115 3300025903 Ga0207680_10104690 Ga0207680_101046902 330
116 3300025908 Ga0207643_10077588 Ga0207643_100775883 330
117 3300025910 Ga0207684_10000020 Ga0207684_1000002056 330
118 3300025918 Ga0207662_10000024 Ga0207662_1000002468 330
119 3300025921 Ga0207652_10029903 Ga0207652_100299034 330
120 3300025922 Ga0207646_10001140 Ga0207646_100011402 330
121 3300025925 Ga0207650_10004213 Ga0207650_100042134 330
122 3300025927 Ga0207687_10026914 Ga0207687_100269144 330
123 3300025934 Ga0207686_10001122 Ga0207686_100011222 330
124 3300025935 Ga0207709_10006556 Ga0207709_100065564 330
125 3300025938 Ga0207704_10058283 Ga0207704_100582833 330
126 3300025941 Ga0207711_10281591 Ga0207711_102815911 330
127 3300025942 Ga0207689_10000162 Ga0207689_1000016256 330
128 3300025949 Ga0207667_10005789 Ga0207667_100057895 330
129 3300025981 Ga0207640_10018355 Ga0207640_100183553 330
130 3300026023 Ga0207677_10000875 Ga0207677_1000087513 330
131 3300026035 Ga0207703_10029263 Ga0207703_100292634 330
132 3300026075 Ga0207708_10001467 Ga0207708_1000146718 330
133 3300026078 Ga0207702_10374748 Ga0207702_103747481 330
134 3300026089 Ga0207648_10000147 Ga0207648_1000014769 330
135 3300026118 Ga0207675_100000104 Ga0207675_10000010468 330
136 3300026121 Ga0207683_10003489 Ga0207683_100034895 330
137 3300028380 Ga0268265_10000875 Ga0268265_1000087527 330
138 3300028381 Ga0268264_10000841 Ga0268264_100008415 330
139 3300031824 Ga0307413_10151139 Ga0307413_101511392 330
140 3300031852 Ga0307410_10115872 Ga0307410_101158722 330
141 3300041404 Ga0439436_0004373 Ga0439436_0004373_1694_2686 330
142 3300041411 Ga0439466_0041154 Ga0439466_0041154_308_1300 330
143 3300041999 Ga0439433_0004374 Ga0439433_0004374_1831_2823 330
144 3300041999 Ga0439433_0041875 Ga0439433_0041875_26_1018 330
145 3300042002 Ga0439442_001374 Ga0439442_001374_70_1062 330
146 3300042122 Ga0450920_000526 Ga0450920_000526_2712_3704 330
147 3300042122 Ga0450920_003839 Ga0450920_003839_34_1026 330
148 3300042146 Ga0450907_000584 Ga0450907_000584_2878_3870 330
149 3300042531 Ga0450918_001097 Ga0450918_001097_98_1090 330
150 3300046499 Ga0495594_0064603 Ga0495594_0064603_353_1345 330
151 3300046522 Ga0495643_0071739 Ga0495643_0071739_680_1672 330
152 3300046528 Ga0495642_0055796 Ga0495642_0055796_67_1059 330
153 3300046535 Ga0495586_0004594 Ga0495586_0004594_3787_4779 330
154 3300046535 Ga0495586_0018559 Ga0495586_0018559_972_1964 330
155 3300046674 Ga0495588_0017710 Ga0495588_0017710_1391_2383 330
156 3300046674 Ga0495588_0099094 Ga0495588_0099094_355_1347 330
157 3300046691 Ga0495670_0067613 Ga0495670_0067613_416_1408 330
158 3300047318 Ga0495636_0030359 Ga0495636_0030359_611_1603 330
159 3300048905 Ga0496102_0083209 Ga0496102_0083209_183_1175 330
160 3300048910 Ga0496107_0136431 Ga0496107_0136431_336_1328 330
161 3300048913 Ga0496110_0340159 Ga0496110_0340159_178_1170 330
162 3300048915 Ga0496112_0369677 Ga0496112_0369677_355_1347 330
163 3300048916 Ga0496113_0259648 Ga0496113_0259648_30_1022 330
164 3300049578 Ga0501042_0011314 Ga0501042_0011314_112_1110 330
165 3300049591 Ga0501075_0016542 Ga0501075_0016542_639_1637 330
166 3300049591 Ga0501075_0195336 Ga0501075_0195336_509_1519 330
167 3300049775 Ga0501279_002083 Ga0501279_002083_552_1544 330
168 3300060353 Ga0501082_0422247 Ga0501082_0422247_144_1154 330
169 3300035083 Ga0373926_0000374 Ga0373926_0000374_1146_2192 333
170 3300035695 Ga0373927_0019415 Ga0373927_0019415_1728_2774 333
171 3300046472 Ga0495580_0008764 Ga0495580_0008764_2531_3577 333
172 3300046475 Ga0495639_0014771 Ga0495639_0014771_1240_2286 333
173 3300046535 Ga0495586_0033812 Ga0495586_0033812_1283_2329 333
174 3300046683 Ga0495658_0025915 Ga0495658_0025915_1038_2084 333
175 3300050515 nmdc:mga0a205_45087_c1 nmdc:mga0a205_45087_c1_3133_4188 335
176 3300005546 Ga0070696_100000739 Ga0070696_1000007398 336
177 3300042015 Ga0439462_0016256 Ga0439462_0016256_223_1323 339
178 3300049588 Ga0501072_0022288 Ga0501072_0022288_1005_2075 339
179 3300049591 Ga0501075_0060226 Ga0501075_0060226_1536_2606 339
180 3300035171 Ga0373946_0057869 Ga0373946_0057869_107_1174 340
181 3300046526 Ga0495666_0007281 Ga0495666_0007281_1440_2507 340
182 3300046681 Ga0495647_0001798 Ga0495647_0001798_3217_4284 340
183 3300041410 Ga0439461_0000481 Ga0439461_0000481_2051_3127 342
184 3300042435 Ga0439434_0009163 Ga0439434_0009163_74_1150 342
185 3300042436 Ga0439435_0001815 Ga0439435_0001815_1813_2889 342
186 3300006846 Ga0075430_100008701 Ga0075430_1000087017 344
187 3300006871 Ga0075434_100004191 Ga0075434_1000041915 344
188 3300007076 Ga0075435_100022097 Ga0075435_1000220975 344
189 3300050509 nmdc:mga0qj67_48546_c1 nmdc:mga0qj67_48546_c1_346_1428 344
190 3300050512 nmdc:mga0n895_26762_c1 nmdc:mga0n895_26762_c1_1886_2980 344
191 3300050513 nmdc:mga0rr50_118081_c1 nmdc:mga0rr50_118081_c1_104_1183 344
192 3300050513 nmdc:mga0rr50_13072_c1 nmdc:mga0rr50_13072_c1_1774_2868 344
193 3300009147 Ga0114129_10666112 Ga0114129_106661121 345
194 3300006844 Ga0075428_100000502 Ga0075428_1000005029 347
195 3300006847 Ga0075431_100220054 Ga0075431_1002200543 347
196 3300006880 Ga0075429_100006458 Ga0075429_1000064587 347
197 3300009094 Ga0111539_10025953 Ga0111539_100259536 347
198 3300009147 Ga0114129_10000393 Ga0114129_1000039346 347
199 3300027907 Ga0207428_10009302 Ga0207428_100093025 347
200 3300034817 Ga0373948_0004509 Ga0373948_0004509_80_1147 347
201 3300035084 Ga0373928_0001441 Ga0373928_0001441_2334_3401 347
202 3300035088 Ga0373940_0008080 Ga0373940_0008080_653_1720 347
203 3300035092 Ga0373952_0003435 Ga0373952_0003435_1571_2638 347
204 3300035112 Ga0373932_0002228 Ga0373932_0002228_2991_4058 347
205 3300035114 Ga0373939_0000980 Ga0373939_0000980_5835_6902 347
206 3300035115 Ga0373941_0040190 Ga0373941_0040190_211_1278 347
207 3300035241 Ga0373961_0022590 Ga0373961_0022590_583_1650 347
208 3300035242 Ga0373962_0003422 Ga0373962_0003422_2522_3589 347
209 3300035691 Ga0373931_0000177 Ga0373931_0000177_11182_12249 347
210 3300045051 Ga0451576_0020809 Ga0451576_0020809_2784_3851 347
211 3300046531 Ga0495665_0069990 Ga0495665_0069990_626_1672 347
212 3300050507 nmdc:mga05p37_775_c1 nmdc:mga05p37_775_c1_3099_4166 347
213 3300050508 nmdc:mga09592_148_c1 nmdc:mga09592_148_c1_29977_31044 347
214 3300050511 nmdc:mga08y16_6707_c1 nmdc:mga08y16_6707_c1_2238_3305 347
215 3300005444 Ga0070694_100064230 Ga0070694_1000642302 348
216 3300005937 Ga0081455_10042572 Ga0081455_100425722 348
217 3300006058 Ga0075432_10018835 Ga0075432_100188352 348
218 3300006844 Ga0075428_100141150 Ga0075428_1001411503 348
219 3300006846 Ga0075430_100053261 Ga0075430_1000532614 348
220 3300006871 Ga0075434_100000420 Ga0075434_10000042011 348
221 3300009148 Ga0105243_10066999 Ga0105243_100669993 348
222 3300026118 Ga0207675_100005042 Ga0207675_1000050427 348
223 3300027907 Ga0207428_10000591 Ga0207428_1000059126 348
224 3300045051 Ga0451576_0047301 Ga0451576_0047301_3396_4463 348
225 3300046537 Ga0495598_0008773 Ga0495598_0008773_523_1587 348
226 3300005468 Ga0070707_100027499 Ga0070707_1000274992 349
227 3300006028 Ga0070717_10000105 Ga0070717_100001054 349
228 3300025922 Ga0207646_10002272 Ga0207646_1000227213 349
229 3300031731 Ga0307405_10120341 Ga0307405_101203412 349
230 3300031901 Ga0307406_10034961 Ga0307406_100349613 349
231 3300031903 Ga0307407_10076792 Ga0307407_100767922 349
232 3300050514 nmdc:mga08x19_22448_c1 nmdc:mga08x19_22448_c1_2496_3614 349
233 3300005981 Ga0081538_10005326 Ga0081538_100053265 350
234 3300026078 Ga0207702_10127613 Ga0207702_101276132 350
235 3300048909 Ga0496106_0010677 Ga0496106_0010677_5562_6632 350
236 3300048910 Ga0496107_0000513 Ga0496107_0000513_16541_17611 350
237 3300013105 Ga0157369_10118773 Ga0157369_101187734 351
238 3300006852 Ga0075433_10068436 Ga0075433_100684362 352
239 3300007076 Ga0075435_100059147 Ga0075435_1000591473 352
240 3300025922 Ga0207646_10003775 Ga0207646_100037756 352
241 3300025928 Ga0207700_10165307 Ga0207700_101653073 352
242 3300025939 Ga0207665_10028280 Ga0207665_100282803 352
243 3300050513 nmdc:mga0rr50_31752_c1 nmdc:mga0rr50_31752_c1_1100_2233 352
244 3300053084 Ga0495595_0044077 Ga0495595_0044077_562_1662 352
245 3300005445 Ga0070708_100002210 Ga0070708_1000022102 353
246 3300005445 Ga0070708_100008673 Ga0070708_10000867311 353
247 3300005536 Ga0070697_100008599 Ga0070697_1000085994 353
248 3300037466 Ga0395898_0245901 Ga0395898_0245901_549_1661 353
249 3300037471 Ga0395905_0250671 Ga0395905_0250671_437_1549 353
250 3300042001 Ga0439441_009392 Ga0439441_009392_250_1311 353
251 3300049577 Ga0501041_0090146 Ga0501041_0090146_771_1850 353
252 3300049577 Ga0501041_0125289 Ga0501041_0125289_390_1487 353
253 3300049593 Ga0501077_0024362 Ga0501077_0024362_1977_3056 353
254 3300049743 Ga0501081_0141851 Ga0501081_0141851_597_1676 353
255 3300049824 Ga0501045_0097276 Ga0501045_0097276_82_1179 353
256 3300050509 nmdc:mga0qj67_315226_c1 nmdc:mga0qj67_315226_c1_11_1090 353
257 3300054114 Ga0501084_0236428 Ga0501084_0236428_144_1223 353
258 3300005444 Ga0070694_100160928 Ga0070694_1001609281 354
259 3300005445 Ga0070708_100032831 Ga0070708_1000328311 354
260 3300005467 Ga0070706_100040024 Ga0070706_1000400245 354
261 3300005468 Ga0070707_100402173 Ga0070707_1004021732 354
262 3300005471 Ga0070698_100000198 Ga0070698_10000019829 354
263 3300005471 Ga0070698_100038027 Ga0070698_1000380276 354
264 3300005518 Ga0070699_100000052 Ga0070699_10000005225 354
265 3300005536 Ga0070697_100011227 Ga0070697_1000112277 354
266 3300005536 Ga0070697_100017456 Ga0070697_1000174561 354
267 3300005545 Ga0070695_100007139 Ga0070695_1000071395 354
268 3300006028 Ga0070717_10042070 Ga0070717_100420702 354
269 3300006173 Ga0070716_100034944 Ga0070716_1000349444 354
270 3300014325 Ga0163163_10092245 Ga0163163_100922453 354
271 3300025910 Ga0207684_10000441 Ga0207684_1000044120 354
272 3300025910 Ga0207684_10007210 Ga0207684_1000721010 354
273 3300025910 Ga0207684_10017186 Ga0207684_100171861 354
274 3300025922 Ga0207646_10034128 Ga0207646_100341284 354
275 3300037312 Ga0395899_0001483 Ga0395899_0001483_11197_12315 354
276 3300042122 Ga0450920_012382 Ga0450920_012382_207_1277 354
277 3300006846 Ga0075430_100000620 Ga0075430_10000062017 355
278 3300006847 Ga0075431_100007715 Ga0075431_1000077155 355
279 3300044694 Ga0466963_0022653 Ga0466963_0022653_396_1481 355
280 3300045976 Ga0466967_0109340 Ga0466967_0109340_771_1856 355
281 3300049575 Ga0501039_0031851 Ga0501039_0031851_2048_3118 355
282 3300049577 Ga0501041_0016627 Ga0501041_0016627_2062_3132 355
283 3300049588 Ga0501072_0000720 Ga0501072_0000720_17421_18491 355
284 3300049592 Ga0501076_0003881 Ga0501076_0003881_8798_9868 355
285 3300049741 Ga0501079_0006150 Ga0501079_0006150_6905_7975 355
286 3300049742 Ga0501080_0030502 Ga0501080_0030502_2958_4028 355
287 3300050509 nmdc:mga0qj67_740_c1 nmdc:mga0qj67_740_c1_14152_15222 355
288 3300050510 nmdc:mga06r32_2241_c1 nmdc:mga06r32_2241_c1_3981_5051 355
289 3300054114 Ga0501084_0095082 Ga0501084_0095082_1258_2328 355
290 3300060353 Ga0501082_0040627 Ga0501082_0040627_2766_3836 355
291 3300061734 Ga0530510_0000042 Ga0530510_0000042_25378_26448 355
292 3300007076 Ga0075435_100088147 Ga0075435_1000881472 356
293 3300005536 Ga0070697_100084088 Ga0070697_1000840881 357
294 3300028563 Ga0265319_1003152 Ga0265319_10031524 357
295 3300028573 Ga0265334_10016102 Ga0265334_100161023 357
296 3300029957 Ga0265324_10042953 Ga0265324_100429532 357
297 3300031240 Ga0265320_10011874 Ga0265320_100118742 357
298 3300031247 Ga0265340_10015242 Ga0265340_100152422 357
299 3300031344 Ga0265316_10011245 Ga0265316_100112454 357
300 3300031711 Ga0265314_10045828 Ga0265314_100458282 357
301 3300031911 Ga0307412_10048946 Ga0307412_100489464 357
302 3300037068 Ga0373925_0072097 Ga0373925_0072097_708_1781 357
303 3300005445 Ga0070708_100278160 Ga0070708_1002781601 358
304 3300005468 Ga0070707_100423806 Ga0070707_1004238061 358
305 3300005618 Ga0068864_100011897 Ga0068864_1000118974 358
306 3300006844 Ga0075428_100336606 Ga0075428_1003366062 358
307 3300006852 Ga0075433_10015296 Ga0075433_100152964 358
308 3300006852 Ga0075433_10248490 Ga0075433_102484902 358
309 3300006871 Ga0075434_100037772 Ga0075434_1000377724 358
310 3300006871 Ga0075434_100156318 Ga0075434_1001563181 358
311 3300009147 Ga0114129_10101226 Ga0114129_101012264 358
312 3300009147 Ga0114129_10102635 Ga0114129_101026353 358
313 3300026095 Ga0207676_10194056 Ga0207676_101940562 358
314 3300032002 Ga0307416_100249971 Ga0307416_1002499712 358
315 3300049568 Ga0501031_0074093 Ga0501031_0074093_101_1213 358
316 3300049572 Ga0501036_0182535 Ga0501036_0182535_131_1243 358
317 3300049573 Ga0501037_0207075 Ga0501037_0207075_130_1242 358
318 3300049574 Ga0501038_0012593 Ga0501038_0012593_3519_4631 358
319 3300049575 Ga0501039_0022288 Ga0501039_0022288_489_1601 358
320 3300049576 Ga0501040_0014901 Ga0501040_0014901_118_1230 358
321 3300049577 Ga0501041_0022257 Ga0501041_0022257_193_1305 358
322 3300049580 Ga0501046_0035200 Ga0501046_0035200_2489_3601 358
323 3300049586 Ga0501070_0088447 Ga0501070_0088447_984_2096 358
324 3300049587 Ga0501071_0159674 Ga0501071_0159674_214_1326 358
325 3300049588 Ga0501072_0104297 Ga0501072_0104297_630_1742 358
326 3300049589 Ga0501073_0011928 Ga0501073_0011928_4704_5816 358
327 3300049590 Ga0501074_0098925 Ga0501074_0098925_602_1714 358
328 3300049592 Ga0501076_0014654 Ga0501076_0014654_31_1143 358
329 3300049593 Ga0501077_0021673 Ga0501077_0021673_2499_3611 358
330 3300049741 Ga0501079_0018197 Ga0501079_0018197_3843_4955 358
331 3300049742 Ga0501080_0022576 Ga0501080_0022576_4425_5537 358
332 3300049743 Ga0501081_0026187 Ga0501081_0026187_2490_3602 358
333 3300049824 Ga0501045_0010278 Ga0501045_0010278_471_1583 358
334 3300050507 nmdc:mga05p37_105338_c1 nmdc:mga05p37_105338_c1_1282_2397 358
335 3300050507 nmdc:mga05p37_382184_c1 nmdc:mga05p37_382184_c1_363_1478 358
336 3300050512 nmdc:mga0n895_37609_c1 nmdc:mga0n895_37609_c1_2087_3199 358
337 3300050515 nmdc:mga0a205_28573_c1 nmdc:mga0a205_28573_c1_1301_2416 358
338 3300054114 Ga0501084_0126519 Ga0501084_0126519_473_1585 358
339 3300060353 Ga0501082_0015226 Ga0501082_0015226_304_1416 358
340 3300061734 Ga0530510_0014848 Ga0530510_0014848_342_1454 358
341 iso_pu_bacteria 2808606366 2808877223 358
342 3300061734 Ga0530510_0195608 Ga0530510_0195608_42_1160 359
343 iso_pu_bacteria 2946059875 2946060847 359
344 3300006038 Ga0075365_10008218 Ga0075365_100082185 360
345 3300006844 Ga0075428_100071259 Ga0075428_1000712593 360
346 3300014325 Ga0163163_10167940 Ga0163163_101679402 360
347 3300048907 Ga0496104_0008368 Ga0496104_0008368_384_1478 360
348 3300048908 Ga0496105_0002859 Ga0496105_0002859_6039_7133 360
349 3300048911 Ga0496108_0000674 Ga0496108_0000674_19527_20621 360
350 3300048912 Ga0496109_0015359 Ga0496109_0015359_1487_2581 360
351 3300048913 Ga0496110_0006729 Ga0496110_0006729_5657_6751 360
352 3300048915 Ga0496112_0047202 Ga0496112_0047202_2962_4056 360
353 3300049569 Ga0501032_0033530 Ga0501032_0033530_918_2051 360
354 3300049573 Ga0501037_0016066 Ga0501037_0016066_3881_5014 360
355 3300049574 Ga0501038_0022914 Ga0501038_0022914_257_1390 360
356 3300049575 Ga0501039_0006182 Ga0501039_0006182_7648_8781 360
357 3300049586 Ga0501070_0076389 Ga0501070_0076389_79_1212 360
358 iso_pu_bacteria 2808606371 2808898681 360
359 iso_pu_bacteria 2919034639 2919039114 360
360 iso_pu_bacteria 2808606357 2808829001 361
361 iso_pu_bacteria 2808606360 2808850224 361
362 3300013105 Ga0157369_10151684 Ga0157369_101516844 362
363 3300031901 Ga0307406_10234931 Ga0307406_102349312 362
364 3300031903 Ga0307407_10043578 Ga0307407_100435781 362
365 iso_pu_bacteria 2945916053 2945917017 362
366 3300032126 Ga0307415_100378542 Ga0307415_1003785421 363
367 iso_pu_bacteria 2857740372 2857744841 363
368 iso_pu_bacteria 2904776348 2904780616 363
369 iso_pu_bacteria 2910809715 2910811363 363
370 iso_pu_bacteria 2919059106 2919060884 363
371 iso_pu_bacteria 2919538618 2919541309 363
372 iso_pu_bacteria 2932426870 2932430188 363
373 iso_pu_bacteria 2939647034 2939651255 363
374 iso_pu_bacteria 2939674588 2939678941 363
375 iso_pu_bacteria 8054107350 8054112029 363
376 3300050515 nmdc:mga0a205_121786_c1 nmdc:mga0a205_121786_c1_189_1340 364
377 iso_pu_bacteria 2690315906 2691511806 364
378 iso_pu_bacteria 2808606370 2808893238 364
379 iso_pu_bacteria 2919391150 2919395637 364
380 iso_pu_bacteria 2939598168 2939602395 364
381 iso_pu_bacteria 2945956166 2945956198 364
382 iso_pu_bacteria 2946037020 2946041584 364
383 iso_pu_bacteria 2953998280 2954002782 364
384 iso_pu_bacteria 2974302888 2974305020 364
385 3300032005 Ga0307411_10029162 Ga0307411_100291622 365
386 3300037312 Ga0395899_0103433 Ga0395899_0103433_32_1156 365
387 3300037418 Ga0395900_0056857 Ga0395900_0056857_2631_3755 365
388 3300038443 Ga0395901_0321686 Ga0395901_0321686_245_1369 365
389 3300049569 Ga0501032_0007511 Ga0501032_0007511_5499_6596 365
390 3300049571 Ga0501034_0001687 Ga0501034_0001687_25620_26717 365
391 3300049573 Ga0501037_0170685 Ga0501037_0170685_170_1267 365
392 iso_pu_bacteria 2945941187 2945945493 365
393 3300003320 rootH2_10130506 rootH2_101305063 366
394 3300006852 Ga0075433_10343031 Ga0075433_103430312 366
395 3300006871 Ga0075434_100154967 Ga0075434_1001549673 366
396 3300007076 Ga0075435_100023865 Ga0075435_1000238652 366
397 3300049576 Ga0501040_0051796 Ga0501040_0051796_547_1647 366
398 3300049591 Ga0501075_0149405 Ga0501075_0149405_315_1415 366
399 3300050515 nmdc:mga0a205_268935_c1 nmdc:mga0a205_268935_c1_207_1307 366
400 3300005354 Ga0070675_100157289 Ga0070675_1001572891 367
401 3300005543 Ga0070672_100101753 Ga0070672_1001017533 367
402 3300005545 Ga0070695_100078205 Ga0070695_1000782052 367
403 3300009148 Ga0105243_10086908 Ga0105243_100869082 367
404 3300011119 Ga0105246_10012860 Ga0105246_100128604 367
405 3300013297 Ga0157378_10065443 Ga0157378_100654432 367
406 3300025303 Ga0209051_1008918 Ga0209051_10089182 367
407 3300025315 Ga0207697_10006018 Ga0207697_100060184 367
408 3300025728 Ga0207655_1013460 Ga0207655_10134604 367
409 3300025728 Ga0207655_1040046 Ga0207655_10400462 367
410 3300025940 Ga0207691_10115023 Ga0207691_101150231 367
411 3300025942 Ga0207689_10019504 Ga0207689_100195045 367
412 3300031548 Ga0307408_100039793 Ga0307408_1000397934 367
413 3300031852 Ga0307410_10045226 Ga0307410_100452261 367
414 3300032004 Ga0307414_10192179 Ga0307414_101921792 367
415 3300048906 Ga0496103_0160284 Ga0496103_0160284_97_1200 367
416 3300048910 Ga0496107_0048708 Ga0496107_0048708_531_1634 367
417 3300049573 Ga0501037_0005772 Ga0501037_0005772_1193_2320 367
418 3300050512 nmdc:mga0n895_42377_c1 nmdc:mga0n895_42377_c1_235_1347 367
419 3300050515 nmdc:mga0a205_72547_c1 nmdc:mga0a205_72547_c1_459_1565 367
420 3300031731 Ga0307405_10013234 Ga0307405_100132344 368
421 3300031824 Ga0307413_10041989 Ga0307413_100419892 368
422 3300031824 Ga0307413_10119284 Ga0307413_101192842 368
423 3300031852 Ga0307410_10151640 Ga0307410_101516402 368
424 3300032002 Ga0307416_100218289 Ga0307416_1002182892 368
425 3300032002 Ga0307416_100294042 Ga0307416_1002940421 368
426 3300048906 Ga0496103_0010898 Ga0496103_0010898_1908_3032 368
427 3300048912 Ga0496109_0118589 Ga0496109_0118589_291_1415 368
428 3300049574 Ga0501038_0005777 Ga0501038_0005777_3295_4422 368
429 3300049579 Ga0501043_0080907 Ga0501043_0080907_861_1988 368
430 3300005467 Ga0070706_100085561 Ga0070706_1000855613 369
431 3300005468 Ga0070707_100093590 Ga0070707_1000935903 369
432 3300011119 Ga0105246_10013182 Ga0105246_100131822 369
433 3300027907 Ga0207428_10019358 Ga0207428_100193582 369
434 3300031548 Ga0307408_100021476 Ga0307408_1000214764 369
435 3300031731 Ga0307405_10008040 Ga0307405_100080404 369
436 3300031824 Ga0307413_10038462 Ga0307413_100384622 369
437 3300031824 Ga0307413_10068560 Ga0307413_100685602 369
438 3300031852 Ga0307410_10033515 Ga0307410_100335154 369
439 3300031852 Ga0307410_10056489 Ga0307410_100564893 369
440 3300031901 Ga0307406_10026807 Ga0307406_100268073 369
441 3300031901 Ga0307406_10046104 Ga0307406_100461042 369
442 3300031903 Ga0307407_10016419 Ga0307407_100164193 369
443 3300031911 Ga0307412_10069772 Ga0307412_100697723 369
444 3300031911 Ga0307412_10087338 Ga0307412_100873382 369
445 3300031995 Ga0307409_100038141 Ga0307409_1000381412 369
446 3300032002 Ga0307416_100005550 Ga0307416_1000055502 369
447 3300032002 Ga0307416_100255894 Ga0307416_1002558942 369
448 3300032002 Ga0307416_100335649 Ga0307416_1003356491 369
449 3300032004 Ga0307414_10264215 Ga0307414_102642151 369
450 3300032126 Ga0307415_100068238 Ga0307415_1000682383 369
451 3300041405 Ga0439438_024979 Ga0439438_024979_98_1207 369
452 3300041406 Ga0439439_0007543 Ga0439439_0007543_72_1181 369
453 3300041411 Ga0439466_0002744 Ga0439466_0002744_784_1893 369
454 3300042002 Ga0439442_002583 Ga0439442_002583_29_1138 369
455 3300042007 Ga0439449_0001865 Ga0439449_0001865_988_2097 369
456 3300042435 Ga0439434_0016708 Ga0439434_0016708_47_1156 369
457 3300042147 Ga0450910_001694 Ga0450910_001694_1123_2250 370
458 3300031548 Ga0307408_100170101 Ga0307408_1001701012 373
459 3300046473 Ga0495582_0019386 Ga0495582_0019386_597_1721 373
460 3300046475 Ga0495639_0028944 Ga0495639_0028944_443_1567 373
461 3300046518 Ga0495631_0030681 Ga0495631_0030681_492_1613 373
462 3300046530 Ga0495654_0079682 Ga0495654_0079682_355_1476 373
463 3300046535 Ga0495586_0052936 Ga0495586_0052936_571_1695 373
464 3300046558 Ga0495633_0046004 Ga0495633_0046004_31_1152 373
465 3300046615 Ga0495656_0004238 Ga0495656_0004238_2883_4004 373
466 3300046664 Ga0495659_0010181 Ga0495659_0010181_831_1952 373
467 3300046674 Ga0495588_0040433 Ga0495588_0040433_696_1820 373
468 3300046691 Ga0495670_0000338 Ga0495670_0000338_3905_5026 373
469 3300046691 Ga0495670_0062159 Ga0495670_0062159_43_1164 373
470 3300046809 Ga0495600_0128663 Ga0495600_0128663_25_1149 373
471 3300047318 Ga0495636_0005293 Ga0495636_0005293_1902_3023 373
472 3300047470 Ga0495681_0037248 Ga0495681_0037248_202_1323 373
473 3300047673 Ga0495593_0009654 Ga0495593_0009654_4331_5455 373
474 3300048907 Ga0496104_0080987 Ga0496104_0080987_1339_2460 373
475 3300048911 Ga0496108_0196963 Ga0496108_0196963_140_1261 373
476 3300025907 Ga0207645_10008636 Ga0207645_100086364 377
477 3300025926 Ga0207659_10014866 Ga0207659_100148665 377
478 3300025960 Ga0207651_10012861 Ga0207651_100128612 377
479 iso_pu_bacteria 2811994871 2812319264 382
480 3300031731 Ga0307405_10014199 Ga0307405_100141993 385
481 3300031852 Ga0307410_10137383 Ga0307410_101373832 385
482 3300032002 Ga0307416_100162820 Ga0307416_1001628202 385
483 3300013308 Ga0157375_10148212 Ga0157375_101482122 398
484 3300048903 Ga0496100_0003367 Ga0496100_0003367_5977_7173 398
485 3300048905 Ga0496102_0077871 Ga0496102_0077871_351_1547 398
486 3300048906 Ga0496103_0017766 Ga0496103_0017766_2059_3255 398
487 3300048909 Ga0496106_0004267 Ga0496106_0004267_3326_4522 398
488 3300048910 Ga0496107_0028931 Ga0496107_0028931_1079_2275 398
489 3300048913 Ga0496110_0072716 Ga0496110_0072716_1505_2701 398
490 3300048914 Ga0496111_0049095 Ga0496111_0049095_1497_2693 398
491 3300000549 LJQas_1000586 LJQas_10005867 405

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00174

Oxidored_molyb

Oxidoreductase molybdopterin binding domain

96

268

0.96

PF03404

Mo-co_dimer

Mo-co oxidoreductase dimerisation domain

286

405

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ca4-assembly1.cif.gz_A sulfite dehydrogenase from starkeya novella mutant 0.9199 73 405
2ca3-assembly1.cif.gz_A sulfite dehydrogenase from starkeya novella r55m mutant 0.9183 73 405
2c9x-assembly1.cif.gz_A sulfite dehydrogenase from starkeya novella y236f mutant 0.9181 73 405
2bpb-assembly1.cif.gz_A sulfite dehydrogenase from starkeya novella 0.9095 73 405
3r18-assembly1.cif.gz_A-2 chicken sulfite oxidase double mutant with altered activity and substrate affinity 0.8968 73 405
ID Description Score Start End Superfamily
af_I1N786_1_262_3.90.420.10 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.9403 73 274 3.90.420.10
2ca4A01 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.9266 73 279 3.90.420.10
af_P11035_116_359_3.90.420.10 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.9197 72 282 3.90.420.10
af_Q54XJ8_10_262_3.90.420.10 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.9188 73 281 3.90.420.10
2biiB01 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.9122 71 276 3.90.420.10
ID Description Score Start End GO Terms
AF-A0A538J6U1-F1-model_v4 Sulfite oxidase 0.9786 76 405 GO:0006790
GO:0008482
GO:0020037
GO:0030151
GO:0043546
AF-A0A7W1HPM1-F1-model_v4 Sulfite oxidase 0.9715 85 405 GO:0006790
GO:0008482
GO:0020037
GO:0030151
GO:0043546
AF-A0A536LKC0-F1-model_v4 Sulfite oxidase 0.9697 76 268 GO:0006790
GO:0008482
GO:0020037
GO:0043546
AF-A0A538J6U1-F1-model_v4 Sulfite oxidase 0.9586 76 405 GO:0006790
GO:0008482
GO:0020037
GO:0030151
GO:0043546
AF-A0A1W2C1P1-F1-model_v4 Oxidoreductase molybdopterin binding domain-containing protein 0.9553 163 271 GO:0006790
GO:0008482
GO:0020037
GO:0043546

Feature Viewer

pLDDT pTM Quality
82.1 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map