F454013

General Info

Members Datasets Scaffolds Average Seq Length
490 196 980 234

Family's Representative Sequence

Representative Sequence 3300049588|Ga0501072_0089029|Ga0501072_0089029_564_1370
Length 268
Sequence MVLIFIGLAFWRPSMQCPYDPCKKRDMKRCSVYSASPKAPKLLFVILCLAAWCVMAGGSAWGGTIRGTVRFTGATVEPKKLPVTVDHAVCGKEKDAEDLVLSPEKGIRNVVVSLQPSPAGAKWPTFLPSVQMDQGECVFVPRVVVVPVGGTVEFLNSDRLLHNLHSASTKNLTFNRTQPRGRTIPIVFNKPEIIRLDCDLHPWMRAWVVVAEHPFYAITNDQGEFVLENVPPGKYTLQVWQESLGTVTQDVTVREEGDTPVTVEMSQK

Samples

Sample ID Description Type Environment
1 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
2 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
48 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
49 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
59 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
60 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
72 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
79 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
80 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
120 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
123 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
124 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
125 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
126 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
127 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
128 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
129 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
130 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
131 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
132 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
133 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
134 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
135 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
136 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
137 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
138 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
139 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
140 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
141 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
142 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
143 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
144 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
145 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
146 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
147 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
148 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
149 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
150 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
151 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
152 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
153 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
154 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
155 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
169 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
170 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
171 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
172 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
173 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
174 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
175 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
176 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
177 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
178 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
179 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
180 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
181 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
182 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
184 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
185 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
186 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
187 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
188 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
189 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
190 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
191 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
192 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
193 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
194 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
195 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
196 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.22
Rhizosphere 98.57
Stem 0
Stem Tuber 0
Unclassified 16.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501072_0089029 3300049588 Bacteria 2450
2 JGI25405J52794_10000451 3300003911 Bacteria 5815
3 Ga0065712_10069486 3300005290 Bacteria 7198
4 Ga0065707_10100483 3300005295 Bacteria 2927
5 Ga0070676_10331037 3300005328 Unclassified 1041
6 Ga0070690_100007878 3300005330 Bacteria 6111
7 Ga0070670_100001766 3300005331 Bacteria 17595
8 Ga0068869_100853232 3300005334 Unclassified 786
9 Ga0070680_100011527 3300005336 Bacteria 6840
10 Ga0068868_100154639 3300005338 Bacteria 1891
11 Ga0070660_100012240 3300005339 Bacteria 6123
12 Ga0070691_10061433 3300005341 Bacteria 1807
13 Ga0070661_100005812 3300005344 Bacteria 8484
14 Ga0070668_100072979 3300005347 Bacteria 2675
15 Ga0070669_100067062 3300005353 Bacteria 2646
16 Ga0070671_100318817 3300005355 Bacteria 1324
17 Ga0070674_100041440 3300005356 Bacteria 3121
18 Ga0070673_100323778 3300005364 Bacteria 1362
19 Ga0070659_100071414 3300005366 Bacteria 2760
20 Ga0070701_10015824 3300005438 Bacteria 3494
21 Ga0070711_100059316 3300005439 Bacteria 2656
22 Ga0070705_100394781 3300005440 Bacteria 1022
23 Ga0070694_100293941 3300005444 Bacteria 1243
24 Ga0070708_100000602 3300005445 Bacteria 27055
25 Ga0070708_100014220 3300005445 Bacteria 6540
26 Ga0070708_100137357 3300005445 Bacteria 2265
27 Ga0070708_100228421 3300005445 Bacteria 1746
28 Ga0070708_100280652 3300005445 Bacteria 1568
29 Ga0070708_100665770 3300005445 Bacteria 980
30 Ga0070663_100066464 3300005455 Bacteria 2612
31 Ga0070681_10285145 3300005458 Unclassified 1562
32 Ga0070706_100004708 3300005467 Bacteria 13090
33 Ga0070706_100019315 3300005467 Bacteria 6285
34 Ga0070706_100034961 3300005467 Bacteria 4640
35 Ga0070706_100793605 3300005467 Archaea 877
36 Ga0070707_100003325 3300005468 Bacteria 15181
37 Ga0070707_100011102 3300005468 Bacteria 8389
38 Ga0070707_100057195 3300005468 Bacteria 3741
39 Ga0070707_100062028 3300005468 Bacteria 3586
40 Ga0070707_100104477 3300005468 Bacteria 2746
41 Ga0070707_100177265 3300005468 Bacteria 2078
42 Ga0070707_100257591 3300005468 Unclassified 1698
43 Ga0070707_100663447 3300005468 Bacteria 1006
44 Ga0070707_100707725 3300005468 Unclassified 970
45 Ga0070698_100178567 3300005471 Bacteria 2061
46 Ga0070699_100004312 3300005518 Bacteria 12575
47 Ga0070697_100009950 3300005536 Bacteria 7419
48 Ga0070697_100078755 3300005536 Bacteria 2713
49 Ga0070697_100095069 3300005536 Bacteria 2470
50 Ga0070697_100124017 3300005536 Bacteria 2163
51 Ga0070697_100282165 3300005536 Unclassified 1425
52 Ga0070697_100361859 3300005536 Bacteria 1254
53 Ga0070686_100457357 3300005544 Unclassified 983
54 Ga0070695_100118881 3300005545 Bacteria 1805
55 Ga0070695_100304947 3300005545 Bacteria 1178
56 Ga0070696_100104051 3300005546 Bacteria 2038
57 Ga0070696_100160545 3300005546 Bacteria 1656
58 Ga0070665_100304150 3300005548 Bacteria 1598
59 Ga0070704_100256595 3300005549 Unclassified 1438
60 Ga0070704_100534083 3300005549 Bacteria 1023
61 Ga0070704_100691043 3300005549 Bacteria 904
62 Ga0068855_100219544 3300005563 Bacteria 2132
63 Ga0070664_100033682 3300005564 Bacteria 4293
64 Ga0070664_100050074 3300005564 Bacteria 3534
65 Ga0068856_100317115 3300005614 Bacteria 1576
66 Ga0068852_100634300 3300005616 Bacteria 1075
67 Ga0068864_100037099 3300005618 Bacteria 4157
68 Ga0068864_100483337 3300005618 Bacteria 1189
69 Ga0068866_10329093 3300005718 Bacteria 964
70 Ga0068861_100072706 3300005719 Bacteria 2669
71 Ga0068861_100703663 3300005719 Unclassified 939
72 Ga0068863_100007993 3300005841 Bacteria 10338
73 Ga0068860_100012812 3300005843 Bacteria 8244
74 Ga0068860_100072214 3300005843 Bacteria 3279
75 Ga0068860_100191681 3300005843 Bacteria 1978
76 Ga0068862_100022193 3300005844 Bacteria 5310
77 Ga0081455_10001868 3300005937 Bacteria 25350
78 Ga0081455_10184210 3300005937 Bacteria 1578
79 Ga0081455_10231401 3300005937 Unclassified 1364
80 Ga0081538_10004502 3300005981 Bacteria 12826
81 Ga0081538_10009006 3300005981 Bacteria 8382
82 Ga0081538_10013157 3300005981 Bacteria 6569
83 Ga0070715_10112765 3300006163 Unclassified 1285
84 Ga0068871_100076313 3300006358 Bacteria 2767
85 Ga0075428_100024084 3300006844 Bacteria 6736
86 Ga0075428_100043178 3300006844 Bacteria 4957
87 Ga0075428_100058672 3300006844 Bacteria 4213
88 Ga0075428_100060413 3300006844 Bacteria 4150
89 Ga0075428_100093244 3300006844 Bacteria 3283
90 Ga0075428_100129807 3300006844 Bacteria 2742
91 Ga0075428_100545907 3300006844 Bacteria 1239
92 Ga0075428_100743186 3300006844 Bacteria 1044
93 Ga0075430_100027551 3300006846 Bacteria 4827
94 Ga0075430_100067775 3300006846 Bacteria 2995
95 Ga0075430_100089490 3300006846 Bacteria 2575
96 Ga0075430_100116775 3300006846 Unclassified 2224
97 Ga0075430_100127480 3300006846 Bacteria 2122
98 Ga0075430_100243877 3300006846 Unclassified 1489
99 Ga0075431_100013329 3300006847 Bacteria 8310
100 Ga0075431_100017994 3300006847 Bacteria 7186
101 Ga0075431_100022315 3300006847 Bacteria 6470
102 Ga0075431_100059424 3300006847 Bacteria 3945
103 Ga0075431_100091971 3300006847 Bacteria 3130
104 Ga0075431_100116157 3300006847 Bacteria 2762
105 Ga0075431_100134791 3300006847 Bacteria 2546
106 Ga0075431_100357399 3300006847 Unclassified 1468
107 Ga0075433_10003217 3300006852 Bacteria 12602
108 Ga0075433_10030968 3300006852 Bacteria 4568
109 Ga0075433_10047905 3300006852 Bacteria 3717
110 Ga0075433_10054362 3300006852 Bacteria 3493
111 Ga0075433_10167234 3300006852 Bacteria 1957
112 Ga0075433_10236817 3300006852 Bacteria 1621
113 Ga0075434_100023778 3300006871 Bacteria 5978
114 Ga0075434_100026457 3300006871 Bacteria 5683
115 Ga0075434_100057028 3300006871 Bacteria 3882
116 Ga0075434_100071134 3300006871 Bacteria 3469
117 Ga0075434_100141573 3300006871 Bacteria 2425
118 Ga0075429_100004577 3300006880 Bacteria 11886
119 Ga0075429_100011924 3300006880 Bacteria 7537
120 Ga0075429_100027596 3300006880 Bacteria 4928
121 Ga0075429_100029359 3300006880 Bacteria 4777
122 Ga0068865_100230520 3300006881 Bacteria 1453
123 Ga0075436_100002456 3300006914 Bacteria 12751
124 Ga0075436_100054258 3300006914 Bacteria 2767
125 Ga0075436_100323448 3300006914 Bacteria 1108
126 Ga0075435_100005700 3300007076 Bacteria 8727
127 Ga0075435_100025025 3300007076 Bacteria 4641
128 Ga0075435_100042041 3300007076 Bacteria 3655
129 Ga0075435_100086384 3300007076 Bacteria 2583
130 Ga0099794_10004555 3300007265 Bacteria 5462
131 Ga0105240_10058057 3300009093 Bacteria 4831
132 Ga0111539_10031669 3300009094 Bacteria 6424
133 Ga0111539_10065873 3300009094 Bacteria 4279
134 Ga0111539_10104476 3300009094 Bacteria 3324
135 Ga0111539_10512157 3300009094 Bacteria 1398
136 Ga0111539_10701422 3300009094 Bacteria 1178
137 Ga0105245_10642683 3300009098 Bacteria 1091
138 Ga0114129_10000042 3300009147 Bacteria 107385
139 Ga0114129_10003401 3300009147 Bacteria 22352
140 Ga0114129_10013154 3300009147 Bacteria 11791
141 Ga0114129_10022282 3300009147 Bacteria 8993
142 Ga0114129_10064467 3300009147 Bacteria 5113
143 Ga0114129_10084612 3300009147 Bacteria 4403
144 Ga0114129_10101266 3300009147 Bacteria 3986
145 Ga0114129_10123770 3300009147 Bacteria 3556
146 Ga0114129_10175573 3300009147 Bacteria 2918
147 Ga0114129_10250783 3300009147 Bacteria 2376
148 Ga0114129_10263491 3300009147 Bacteria 2309
149 Ga0114129_10263862 3300009147 Bacteria 2307
150 Ga0114129_10384352 3300009147 Unclassified 1853
151 Ga0105243_10018921 3300009148 Bacteria 5222
152 Ga0105243_10336270 3300009148 Unclassified 1381
153 Ga0105243_10442277 3300009148 Bacteria 1218
154 Ga0105241_10017267 3300009174 Bacteria 5301
155 Ga0105241_10026584 3300009174 Bacteria 4307
156 Ga0105242_10078292 3300009176 Unclassified 2759
157 Ga0105248_10063087 3300009177 Bacteria 4159
158 Ga0105249_10004937 3300009553 Bacteria 11514
159 Ga0105249_10074661 3300009553 Bacteria 3139
160 Ga0105249_10150685 3300009553 Bacteria 2239
161 Ga0105239_10026489 3300010375 Bacteria 6380
162 Ga0157313_1002182 3300012503 Bacteria 1144
163 Ga0157371_10310250 3300013102 Unclassified 1143
164 Ga0157378_10046896 3300013297 Bacteria 3841
165 Ga0157378_10589992 3300013297 Bacteria 1121
166 Ga0163162_10125496 3300013306 Bacteria 2673
167 Ga0163162_10170949 3300013306 Unclassified 2298
168 Ga0163162_10385573 3300013306 Bacteria 1534
169 Ga0157375_10576883 3300013308 Bacteria 1285
170 Ga0157380_10554830 3300014326 Unclassified 1128
171 Ga0157380_10861712 3300014326 Unclassified 929
172 Ga0157379_10309629 3300014968 Bacteria 1440
173 Ga0157376_10132577 3300014969 Bacteria 2226
174 Ga0163161_10138356 3300017792 Bacteria 1842
175 Ga0207697_10010005 3300025315 Bacteria 4073
176 Ga0207697_10021653 3300025315 Bacteria 2632
177 Ga0207682_10081851 3300025893 Bacteria 1385
178 Ga0207692_10123887 3300025898 Bacteria 1451
179 Ga0207688_10014066 3300025901 Bacteria 4351
180 Ga0207645_10002135 3300025907 Bacteria 15800
181 Ga0207684_10000546 3300025910 Bacteria 46386
182 Ga0207684_10003757 3300025910 Bacteria 14679
183 Ga0207684_10008118 3300025910 Bacteria 9360
184 Ga0207684_10085343 3300025910 Bacteria 2690
185 Ga0207684_10608402 3300025910 Unclassified 933
186 Ga0207654_10013702 3300025911 Bacteria 4175
187 Ga0207707_10231171 3300025912 Unclassified 1609
188 Ga0207693_10210400 3300025915 Unclassified 1529
189 Ga0207663_10050711 3300025916 Bacteria 2581
190 Ga0207657_10008121 3300025919 Bacteria 10703
191 Ga0207652_10384739 3300025921 Bacteria 1266
192 Ga0207646_10001810 3300025922 Bacteria 25862
193 Ga0207646_10007073 3300025922 Bacteria 11478
194 Ga0207646_10010158 3300025922 Bacteria 9225
195 Ga0207646_10048794 3300025922 Bacteria 3794
196 Ga0207646_10245163 3300025922 Unclassified 1618
197 Ga0207646_10836786 3300025922 Bacteria 818
198 Ga0207681_10030697 3300025923 Bacteria 3505
199 Ga0207706_10005843 3300025933 Bacteria 11441
200 Ga0207706_10129009 3300025933 Bacteria 2224
201 Ga0207686_10108729 3300025934 Bacteria 1866
202 Ga0207709_10044412 3300025935 Bacteria 2685
203 Ga0207669_10193410 3300025937 Bacteria 1470
204 Ga0207704_10046640 3300025938 Bacteria 2584
205 Ga0207691_10020252 3300025940 Bacteria 6289
206 Ga0207689_10487196 3300025942 Unclassified 1033
207 Ga0207679_10027038 3300025945 Bacteria 3963
208 Ga0207679_10119614 3300025945 Bacteria 2094
209 Ga0207651_10146252 3300025960 Bacteria 1833
210 Ga0207712_10011533 3300025961 Bacteria 5633
211 Ga0207712_10409373 3300025961 Bacteria 1142
212 Ga0207658_10155701 3300025986 Bacteria 1867
213 Ga0207678_10007705 3300026067 Bacteria 9512
214 Ga0207708_10297269 3300026075 Bacteria 1312
215 Ga0207702_10312865 3300026078 Bacteria 1493
216 Ga0207641_10063732 3300026088 Bacteria 3149
217 Ga0207676_10083902 3300026095 Bacteria 2596
218 Ga0207676_10327250 3300026095 Bacteria 1409
219 Ga0207675_100026649 3300026118 Bacteria 5381
220 Ga0207675_100521275 3300026118 Unclassified 1185
221 Ga0207698_10564252 3300026142 Bacteria 1118
222 Ga0209973_1013162 3300027252 Unclassified 1016
223 Ga0209967_1006322 3300027364 Bacteria 1606
224 Ga0209981_1021081 3300027378 Unclassified 931
225 Ga0209982_1007253 3300027552 Bacteria 1620
226 Ga0209982_1025795 3300027552 Unclassified 915
227 Ga0209983_1042080 3300027665 Unclassified 990
228 Ga0209966_1036291 3300027695 Unclassified 1014
229 Ga0209998_10035956 3300027717 Bacteria 1111
230 Ga0207428_10431740 3300027907 Bacteria 962
231 Ga0268265_10013080 3300028380 Bacteria 5634
232 Ga0268265_10785050 3300028380 Unclassified 927
233 Ga0268264_11024447 3300028381 Unclassified 833
234 Ga0307408_100018618 3300031548 Bacteria 4665
235 Ga0307408_100170516 3300031548 Bacteria 1737
236 Ga0307405_10021556 3300031731 Bacteria 3624
237 Ga0307413_10162363 3300031824 Bacteria 1571
238 Ga0307410_10119901 3300031852 Bacteria 1917
239 Ga0307412_10005134 3300031911 Bacteria 7334
240 Ga0307412_10074638 3300031911 Bacteria 2324
241 Ga0307412_10175352 3300031911 Bacteria 1607
242 Ga0307412_10448650 3300031911 Bacteria 1062
243 Ga0307409_100056343 3300031995 Bacteria 3039
244 Ga0307416_100003263 3300032002 Bacteria 9495
245 Ga0307416_100054521 3300032002 Bacteria 3214
246 Ga0307411_10206460 3300032005 Bacteria 1513
247 Ga0307411_10554212 3300032005 Bacteria 981
248 Ga0307415_100137932 3300032126 Bacteria 1858
249 Ga0307415_100206699 3300032126 Bacteria 1563
250 Ga0373926_0015035 3300035083 Unclassified 2636
251 Ga0373936_0089630 3300035113 Unclassified 1288
252 Ga0373931_0017748 3300035691 Unclassified 3525
253 Ga0373935_0056709 3300035692 Bacteria 2498
254 Ga0373927_0123917 3300035695 Unclassified 1687
255 Ga0373947_0025354 3300035725 Unclassified 3458
256 Ga0373925_0045680 3300037068 Bacteria 3254
257 Ga0395899_0028945 3300037312 Bacteria 4169
258 Ga0395900_0062689 3300037418 Bacteria 3822
259 Ga0395905_0065729 3300037471 Bacteria 3396
260 Ga0395901_0226726 3300038443 Bacteria 1952
261 Ga0451839_0010972 3300041496 Bacteria 908
262 Ga0439435_0002036 3300042436 Bacteria 3909
263 Ga0439435_0006320 3300042436 Bacteria 2657
264 Ga0439444_0002774 3300042437 Bacteria 2425
265 Ga0439460_0032480 3300042461 Bacteria 1495
266 Ga0450893_0039389 3300042532 Bacteria 862
267 Ga0453683_0037657 3300044673 Bacteria 3042
268 Ga0451576_0070858 3300045051 Bacteria 3628
269 Ga0495670_0252908 3300046691 Unclassified 940
270 Ga0496103_0070813 3300048906 Unclassified 2182
271 Ga0496108_0706750 3300048911 Unclassified 874
272 Ga0496111_0489534 3300048914 Unclassified 906
273 Ga0496112_0006528 3300048915 Bacteria 10257
274 Ga0496112_0251487 3300048915 Bacteria 1718
275 Ga0496113_0544313 3300048916 Unclassified 931
276 Ga0501031_0016482 3300049568 Bacteria 4801
277 Ga0501031_0028291 3300049568 Bacteria 3653
278 Ga0501033_0038046 3300049570 Bacteria 3599
279 Ga0501033_0064442 3300049570 Bacteria 2697
280 Ga0501033_0385283 3300049570 Bacteria 979
281 Ga0501034_0105028 3300049571 Unclassified 2818
282 Ga0501036_0134794 3300049572 Unclassified 2084
283 Ga0501036_0156401 3300049572 Unclassified 1922
284 Ga0501036_0184877 3300049572 Bacteria 1754
285 Ga0501036_0401689 3300049572 Bacteria 1143
286 Ga0501036_0406788 3300049572 Unclassified 1135
287 Ga0501036_0536695 3300049572 Bacteria 972
288 Ga0501037_0183832 3300049573 Unclassified 1482
289 Ga0501037_0464084 3300049573 Unclassified 862
290 Ga0501038_0001539 3300049574 Bacteria 21270
291 Ga0501038_0025651 3300049574 Bacteria 5251
292 Ga0501038_0045247 3300049574 Bacteria 3821
293 Ga0501038_0047922 3300049574 Bacteria 3700
294 Ga0501039_0001351 3300049575 Bacteria 17957
295 Ga0501039_0087340 3300049575 Bacteria 2429
296 Ga0501039_0112284 3300049575 Bacteria 2131
297 Ga0501039_0310622 3300049575 Bacteria 1239
298 Ga0501040_0002474 3300049576 Bacteria 11896
299 Ga0501040_0016770 3300049576 Bacteria 4856
300 Ga0501040_0027441 3300049576 Bacteria 3834
301 Ga0501040_0029233 3300049576 Bacteria 3720
302 Ga0501040_0047473 3300049576 Bacteria 2932
303 Ga0501040_0386063 3300049576 Bacteria 1005
304 Ga0501041_0004419 3300049577 Bacteria 8131
305 Ga0501041_0004507 3300049577 Bacteria 8076
306 Ga0501041_0016103 3300049577 Bacteria 4441
307 Ga0501041_0031825 3300049577 Bacteria 3189
308 Ga0501041_0035075 3300049577 Bacteria 3039
309 Ga0501041_0186103 3300049577 Bacteria 1300
310 Ga0501042_0003428 3300049578 Bacteria 9956
311 Ga0501042_0060559 3300049578 Bacteria 2704
312 Ga0501042_0142491 3300049578 Bacteria 1728
313 Ga0501042_0158044 3300049578 Bacteria 1635
314 Ga0501042_0227399 3300049578 Viruses 1345
315 Ga0501043_0099472 3300049579 Unclassified 2286
316 Ga0501043_0120693 3300049579 Bacteria 2055
317 Ga0501043_0238125 3300049579 Unclassified 1404
318 Ga0501046_0056320 3300049580 Bacteria 3087
319 Ga0501046_0082073 3300049580 Bacteria 2490
320 Ga0501046_0116539 3300049580 Unclassified 2036
321 Ga0501046_0190438 3300049580 Bacteria 1530
322 Ga0501046_0237976 3300049580 Unclassified 1343
323 Ga0501046_0316651 3300049580 Unclassified 1137
324 Ga0501048_0028919 3300049582 Bacteria 4022
325 Ga0501048_0047096 3300049582 Viruses 3076
326 Ga0501048_0067057 3300049582 Unclassified 2537
327 Ga0501048_0465030 3300049582 Unclassified 906
328 Ga0501067_0015384 3300049583 Bacteria 4236
329 Ga0501068_0005072 3300049584 Bacteria 7179
330 Ga0501068_0008284 3300049584 Bacteria 5777
331 Ga0501068_0013731 3300049584 Bacteria 4614
332 Ga0501068_0121117 3300049584 Bacteria 1631
333 Ga0501069_0010659 3300049585 Bacteria 4872
334 Ga0501069_0018708 3300049585 Bacteria 3741
335 Ga0501070_0795206 3300049586 Unclassified 743
336 Ga0501071_0017350 3300049587 Bacteria 4962
337 Ga0501071_0024075 3300049587 Bacteria 4256
338 Ga0501071_0032278 3300049587 Bacteria 3717
339 Ga0501071_0038579 3300049587 Bacteria 3414
340 Ga0501072_0000634 3300049588 Bacteria 25170
341 Ga0501072_0003793 3300049588 Bacteria 11409
342 Ga0501072_0019188 3300049588 Bacteria 5283
343 Ga0501072_0020544 3300049588 Bacteria 5118
344 Ga0501072_0084053 3300049588 Bacteria 2523
345 Ga0501072_0177894 3300049588 Bacteria 1697
346 Ga0501072_0240398 3300049588 Bacteria 1442
347 Ga0501072_0242021 3300049588 Bacteria 1437
348 Ga0501072_0569208 3300049588 Unclassified 894
349 Ga0501073_0005650 3300049589 Bacteria 9357
350 Ga0501074_0045257 3300049590 Bacteria 3184
351 Ga0501074_0058291 3300049590 Bacteria 2782
352 Ga0501074_0241390 3300049590 Bacteria 1285
353 Ga0501074_0273829 3300049590 Unclassified 1200
354 Ga0501075_0000273 3300049591 Bacteria 28401
355 Ga0501075_0009685 3300049591 Bacteria 6749
356 Ga0501075_0011783 3300049591 Bacteria 6198
357 Ga0501075_0041079 3300049591 Bacteria 3466
358 Ga0501075_0064793 3300049591 Bacteria 2756
359 Ga0501075_0067008 3300049591 Bacteria 2710
360 Ga0501075_0070679 3300049591 Viruses 2637
361 Ga0501075_0085396 3300049591 Bacteria 2391
362 Ga0501075_0134004 3300049591 Unclassified 1887
363 Ga0501075_0156841 3300049591 Bacteria 1736
364 Ga0501075_0338817 3300049591 Unclassified 1146
365 Ga0501075_0795365 3300049591 Bacteria 720
366 Ga0501076_0000533 3300049592 Bacteria 24272
367 Ga0501076_0001082 3300049592 Bacteria 17902
368 Ga0501076_0009767 3300049592 Bacteria 7088
369 Ga0501076_0011985 3300049592 Bacteria 6477
370 Ga0501076_0021691 3300049592 Bacteria 4930
371 Ga0501076_0029349 3300049592 Bacteria 4277
372 Ga0501076_0074869 3300049592 Bacteria 2713
373 Ga0501076_0242318 3300049592 Bacteria 1475
374 Ga0501076_0265132 3300049592 Unclassified 1406
375 Ga0501076_0589495 3300049592 Bacteria 917
376 Ga0501077_0001092 3300049593 Bacteria 16358
377 Ga0501077_0009728 3300049593 Bacteria 5977
378 Ga0501077_0030361 3300049593 Bacteria 3439
379 Ga0501077_0031137 3300049593 Bacteria 3393
380 Ga0501077_0077122 3300049593 Unclassified 2111
381 Ga0501077_0116546 3300049593 Bacteria 1693
382 Ga0501079_0000496 3300049741 Bacteria 25691
383 Ga0501079_0003087 3300049741 Bacteria 12194
384 Ga0501079_0020111 3300049741 Bacteria 5100
385 Ga0501079_0028874 3300049741 Bacteria 4257
386 Ga0501079_0050518 3300049741 Unclassified 3210
387 Ga0501079_0098917 3300049741 Bacteria 2261
388 Ga0501079_0227783 3300049741 Bacteria 1456
389 Ga0501080_0013689 3300049742 Bacteria 7469
390 Ga0501080_0040587 3300049742 Bacteria 4340
391 Ga0501080_0057606 3300049742 Unclassified 3617
392 Ga0501080_0078154 3300049742 Bacteria 3078
393 Ga0501080_0114559 3300049742 Bacteria 2499
394 Ga0501080_0163025 3300049742 Bacteria 2058
395 Ga0501080_0331968 3300049742 Bacteria 1375
396 Ga0501081_0003599 3300049743 Bacteria 9914
397 Ga0501081_0003921 3300049743 Bacteria 9536
398 Ga0501081_0006925 3300049743 Bacteria 7367
399 Ga0501081_0007356 3300049743 Bacteria 7147
400 Ga0501081_0020846 3300049743 Bacteria 4373
401 Ga0501081_0027548 3300049743 Unclassified 3832
402 Ga0501081_0134794 3300049743 Bacteria 1767
403 Ga0501081_0142912 3300049743 Viruses 1715
404 Ga0501081_0428556 3300049743 Bacteria 981
405 Ga0501083_0012421 3300049744 Bacteria 5958
406 Ga0501083_0179551 3300049744 Bacteria 1382
407 Ga0501083_0404480 3300049744 Unclassified 888
408 Ga0501044_0275542 3300049823 Viruses 1617
409 Ga0501045_0001118 3300049824 Bacteria 17716
410 Ga0501045_0019676 3300049824 Bacteria 4816
411 Ga0501045_0045182 3300049824 Bacteria 3208
412 Ga0501045_0105390 3300049824 Unclassified 2089
413 Ga0501045_0116385 3300049824 Viruses 1983
414 Ga0501045_0212435 3300049824 Bacteria 1441
415 Ga0501045_0220232 3300049824 Bacteria 1413
416 nmdc:mga05p37_12250_c1 3300050507 Bacteria 10241
417 nmdc:mga05p37_138480_c1 3300050507 Bacteria 2983
418 nmdc:mga05p37_163159_c1 3300050507 Bacteria 2720
419 nmdc:mga05p37_305430_c1 3300050507 Bacteria 1888
420 nmdc:mga05p37_31015_c1 3300050507 Bacteria 6528
421 nmdc:mga05p37_35769_c1 3300050507 Unclassified 2952
422 nmdc:mga05p37_37713_c1 3300050507 Bacteria 5927
423 nmdc:mga05p37_519297_c1 3300050507 Bacteria 1363
424 nmdc:mga05p37_5507_c1 3300050507 Bacteria 14871
425 nmdc:mga05p37_62909_c1 3300050507 Bacteria 4567
426 nmdc:mga05p37_65017_c1 3300050507 Bacteria 4283
427 nmdc:mga05p37_661572_c1 3300050507 Unclassified 1168
428 nmdc:mga05p37_730_c1 3300050507 Bacteria 36492
429 nmdc:mga09592_11001_c1 3300050508 Bacteria 7359
430 nmdc:mga09592_118560_c1 3300050508 Bacteria 2272
431 nmdc:mga09592_332572_c1 3300050508 Unclassified 1315
432 nmdc:mga09592_38111_c1 3300050508 Bacteria 4034
433 nmdc:mga09592_662080_c1 3300050508 Unclassified 891
434 nmdc:mga0qj67_118390_c1 3300050509 Bacteria 2141
435 nmdc:mga0qj67_215740_c1 3300050509 Bacteria 1558
436 nmdc:mga0qj67_28468_c1 3300050509 Bacteria 4336
437 nmdc:mga0qj67_46526_c1 3300050509 Unclassified 3425
438 nmdc:mga06r32_10130_c1 3300050510 Bacteria 8509
439 nmdc:mga06r32_14246_c1 3300050510 Bacteria 7211
440 nmdc:mga06r32_28140_c1 3300050510 Bacteria 5256
441 nmdc:mga06r32_28187_c1 3300050510 Bacteria 5252
442 nmdc:mga06r32_9803_c1 3300050510 Bacteria 8643
443 nmdc:mga08y16_296946_c1 3300050511 Bacteria 1665
444 nmdc:mga08y16_390476_c1 3300050511 Bacteria 1426
445 nmdc:mga08y16_55594_c1 3300050511 Bacteria 4135
446 nmdc:mga08y16_96133_c1 3300050511 Bacteria 3085
447 nmdc:mga0n895_133839_c1 3300050512 Bacteria 2505
448 nmdc:mga0n895_220_c1 3300050512 Bacteria 35971
449 nmdc:mga0n895_30449_c1 3300050512 Bacteria 5158
450 nmdc:mga0n895_3102_c1 3300050512 Bacteria 13235
451 nmdc:mga0n895_532008_c1 3300050512 Unclassified 1182
452 nmdc:mga0rr50_111886_c1 3300050513 Bacteria 2162
453 nmdc:mga0rr50_13568_c1 3300050513 Bacteria 5311
454 nmdc:mga0rr50_1764_c1 3300050513 Bacteria 11936
455 nmdc:mga0rr50_3313_c1 3300050513 Bacteria 9251
456 nmdc:mga0rr50_445608_c1 3300050513 Bacteria 1097
457 nmdc:mga0rr50_7100_c1 3300050513 Bacteria 6878
458 nmdc:mga0rr50_73635_c1 3300050513 Bacteria 2612
459 nmdc:mga08x19_207_c1 3300050514 Bacteria 45031
460 nmdc:mga0a205_1976_c1 3300050515 Bacteria 17858
461 nmdc:mga0a205_24678_c1 3300050515 Bacteria 4253
462 nmdc:mga0a205_37490_c1 3300050515 Bacteria 2225
463 nmdc:mga0a205_46506_c1 3300050515 Bacteria 4186
464 nmdc:mga0a205_57473_c1 3300050515 Bacteria 3756
465 nmdc:mga0a205_808835_c1 3300050515 Unclassified 785
466 nmdc:mga0a205_85882_c1 3300050515 Bacteria 3039
467 Ga0501084_0009153 3300054114 Bacteria 8192
468 Ga0501084_0009156 3300054114 Bacteria 8191
469 Ga0501084_0012982 3300054114 Bacteria 6894
470 Ga0501084_0069630 3300054114 Bacteria 2945
471 Ga0501084_0073641 3300054114 Bacteria 2860
472 Ga0501084_0179173 3300054114 Bacteria 1789
473 Ga0501084_0188284 3300054114 Unclassified 1741
474 Ga0590075_006457 3300059424 Bacteria 2781
475 Ga0501082_0013165 3300060353 Bacteria 7112
476 Ga0501082_0025097 3300060353 Bacteria 5135
477 Ga0501082_0033182 3300060353 Bacteria 4453
478 Ga0501082_0049673 3300060353 Bacteria 3618
479 Ga0501082_0068547 3300060353 Bacteria 3054
480 Ga0501082_0135916 3300060353 Viruses 2133
481 Ga0501082_0202517 3300060353 Bacteria 1727
482 Ga0501082_0396360 3300060353 Unclassified 1204
483 Ga0530510_0001094 3300061734 Bacteria 17978
484 Ga0530510_0001815 3300061734 Bacteria 14560
485 Ga0530510_0003097 3300061734 Bacteria 11422
486 Ga0530510_0006938 3300061734 Bacteria 7895
487 Ga0530510_0023603 3300061734 Bacteria 4384
488 Ga0530510_0124818 3300061734 Unclassified 1891
489 Ga0530510_0163888 3300061734 Bacteria 1645
490 Ga0530510_0210110 3300061734 Bacteria 1446
491 Ga0501072_0089029
492 JGI25405J52794_10000451
493 Ga0065712_10069486
494 Ga0065707_10100483
495 Ga0070676_10331037
496 Ga0070690_100007878
497 Ga0070670_100001766
498 Ga0068869_100853232
499 Ga0070680_100011527
500 Ga0068868_100154639
501 Ga0070660_100012240
502 Ga0070691_10061433
503 Ga0070661_100005812
504 Ga0070668_100072979
505 Ga0070669_100067062
506 Ga0070671_100318817
507 Ga0070674_100041440
508 Ga0070673_100323778
509 Ga0070659_100071414
510 Ga0070701_10015824
511 Ga0070711_100059316
512 Ga0070705_100394781
513 Ga0070694_100293941
514 Ga0070708_100000602
515 Ga0070708_100014220
516 Ga0070708_100137357
517 Ga0070708_100228421
518 Ga0070708_100280652
519 Ga0070708_100665770
520 Ga0070663_100066464
521 Ga0070681_10285145
522 Ga0070706_100004708
523 Ga0070706_100019315
524 Ga0070706_100034961
525 Ga0070706_100793605
526 Ga0070707_100003325
527 Ga0070707_100011102
528 Ga0070707_100057195
529 Ga0070707_100062028
530 Ga0070707_100104477
531 Ga0070707_100177265
532 Ga0070707_100257591
533 Ga0070707_100663447
534 Ga0070707_100707725
535 Ga0070698_100178567
536 Ga0070699_100004312
537 Ga0070697_100009950
538 Ga0070697_100078755
539 Ga0070697_100095069
540 Ga0070697_100124017
541 Ga0070697_100282165
542 Ga0070697_100361859
543 Ga0070686_100457357
544 Ga0070695_100118881
545 Ga0070695_100304947
546 Ga0070696_100104051
547 Ga0070696_100160545
548 Ga0070665_100304150
549 Ga0070704_100256595
550 Ga0070704_100534083
551 Ga0070704_100691043
552 Ga0068855_100219544
553 Ga0070664_100033682
554 Ga0070664_100050074
555 Ga0068856_100317115
556 Ga0068852_100634300
557 Ga0068864_100037099
558 Ga0068864_100483337
559 Ga0068866_10329093
560 Ga0068861_100072706
561 Ga0068861_100703663
562 Ga0068863_100007993
563 Ga0068860_100012812
564 Ga0068860_100072214
565 Ga0068860_100191681
566 Ga0068862_100022193
567 Ga0081455_10001868
568 Ga0081455_10184210
569 Ga0081455_10231401
570 Ga0081538_10004502
571 Ga0081538_10009006
572 Ga0081538_10013157
573 Ga0070715_10112765
574 Ga0068871_100076313
575 Ga0075428_100024084
576 Ga0075428_100043178
577 Ga0075428_100058672
578 Ga0075428_100060413
579 Ga0075428_100093244
580 Ga0075428_100129807
581 Ga0075428_100545907
582 Ga0075428_100743186
583 Ga0075430_100027551
584 Ga0075430_100067775
585 Ga0075430_100089490
586 Ga0075430_100116775
587 Ga0075430_100127480
588 Ga0075430_100243877
589 Ga0075431_100013329
590 Ga0075431_100017994
591 Ga0075431_100022315
592 Ga0075431_100059424
593 Ga0075431_100091971
594 Ga0075431_100116157
595 Ga0075431_100134791
596 Ga0075431_100357399
597 Ga0075433_10003217
598 Ga0075433_10030968
599 Ga0075433_10047905
600 Ga0075433_10054362
601 Ga0075433_10167234
602 Ga0075433_10236817
603 Ga0075434_100023778
604 Ga0075434_100026457
605 Ga0075434_100057028
606 Ga0075434_100071134
607 Ga0075434_100141573
608 Ga0075429_100004577
609 Ga0075429_100011924
610 Ga0075429_100027596
611 Ga0075429_100029359
612 Ga0068865_100230520
613 Ga0075436_100002456
614 Ga0075436_100054258
615 Ga0075436_100323448
616 Ga0075435_100005700
617 Ga0075435_100025025
618 Ga0075435_100042041
619 Ga0075435_100086384
620 Ga0099794_10004555
621 Ga0105240_10058057
622 Ga0111539_10031669
623 Ga0111539_10065873
624 Ga0111539_10104476
625 Ga0111539_10512157
626 Ga0111539_10701422
627 Ga0105245_10642683
628 Ga0114129_10000042
629 Ga0114129_10003401
630 Ga0114129_10013154
631 Ga0114129_10022282
632 Ga0114129_10064467
633 Ga0114129_10084612
634 Ga0114129_10101266
635 Ga0114129_10123770
636 Ga0114129_10175573
637 Ga0114129_10250783
638 Ga0114129_10263491
639 Ga0114129_10263862
640 Ga0114129_10384352
641 Ga0105243_10018921
642 Ga0105243_10336270
643 Ga0105243_10442277
644 Ga0105241_10017267
645 Ga0105241_10026584
646 Ga0105242_10078292
647 Ga0105248_10063087
648 Ga0105249_10004937
649 Ga0105249_10074661
650 Ga0105249_10150685
651 Ga0105239_10026489
652 Ga0157313_1002182
653 Ga0157371_10310250
654 Ga0157378_10046896
655 Ga0157378_10589992
656 Ga0163162_10125496
657 Ga0163162_10170949
658 Ga0163162_10385573
659 Ga0157375_10576883
660 Ga0157380_10554830
661 Ga0157380_10861712
662 Ga0157379_10309629
663 Ga0157376_10132577
664 Ga0163161_10138356
665 Ga0207697_10010005
666 Ga0207697_10021653
667 Ga0207682_10081851
668 Ga0207692_10123887
669 Ga0207688_10014066
670 Ga0207645_10002135
671 Ga0207684_10000546
672 Ga0207684_10003757
673 Ga0207684_10008118
674 Ga0207684_10085343
675 Ga0207684_10608402
676 Ga0207654_10013702
677 Ga0207707_10231171
678 Ga0207693_10210400
679 Ga0207663_10050711
680 Ga0207657_10008121
681 Ga0207652_10384739
682 Ga0207646_10001810
683 Ga0207646_10007073
684 Ga0207646_10010158
685 Ga0207646_10048794
686 Ga0207646_10245163
687 Ga0207646_10836786
688 Ga0207681_10030697
689 Ga0207706_10005843
690 Ga0207706_10129009
691 Ga0207686_10108729
692 Ga0207709_10044412
693 Ga0207669_10193410
694 Ga0207704_10046640
695 Ga0207691_10020252
696 Ga0207689_10487196
697 Ga0207679_10027038
698 Ga0207679_10119614
699 Ga0207651_10146252
700 Ga0207712_10011533
701 Ga0207712_10409373
702 Ga0207658_10155701
703 Ga0207678_10007705
704 Ga0207708_10297269
705 Ga0207702_10312865
706 Ga0207641_10063732
707 Ga0207676_10083902
708 Ga0207676_10327250
709 Ga0207675_100026649
710 Ga0207675_100521275
711 Ga0207698_10564252
712 Ga0209973_1013162
713 Ga0209967_1006322
714 Ga0209981_1021081
715 Ga0209982_1007253
716 Ga0209982_1025795
717 Ga0209983_1042080
718 Ga0209966_1036291
719 Ga0209998_10035956
720 Ga0207428_10431740
721 Ga0268265_10013080
722 Ga0268265_10785050
723 Ga0268264_11024447
724 Ga0307408_100018618
725 Ga0307408_100170516
726 Ga0307405_10021556
727 Ga0307413_10162363
728 Ga0307410_10119901
729 Ga0307412_10005134
730 Ga0307412_10074638
731 Ga0307412_10175352
732 Ga0307412_10448650
733 Ga0307409_100056343
734 Ga0307416_100003263
735 Ga0307416_100054521
736 Ga0307411_10206460
737 Ga0307411_10554212
738 Ga0307415_100137932
739 Ga0307415_100206699
740 Ga0373926_0015035
741 Ga0373936_0089630
742 Ga0373931_0017748
743 Ga0373935_0056709
744 Ga0373927_0123917
745 Ga0373947_0025354
746 Ga0373925_0045680
747 Ga0395899_0028945
748 Ga0395900_0062689
749 Ga0395905_0065729
750 Ga0395901_0226726
751 Ga0451839_0010972
752 Ga0439435_0002036
753 Ga0439435_0006320
754 Ga0439444_0002774
755 Ga0439460_0032480
756 Ga0450893_0039389
757 Ga0453683_0037657
758 Ga0451576_0070858
759 Ga0495670_0252908
760 Ga0496103_0070813
761 Ga0496108_0706750
762 Ga0496111_0489534
763 Ga0496112_0006528
764 Ga0496112_0251487
765 Ga0496113_0544313
766 Ga0501031_0016482
767 Ga0501031_0028291
768 Ga0501033_0038046
769 Ga0501033_0064442
770 Ga0501033_0385283
771 Ga0501034_0105028
772 Ga0501036_0134794
773 Ga0501036_0156401
774 Ga0501036_0184877
775 Ga0501036_0401689
776 Ga0501036_0406788
777 Ga0501036_0536695
778 Ga0501037_0183832
779 Ga0501037_0464084
780 Ga0501038_0001539
781 Ga0501038_0025651
782 Ga0501038_0045247
783 Ga0501038_0047922
784 Ga0501039_0001351
785 Ga0501039_0087340
786 Ga0501039_0112284
787 Ga0501039_0310622
788 Ga0501040_0002474
789 Ga0501040_0016770
790 Ga0501040_0027441
791 Ga0501040_0029233
792 Ga0501040_0047473
793 Ga0501040_0386063
794 Ga0501041_0004419
795 Ga0501041_0004507
796 Ga0501041_0016103
797 Ga0501041_0031825
798 Ga0501041_0035075
799 Ga0501041_0186103
800 Ga0501042_0003428
801 Ga0501042_0060559
802 Ga0501042_0142491
803 Ga0501042_0158044
804 Ga0501042_0227399
805 Ga0501043_0099472
806 Ga0501043_0120693
807 Ga0501043_0238125
808 Ga0501046_0056320
809 Ga0501046_0082073
810 Ga0501046_0116539
811 Ga0501046_0190438
812 Ga0501046_0237976
813 Ga0501046_0316651
814 Ga0501048_0028919
815 Ga0501048_0047096
816 Ga0501048_0067057
817 Ga0501048_0465030
818 Ga0501067_0015384
819 Ga0501068_0005072
820 Ga0501068_0008284
821 Ga0501068_0013731
822 Ga0501068_0121117
823 Ga0501069_0010659
824 Ga0501069_0018708
825 Ga0501070_0795206
826 Ga0501071_0017350
827 Ga0501071_0024075
828 Ga0501071_0032278
829 Ga0501071_0038579
830 Ga0501072_0000634
831 Ga0501072_0003793
832 Ga0501072_0019188
833 Ga0501072_0020544
834 Ga0501072_0084053
835 Ga0501072_0177894
836 Ga0501072_0240398
837 Ga0501072_0242021
838 Ga0501072_0569208
839 Ga0501073_0005650
840 Ga0501074_0045257
841 Ga0501074_0058291
842 Ga0501074_0241390
843 Ga0501074_0273829
844 Ga0501075_0000273
845 Ga0501075_0009685
846 Ga0501075_0011783
847 Ga0501075_0041079
848 Ga0501075_0064793
849 Ga0501075_0067008
850 Ga0501075_0070679
851 Ga0501075_0085396
852 Ga0501075_0134004
853 Ga0501075_0156841
854 Ga0501075_0338817
855 Ga0501075_0795365
856 Ga0501076_0000533
857 Ga0501076_0001082
858 Ga0501076_0009767
859 Ga0501076_0011985
860 Ga0501076_0021691
861 Ga0501076_0029349
862 Ga0501076_0074869
863 Ga0501076_0242318
864 Ga0501076_0265132
865 Ga0501076_0589495
866 Ga0501077_0001092
867 Ga0501077_0009728
868 Ga0501077_0030361
869 Ga0501077_0031137
870 Ga0501077_0077122
871 Ga0501077_0116546
872 Ga0501079_0000496
873 Ga0501079_0003087
874 Ga0501079_0020111
875 Ga0501079_0028874
876 Ga0501079_0050518
877 Ga0501079_0098917
878 Ga0501079_0227783
879 Ga0501080_0013689
880 Ga0501080_0040587
881 Ga0501080_0057606
882 Ga0501080_0078154
883 Ga0501080_0114559
884 Ga0501080_0163025
885 Ga0501080_0331968
886 Ga0501081_0003599
887 Ga0501081_0003921
888 Ga0501081_0006925
889 Ga0501081_0007356
890 Ga0501081_0020846
891 Ga0501081_0027548
892 Ga0501081_0134794
893 Ga0501081_0142912
894 Ga0501081_0428556
895 Ga0501083_0012421
896 Ga0501083_0179551
897 Ga0501083_0404480
898 Ga0501044_0275542
899 Ga0501045_0001118
900 Ga0501045_0019676
901 Ga0501045_0045182
902 Ga0501045_0105390
903 Ga0501045_0116385
904 Ga0501045_0212435
905 Ga0501045_0220232
906 nmdc:mga05p37_12250_c1
907 nmdc:mga05p37_138480_c1
908 nmdc:mga05p37_163159_c1
909 nmdc:mga05p37_305430_c1
910 nmdc:mga05p37_31015_c1
911 nmdc:mga05p37_35769_c1
912 nmdc:mga05p37_37713_c1
913 nmdc:mga05p37_519297_c1
914 nmdc:mga05p37_5507_c1
915 nmdc:mga05p37_62909_c1
916 nmdc:mga05p37_65017_c1
917 nmdc:mga05p37_661572_c1
918 nmdc:mga05p37_730_c1
919 nmdc:mga09592_11001_c1
920 nmdc:mga09592_118560_c1
921 nmdc:mga09592_332572_c1
922 nmdc:mga09592_38111_c1
923 nmdc:mga09592_662080_c1
924 nmdc:mga0qj67_118390_c1
925 nmdc:mga0qj67_215740_c1
926 nmdc:mga0qj67_28468_c1
927 nmdc:mga0qj67_46526_c1
928 nmdc:mga06r32_10130_c1
929 nmdc:mga06r32_14246_c1
930 nmdc:mga06r32_28140_c1
931 nmdc:mga06r32_28187_c1
932 nmdc:mga06r32_9803_c1
933 nmdc:mga08y16_296946_c1
934 nmdc:mga08y16_390476_c1
935 nmdc:mga08y16_55594_c1
936 nmdc:mga08y16_96133_c1
937 nmdc:mga0n895_133839_c1
938 nmdc:mga0n895_220_c1
939 nmdc:mga0n895_30449_c1
940 nmdc:mga0n895_3102_c1
941 nmdc:mga0n895_532008_c1
942 nmdc:mga0rr50_111886_c1
943 nmdc:mga0rr50_13568_c1
944 nmdc:mga0rr50_1764_c1
945 nmdc:mga0rr50_3313_c1
946 nmdc:mga0rr50_445608_c1
947 nmdc:mga0rr50_7100_c1
948 nmdc:mga0rr50_73635_c1
949 nmdc:mga08x19_207_c1
950 nmdc:mga0a205_1976_c1
951 nmdc:mga0a205_24678_c1
952 nmdc:mga0a205_37490_c1
953 nmdc:mga0a205_46506_c1
954 nmdc:mga0a205_57473_c1
955 nmdc:mga0a205_808835_c1
956 nmdc:mga0a205_85882_c1
957 Ga0501084_0009153
958 Ga0501084_0009156
959 Ga0501084_0012982
960 Ga0501084_0069630
961 Ga0501084_0073641
962 Ga0501084_0179173
963 Ga0501084_0188284
964 Ga0590075_006457
965 Ga0501082_0013165
966 Ga0501082_0025097
967 Ga0501082_0033182
968 Ga0501082_0049673
969 Ga0501082_0068547
970 Ga0501082_0135916
971 Ga0501082_0202517
972 Ga0501082_0396360
973 Ga0530510_0001094
974 Ga0530510_0001815
975 Ga0530510_0003097
976 Ga0530510_0006938
977 Ga0530510_0023603
978 Ga0530510_0124818
979 Ga0530510_0163888
980 Ga0530510_0210110

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13620

CarboxypepD_reg

Carboxypeptidase regulatory-like domain

201

266

0.89

PF14686

fn3_3

Polysaccharide lyase family 4, domain II

200

261

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
1iuz-assembly1.cif.gz_A plastocyanin 0.8644 104 185
2jxm-assembly1.cif.gz_A ensemble of twenty structures of the prochlorothrix hollandica plastocyanin- cytochrome f complex 0.8576 102 185
1pcs-assembly1.cif.gz_A-2 the 2.15 a crystal structure of a triple mutant plastocyanin from the cyanobacterium synechocystis sp. pcc 6803 0.8564 102 185
7zqe-assembly1.cif.gz_M plastocyanin bound to psi of chlamydomonas reinhardtii 0.8444 102 185
5ztd-assembly2.cif.gz_B x-ray crystal structure of pseudoazurin met16val variant 0.8439 102 188
ID Description Score Start End Superfamily
af_Q9JHW1_1212_1304_2.60.40.1120 Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain 0.8901 190 242 2.60.40.1120
1jxdA00 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.8781 102 185 2.60.40.420
af_E7FFQ7_717_794_2.60.40.1120 Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain 0.8719 190 242 2.60.40.1120
af_B7Z0Z5_381_464_2.60.40.1120 Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain 0.8564 187 242 2.60.40.1120
af_P15087_375_469_2.60.40.1120 Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain 0.8515 185 241 2.60.40.1120
ID Description Score Start End GO Terms
AF-A0A0S8G073-F1-model_v4 TonB-dependent receptor plug domain-containing protein 0.9673 189 242 GO:0009279
GO:0015344
AF-A0A7X3QF68-F1-model_v4 TonB-dependent receptor plug domain-containing protein 0.9669 189 242 GO:0009279
GO:0015344
GO:0030246
AF-A0A2V6WCB9-F1-model_v4 Rhamnogalacturonan lyase domain-containing protein 0.962 103 242
AF-A0A843T4S0-F1-model_v4 SusC/RagA family TonB-linked outer membrane protein 0.9616 189 242 GO:0009279
GO:0015344
AF-A0A2V7J193-F1-model_v4 TonB-dependent receptor-like beta-barrel domain-containing protein 0.9579 190 242 GO:0009279
GO:0015344
GO:0030246

Map