F453814

General Info

Members Datasets Scaffolds Average Seq Length
489 286 976 496

Family's Representative Sequence

Representative Sequence 3300037068|Ga0373925_0000187|Ga0373925_0000187_9117_10802
Length 552
Sequence MVDVAFPYAYRGVRPLYAKGTDPMSSATQGRPAPDVDRRWLVLVVVATAQLMVVLDSTVVNIALPSAQRALGFPNGDRQWVVTAYALAFGSLLLVGGRLGDMYSRKWVFITGLAGFAVSSAIGGAAVSFEMLVAARALQGAFGAILAPSALGTLVSTFQDPRERGRAFGVFGSVAAGGGGVGLILGGLLTQYLSWRWTLYVNLVFAAIAIAGALAYMSSARPASRPRMDWTGAVLACAGLFLIVFGFSHAETAGWTLGVXLLAAFVVAERRSSHPLLPLHVILDRTRGGSYVAVGLSGIAIFAVFLFLTFYLQLVKGYSPLTSGLVFLPMIACILLSSNLSSIVALPRVGPRVLIATGMLFGCGAMAYLTQLTVTSSYADGVLPALLIMGLGFGMIFSPAINTATAGVERQDSGVASALVNTMQQVGGSIGTAALSTIALTATTSYLAAHHTGPLAPAIAATHGYTTAFAVSAGIFGLGVILAITLLPSRRRLVALRAAAEARPPSLAPARAADAGLAPQLEAHAAQAIPVALPCCSPVINHASLPADRPAG

Samples

Sample ID Description Type Environment
1 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
54 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
55 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
56 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
57 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
58 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
59 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
65 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
66 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
67 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
76 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
77 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
78 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
85 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
86 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
122 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
123 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
124 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
125 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
126 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
127 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
128 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
129 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
130 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
131 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
132 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
133 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
134 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
135 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
136 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
137 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
138 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
139 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
140 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
141 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
142 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
143 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
144 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
145 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
146 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
147 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
148 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
149 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
150 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
151 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
152 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
153 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
154 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
155 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
156 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
157 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
158 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
159 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
160 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
161 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
162 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
163 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
164 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
165 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
166 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
167 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
168 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
169 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
170 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
171 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
172 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
173 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
174 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
175 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
176 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
177 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
178 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
179 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
180 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
181 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
182 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
183 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
184 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
185 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
186 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
187 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
188 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
189 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
190 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
191 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
192 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
193 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
194 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
195 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
196 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
197 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
198 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
199 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
200 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
201 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
202 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
203 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
204 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
205 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
206 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
207 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
208 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
209 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
210 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
211 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
212 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
213 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
214 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
215 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
216 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
217 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
218 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
219 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
220 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
221 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
222 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
223 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
224 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
225 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
226 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
227 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
228 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
229 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
230 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
231 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
232 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
233 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
234 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
235 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
236 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
237 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
238 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
239 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
245 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
249 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
250 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
251 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
253 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
254 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
255 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
256 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
257 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
258 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
259 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
260 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
261 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
262 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
263 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
264 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
265 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
266 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
267 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
268 2751185788 Curtobacterium pusillum AA3 Isolate Unclassified
269 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
270 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
271 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
272 2904430863 Curtobacterium oceanosedimentum 1519 Isolate Rhizosphere
273 2904501621 Curtobacterium sp. 1909 Isolate Unclassified
274 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
275 2908674828 Curtobacterium sp. 1517 Isolate Rhizosphere
276 2909074476 Curtobacterium sp. 1310 Isolate Rhizosphere
277 2919039151 Curtobacterium sp. 260 Isolate Rhizosphere
278 2919042368 Curtobacterium sp. 320 Isolate Rhizosphere
279 2922554459 Rhodococcus sp. 66b Isolate Unclassified
280 2928104781 Curtobacterium sp. 1544 Isolate Rhizosphere
281 2928500415 Curtobacterium oceanosedimentum 1257 Isolate Rhizosphere
282 2956939328 Lolliginicoccus suaedae LNNU 331112 Isolate Rhizosphere
283 2984551494 Curtobacterium sp. SORGH_AS776 Isolate Aerial Root
284 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
285 3001119090 Lolliginicoccus lacisalsi G463 Isolate Rhizosphere
286 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 94.68
Metatranscriptomes 1.02
Isolates 4.29

Biome Distribution

Category Percentage (%)
Aerial Root 0.2
Bulb 0
Endosphere 1.43
Nodule 0
Rhizoplane 5.11
Rhizosphere 85.69
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373925_0000187 3300037068 Bacteria 68043
2 Ga0070658_10000378 3300005327 Bacteria 38794
3 Ga0070658_10001947 3300005327 Bacteria 17353
4 Ga0070658_10062357 3300005327 Bacteria 3038
5 Ga0070658_10092286 3300005327 Bacteria 2496
6 Ga0070683_100050273 3300005329 Bacteria 3858
7 Ga0070683_100083693 3300005329 Bacteria 2988
8 Ga0068869_100119708 3300005334 Bacteria 2012
9 Ga0070666_10035799 3300005335 Bacteria 3292
10 Ga0070680_100058716 3300005336 Bacteria 3147
11 Ga0070682_100035053 3300005337 Bacteria 3061
12 Ga0068868_100028737 3300005338 Bacteria 4254
13 Ga0068868_100180805 3300005338 Bacteria 1749
14 Ga0070660_100064933 3300005339 Bacteria 2840
15 Ga0070689_100075385 3300005340 Bacteria 2641
16 Ga0070691_10022440 3300005341 Bacteria 2928
17 Ga0070687_100029062 3300005343 Bacteria 2688
18 Ga0070661_100030074 3300005344 Bacteria 3922
19 Ga0070661_100103944 3300005344 Bacteria 2116
20 Ga0070669_100076033 3300005353 Bacteria 2491
21 Ga0070675_100107638 3300005354 Bacteria 2354
22 Ga0070671_100062480 3300005355 Bacteria 3101
23 Ga0070674_100058289 3300005356 Bacteria 2684
24 Ga0070673_100024457 3300005364 Bacteria 4429
25 Ga0070659_100023826 3300005366 Bacteria 4687
26 Ga0070709_10018237 3300005434 Bacteria 4038
27 Ga0070709_10028188 3300005434 Bacteria 3347
28 Ga0070709_10033954 3300005434 Bacteria 3090
29 Ga0070709_10067631 3300005434 Bacteria 2295
30 Ga0070714_100000570 3300005435 Bacteria 26508
31 Ga0070714_100004084 3300005435 Bacteria 10974
32 Ga0070714_100005780 3300005435 Bacteria 9485
33 Ga0070714_100025944 3300005435 Bacteria 4840
34 Ga0070714_100057040 3300005435 Bacteria 3342
35 Ga0070714_100062305 3300005435 Bacteria 3205
36 Ga0070714_100155656 3300005435 Bacteria 2063
37 Ga0070713_100002609 3300005436 Bacteria 11775
38 Ga0070713_100006262 3300005436 Bacteria 8238
39 Ga0070713_100026486 3300005436 Bacteria 4553
40 Ga0070713_100037922 3300005436 Bacteria 3900
41 Ga0070713_100084113 3300005436 Bacteria 2722
42 Ga0070710_10003973 3300005437 Bacteria 7008
43 Ga0070710_10026476 3300005437 Bacteria 3081
44 Ga0070701_10072504 3300005438 Bacteria 1844
45 Ga0070711_100005289 3300005439 Bacteria 7706
46 Ga0070711_100010368 3300005439 Bacteria 5765
47 Ga0070711_100019072 3300005439 Bacteria 4392
48 Ga0070711_100067949 3300005439 Bacteria 2502
49 Ga0070700_100035993 3300005441 Bacteria 3000
50 Ga0070708_100139823 3300005445 Bacteria 2245
51 Ga0070662_100186332 3300005457 Bacteria 1638
52 Ga0070681_10006005 3300005458 Bacteria 11771
53 Ga0070681_10132048 3300005458 Bacteria 2429
54 Ga0068867_100162162 3300005459 Bacteria 1764
55 Ga0070706_100007826 3300005467 Bacteria 9991
56 Ga0070706_100025104 3300005467 Bacteria 5486
57 Ga0070706_100122049 3300005467 Bacteria 2429
58 Ga0070707_100053728 3300005468 Bacteria 3863
59 Ga0070698_100004685 3300005471 Bacteria 15026
60 Ga0070698_100016800 3300005471 Bacteria 7720
61 Ga0070698_100024510 3300005471 Bacteria 6296
62 Ga0070698_100166436 3300005471 Bacteria 2147
63 Ga0070699_100002019 3300005518 Bacteria 18346
64 Ga0070679_100073729 3300005530 Bacteria 3404
65 Ga0070684_100040669 3300005535 Bacteria 4004
66 Ga0070697_100006252 3300005536 Bacteria 9219
67 Ga0068853_100204563 3300005539 Bacteria 1797
68 Ga0070672_100124890 3300005543 Bacteria 2110
69 Ga0070695_100025229 3300005545 Bacteria 3669
70 Ga0070696_100013693 3300005546 Bacteria 5446
71 Ga0070665_100109419 3300005548 Bacteria 2766
72 Ga0070665_100186180 3300005548 Bacteria 2077
73 Ga0070664_100197090 3300005564 Bacteria 1795
74 Ga0068857_100038064 3300005577 Bacteria 4260
75 Ga0070702_100043192 3300005615 Bacteria 2539
76 Ga0070702_100088578 3300005615 Bacteria 1872
77 Ga0068852_100063759 3300005616 Bacteria 3210
78 Ga0068852_100097969 3300005616 Bacteria 2639
79 Ga0068852_100167657 3300005616 Bacteria 2056
80 Ga0068864_100074070 3300005618 Bacteria 2970
81 Ga0068866_10004229 3300005718 Bacteria 5896
82 Ga0068861_100064602 3300005719 Bacteria 2816
83 Ga0068863_100111637 3300005841 Bacteria 2603
84 Ga0068860_100168132 3300005843 Bacteria 2117
85 Ga0081455_10052513 3300005937 Bacteria 3488
86 Ga0081540_1000207 3300005983 Bacteria 61586
87 Ga0081539_10003686 3300005985 Bacteria 18345
88 Ga0070717_10005679 3300006028 Bacteria 9119
89 Ga0070717_10024314 3300006028 Bacteria 4808
90 Ga0070717_10044736 3300006028 Bacteria 3617
91 Ga0070717_10081183 3300006028 Bacteria 2722
92 Ga0070717_10142030 3300006028 Bacteria 2071
93 Ga0075363_100017283 3300006048 Bacteria 3574
94 Ga0070715_10011654 3300006163 Bacteria 3172
95 Ga0070715_10020016 3300006163 Bacteria 2574
96 Ga0070716_100002488 3300006173 Bacteria 8511
97 Ga0070716_100016997 3300006173 Bacteria 3764
98 Ga0070716_100025241 3300006173 Bacteria 3169
99 Ga0070712_100023009 3300006175 Bacteria 4110
100 Ga0068871_100033227 3300006358 Bacteria 4083
101 Ga0075428_100189495 3300006844 Bacteria 2225
102 Ga0075434_100064005 3300006871 Bacteria 3661
103 Ga0068865_100009740 3300006881 Bacteria 5960
104 Ga0075436_100045164 3300006914 Bacteria 3038
105 Ga0075435_100019165 3300007076 Bacteria 5217
106 Ga0099794_10066174 3300007265 Bacteria 1763
107 Ga0105251_10018226 3300009011 Bacteria 3737
108 Ga0105240_10073372 3300009093 Bacteria 4226
109 Ga0114129_10223746 3300009147 Bacteria 2537
110 Ga0114129_10469663 3300009147 Bacteria 1648
111 Ga0105243_10021515 3300009148 Bacteria 4897
112 Ga0105237_10069802 3300009545 Bacteria 3509
113 Ga0105238_10141123 3300009551 Bacteria 2386
114 Ga0105249_10007357 3300009553 Bacteria 9599
115 Ga0105239_10100800 3300010375 Bacteria 3194
116 Ga0105239_10261451 3300010375 Bacteria 1945
117 Ga0157373_10051849 3300013100 Bacteria 2921
118 Ga0157371_10015377 3300013102 Bacteria 5743
119 Ga0157371_10038341 3300013102 Bacteria 3429
120 Ga0157370_10007571 3300013104 Bacteria 11796
121 Ga0157369_10000069 3300013105 Bacteria 143271
122 Ga0157369_10003393 3300013105 Bacteria 18900
123 Ga0157369_10007659 3300013105 Bacteria 12422
124 Ga0157378_10059769 3300013297 Bacteria 3401
125 Ga0157378_10231591 3300013297 Bacteria 1761
126 Ga0157375_10076785 3300013308 Bacteria 3368
127 Ga0182008_10000359 3300014497 Bacteria 35469
128 Ga0157376_10094959 3300014969 Bacteria 2592
129 Ga0206353_10085966 3300020082 Bacteria 2952
130 Ga0206353_11386727 3300020082 Bacteria 4481
131 Ga0213876_10009499 3300021384 Bacteria 5232
132 Ga0213875_10000798 3300021388 Bacteria 23550
133 Ga0224712_10007316 3300022467 Bacteria 3208
134 Ga0207653_10013660 3300025885 Bacteria 2543
135 Ga0207692_10000906 3300025898 Bacteria 10731
136 Ga0207692_10005030 3300025898 Bacteria 5265
137 Ga0207692_10006061 3300025898 Bacteria 4889
138 Ga0207692_10037918 3300025898 Bacteria 2360
139 Ga0207692_10053696 3300025898 Bacteria 2054
140 Ga0207642_10015848 3300025899 Bacteria 2822
141 Ga0207647_10017931 3300025904 Bacteria 4801
142 Ga0207647_10025589 3300025904 Bacteria 3874
143 Ga0207647_10053103 3300025904 Bacteria 2499
144 Ga0207699_10003014 3300025906 Bacteria 8004
145 Ga0207699_10009906 3300025906 Bacteria 4764
146 Ga0207699_10030926 3300025906 Bacteria 3001
147 Ga0207699_10032256 3300025906 Bacteria 2950
148 Ga0207705_10000678 3300025909 Bacteria 28176
149 Ga0207705_10055058 3300025909 Bacteria 2868
150 Ga0207705_10087978 3300025909 Bacteria 2272
151 Ga0207684_10006632 3300025910 Bacteria 10523
152 Ga0207684_10028612 3300025910 Bacteria 4749
153 Ga0207684_10059672 3300025910 Bacteria 3239
154 Ga0207707_10006595 3300025912 Bacteria 10124
155 Ga0207671_10039590 3300025914 Bacteria 3490
156 Ga0207693_10004576 3300025915 Bacteria 11674
157 Ga0207693_10004898 3300025915 Bacteria 11253
158 Ga0207693_10013772 3300025915 Bacteria 6511
159 Ga0207693_10016585 3300025915 Bacteria 5885
160 Ga0207693_10065451 3300025915 Bacteria 2847
161 Ga0207663_10019719 3300025916 Bacteria 3805
162 Ga0207663_10023406 3300025916 Bacteria 3544
163 Ga0207663_10054785 3300025916 Bacteria 2499
164 Ga0207660_10035472 3300025917 Bacteria 3464
165 Ga0207660_10047022 3300025917 Bacteria 3049
166 Ga0207660_10111348 3300025917 Bacteria 2060
167 Ga0207662_10003512 3300025918 Bacteria 8077
168 Ga0207657_10062040 3300025919 Bacteria 3202
169 Ga0207657_10091252 3300025919 Bacteria 2541
170 Ga0207652_10046425 3300025921 Bacteria 3706
171 Ga0207646_10048567 3300025922 Bacteria 3804
172 Ga0207646_10073990 3300025922 Bacteria 3043
173 Ga0207646_10097945 3300025922 Bacteria 2628
174 Ga0207646_10098118 3300025922 Bacteria 2625
175 Ga0207700_10001528 3300025928 Bacteria 13106
176 Ga0207700_10001538 3300025928 Bacteria 13074
177 Ga0207700_10006435 3300025928 Bacteria 7091
178 Ga0207700_10008453 3300025928 Bacteria 6380
179 Ga0207700_10039271 3300025928 Bacteria 3444
180 Ga0207700_10100729 3300025928 Bacteria 2303
181 Ga0207700_10201899 3300025928 Bacteria 1676
182 Ga0207664_10000393 3300025929 Bacteria 31358
183 Ga0207664_10005236 3300025929 Bacteria 8850
184 Ga0207664_10005346 3300025929 Bacteria 8771
185 Ga0207664_10064385 3300025929 Bacteria 2932
186 Ga0207664_10167068 3300025929 Bacteria 1880
187 Ga0207706_10038432 3300025933 Bacteria 4246
188 Ga0207709_10019364 3300025935 Bacteria 3826
189 Ga0207670_10026316 3300025936 Bacteria 3664
190 Ga0207670_10029384 3300025936 Bacteria 3501
191 Ga0207665_10000212 3300025939 Bacteria 39344
192 Ga0207665_10006913 3300025939 Bacteria 7510
193 Ga0207665_10013192 3300025939 Bacteria 5435
194 Ga0207665_10037667 3300025939 Bacteria 3219
195 Ga0207689_10036192 3300025942 Bacteria 4098
196 Ga0207679_10154210 3300025945 Bacteria 1873
197 Ga0207668_10168361 3300025972 Bacteria 1716
198 Ga0207703_10108990 3300026035 Bacteria 2359
199 Ga0207678_10022076 3300026067 Bacteria 5577
200 Ga0207708_10047258 3300026075 Bacteria 3277
201 Ga0207708_10071953 3300026075 Bacteria 2649
202 Ga0207702_10035406 3300026078 Bacteria 4174
203 Ga0207648_10056266 3300026089 Bacteria 3433
204 Ga0207648_10199592 3300026089 Bacteria 1774
205 Ga0207674_10065525 3300026116 Bacteria 3661
206 Ga0207675_100040767 3300026118 Bacteria 4337
207 Ga0207683_10007169 3300026121 Bacteria 9557
208 Ga0268266_10085014 3300028379 Bacteria 2764
209 Ga0265337_1001081 3300028556 Bacteria 14056
210 Ga0265319_1003326 3300028563 Bacteria 8445
211 Ga0265334_10002659 3300028573 Bacteria 8277
212 Ga0265318_10015674 3300028577 Bacteria 3146
213 Ga0265323_10003290 3300028653 Bacteria 7190
214 Ga0307515_10044760 3300028794 Bacteria 6825
215 Ga0307515_10096464 3300028794 Bacteria 3626
216 Ga0265338_10004968 3300028800 Bacteria 17609
217 Ga0265338_10006296 3300028800 Bacteria 15173
218 Ga0265338_10011528 3300028800 Bacteria 10196
219 Ga0265338_10014647 3300028800 Bacteria 8699
220 Ga0265760_10008485 3300031090 Bacteria 2938
221 Ga0265332_10002648 3300031238 Bacteria 8991
222 Ga0265340_10000441 3300031247 Bacteria 22380
223 Ga0265316_10011657 3300031344 Bacteria 7916
224 Ga0307513_10000611 3300031456 Bacteria 51109
225 Ga0307513_10044553 3300031456 Bacteria 4859
226 Ga0265313_10021481 3300031595 Bacteria 3529
227 Ga0265314_10015077 3300031711 Bacteria 6148
228 Ga0307405_10005443 3300031731 Bacteria 6141
229 Ga0307415_100082687 3300032126 Bacteria 2298
230 Ga0307415_100096919 3300032126 Bacteria 2151
231 Ga0307507_10147312 3300033179 Bacteria 1784
232 Ga0373926_0001648 3300035083 Bacteria 6901
233 Ga0373934_0014191 3300035086 Bacteria 3017
234 Ga0373934_0020629 3300035086 Bacteria 2533
235 Ga0373944_0002827 3300035089 Bacteria 4440
236 Ga0373949_0013357 3300035090 Bacteria 1820
237 Ga0373923_0000808 3300035111 Bacteria 8194
238 Ga0373923_0012638 3300035111 Bacteria 3127
239 Ga0373936_0001331 3300035113 Bacteria 8962
240 Ga0373953_0001360 3300035117 Bacteria 7038
241 Ga0373954_0026848 3300035118 Bacteria 2641
242 Ga0373954_0043345 3300035118 Bacteria 2098
243 Ga0373957_0005490 3300035120 Bacteria 3932
244 Ga0373957_0043414 3300035120 Bacteria 1699
245 Ga0373943_0001615 3300035170 Bacteria 10227
246 Ga0373943_0046412 3300035170 Bacteria 2120
247 Ga0373946_0001268 3300035171 Bacteria 8736
248 Ga0373955_0006096 3300035172 Bacteria 5476
249 Ga0373955_0039891 3300035172 Bacteria 2508
250 Ga0373955_0116118 3300035172 Bacteria 1551
251 Ga0373924_0001451 3300035410 Bacteria 7702
252 Ga0373924_0024269 3300035410 Bacteria 2387
253 Ga0373931_0047133 3300035691 Bacteria 2280
254 Ga0373935_0006596 3300035692 Bacteria 6935
255 Ga0373927_0006247 3300035695 Bacteria 8131
256 Ga0373927_0116584 3300035695 Bacteria 1742
257 Ga0373933_0008868 3300035724 Bacteria 5483
258 Ga0373947_0004132 3300035725 Bacteria 8533
259 Ga0373947_0062692 3300035725 Bacteria 2263
260 Ga0373947_0076818 3300035725 Bacteria 2059
261 Ga0373937_0102936 3300036401 Bacteria 2651
262 Ga0373937_0134112 3300036401 Bacteria 2314
263 Ga0373925_0005916 3300037068 Bacteria 9072
264 Ga0373925_0014271 3300037068 Bacteria 5747
265 Ga0436364_0097302 3300037853 Bacteria 2734
266 Ga0436364_0148605 3300037853 Bacteria 3775
267 Ga0436364_0902744 3300037853 Bacteria 2840
268 Ga0436364_1272522 3300037853 Bacteria 142026
269 Ga0395901_0279422 3300038443 Bacteria 1735
270 Ga0436365_0555616 3300039437 Bacteria 23516
271 Ga0466969_0057707 3300044656 Bacteria 1892
272 Ga0466965_0001297 3300044683 Bacteria 9960
273 Ga0466966_0006396 3300044684 Bacteria 7789
274 Ga0466961_0028360 3300044693 Bacteria 3599
275 Ga0466963_0002572 3300044694 Bacteria 10180
276 Ga0466964_0032020 3300044706 Bacteria 2088
277 Ga0466971_0000317 3300044719 Bacteria 18609
278 Ga0466971_0005888 3300044719 Bacteria 5336
279 Ga0466970_0001425 3300044765 Bacteria 11565
280 Ga0466970_0004661 3300044765 Bacteria 6767
281 Ga0466957_0077939 3300044842 Bacteria 2059
282 Ga0466959_0000999 3300045049 Bacteria 16863
283 Ga0466959_0084693 3300045049 Bacteria 2282
284 Ga0466958_0000669 3300045836 Bacteria 14858
285 Ga0466967_0004644 3300045976 Bacteria 9315
286 Ga0466967_0006610 3300045976 Bacteria 8238
287 Ga0466967_0031715 3300045976 Bacteria 4453
288 Ga0466967_0120357 3300045976 Bacteria 2424
289 Ga0466967_0200682 3300045976 Bacteria 1889
290 Ga0495592_0005094 3300046454 Bacteria 9679
291 Ga0495592_0024327 3300046454 Bacteria 4605
292 Ga0495592_0148595 3300046454 Bacteria 1622
293 Ga0495641_0012006 3300046461 Bacteria 4881
294 Ga0495651_0041096 3300046462 Bacteria 3592
295 Ga0495651_0060939 3300046462 Bacteria 2888
296 Ga0495653_0020193 3300046463 Bacteria 5400
297 Ga0495653_0051764 3300046463 Bacteria 3150
298 Ga0495653_0053389 3300046463 Bacteria 3092
299 Ga0495653_0185747 3300046463 Bacteria 1422
300 Ga0495580_0008335 3300046472 Bacteria 8243
301 Ga0495582_0002313 3300046473 Bacteria 10681
302 Ga0495639_0002420 3300046475 Bacteria 8153
303 Ga0495662_0003217 3300046476 Bacteria 8249
304 Ga0495662_0027177 3300046476 Bacteria 2764
305 Ga0495664_0007827 3300046477 Bacteria 5947
306 Ga0495664_0026785 3300046477 Bacteria 3358
307 Ga0495594_0016824 3300046499 Bacteria 3857
308 Ga0495608_0001849 3300046511 Bacteria 15093
309 Ga0495608_0004213 3300046511 Bacteria 10309
310 Ga0495608_0005548 3300046511 Bacteria 9014
311 Ga0495608_0009867 3300046511 Bacteria 6664
312 Ga0495628_0008460 3300046516 Bacteria 8823
313 Ga0495630_0012121 3300046517 Bacteria 6250
314 Ga0495630_0015920 3300046517 Bacteria 5496
315 Ga0495632_0044441 3300046519 Bacteria 2217
316 Ga0495666_0025670 3300046526 Bacteria 2909
317 Ga0495652_0000731 3300046529 Bacteria 38018
318 Ga0495652_0002650 3300046529 Bacteria 18240
319 Ga0495652_0006985 3300046529 Bacteria 10436
320 Ga0495652_0180146 3300046529 Bacteria 1622
321 Ga0495665_0002348 3300046531 Bacteria 10222
322 Ga0495586_0003300 3300046535 Bacteria 8653
323 Ga0495587_0007734 3300046536 Bacteria 6948
324 Ga0495587_0016493 3300046536 Bacteria 4594
325 Ga0495645_0006572 3300046543 Bacteria 8080
326 Ga0495645_0010981 3300046543 Bacteria 6361
327 Ga0495645_0011785 3300046543 Bacteria 6159
328 Ga0495645_0052819 3300046543 Bacteria 2955
329 Ga0495645_0090926 3300046543 Bacteria 2180
330 Ga0495667_0000535 3300046559 Bacteria 24277
331 Ga0495667_0009414 3300046559 Bacteria 6617
332 Ga0495667_0022588 3300046559 Bacteria 4238
333 Ga0495634_0050877 3300046642 Bacteria 2780
334 Ga0495634_0053890 3300046642 Bacteria 2692
335 Ga0495635_0002697 3300046663 Bacteria 12144
336 Ga0495635_0015425 3300046663 Bacteria 5343
337 Ga0495635_0016198 3300046663 Bacteria 5203
338 Ga0495635_0021219 3300046663 Bacteria 4527
339 Ga0495657_0003052 3300046675 Bacteria 13857
340 Ga0495657_0039714 3300046675 Bacteria 3232
341 Ga0495657_0097727 3300046675 Bacteria 1874
342 Ga0495599_0045294 3300046678 Bacteria 2758
343 Ga0495623_0009760 3300046679 Bacteria 6227
344 Ga0495623_0012894 3300046679 Bacteria 5414
345 Ga0495623_0026213 3300046679 Bacteria 3753
346 Ga0495646_0001297 3300046680 Bacteria 14748
347 Ga0495646_0023764 3300046680 Bacteria 3858
348 Ga0495646_0066351 3300046680 Bacteria 2134
349 Ga0495647_0007394 3300046681 Bacteria 3678
350 Ga0495658_0028946 3300046683 Bacteria 2994
351 Ga0495669_0011147 3300046684 Bacteria 3810
352 Ga0495613_0007907 3300046689 Bacteria 7909
353 Ga0495613_0013311 3300046689 Bacteria 6112
354 Ga0495613_0081003 3300046689 Bacteria 2359
355 Ga0495624_0005534 3300046690 Bacteria 9094
356 Ga0495624_0023863 3300046690 Bacteria 4029
357 Ga0495624_0082378 3300046690 Bacteria 1991
358 Ga0495600_0002380 3300046809 Bacteria 10760
359 Ga0495600_0016249 3300046809 Bacteria 4720
360 Ga0495600_0019125 3300046809 Bacteria 4370
361 Ga0495600_0024468 3300046809 Bacteria 3887
362 Ga0495600_0053307 3300046809 Bacteria 2641
363 Ga0495581_0004968 3300047315 Bacteria 7696
364 Ga0495581_0048601 3300047315 Bacteria 2449
365 Ga0495604_0009559 3300047317 Bacteria 7668
366 Ga0495604_0053602 3300047317 Bacteria 3115
367 Ga0495604_0081055 3300047317 Bacteria 2430
368 Ga0495674_0004789 3300047319 Bacteria 13018
369 Ga0495674_0009685 3300047319 Bacteria 9146
370 Ga0495674_0185599 3300047319 Bacteria 1730
371 Ga0495676_0054604 3300047321 Bacteria 3174
372 Ga0495680_0001524 3300047322 Bacteria 24781
373 Ga0495680_0047753 3300047322 Bacteria 3365
374 Ga0495680_0145617 3300047322 Bacteria 1730
375 Ga0495675_0004210 3300047444 Bacteria 8706
376 Ga0495684_0109455 3300047471 Bacteria 2086
377 Ga0495686_0096193 3300047472 Bacteria 1793
378 Ga0495593_0001410 3300047673 Bacteria 14074
379 Ga0495593_0002029 3300047673 Bacteria 12081
380 Ga0495602_0005369 3300048088 Bacteria 13451
381 Ga0495602_0148249 3300048088 Bacteria 1847
382 Ga0495614_0002852 3300048089 Bacteria 7690
383 Ga0495614_0025359 3300048089 Bacteria 2557
384 Ga0496100_0031025 3300048903 Bacteria 3319
385 Ga0496101_0026826 3300048904 Bacteria 4006
386 Ga0496101_0084293 3300048904 Bacteria 2353
387 Ga0496102_0055904 3300048905 Bacteria 3599
388 Ga0496102_0177529 3300048905 Bacteria 2006
389 Ga0496104_0057107 3300048907 Bacteria 3693
390 Ga0496105_0000929 3300048908 Bacteria 19948
391 Ga0496105_0175891 3300048908 Bacteria 1753
392 Ga0496107_0057174 3300048910 Bacteria 2820
393 Ga0496108_0000020 3300048911 Bacteria 226992
394 Ga0496108_0004023 3300048911 Bacteria 11798
395 Ga0496108_0020765 3300048911 Bacteria 5398
396 Ga0496108_0107486 3300048911 Bacteria 2382
397 Ga0496109_0037074 3300048912 Bacteria 4404
398 Ga0496109_0085108 3300048912 Bacteria 2918
399 Ga0496109_0115116 3300048912 Bacteria 2502
400 Ga0496110_0036190 3300048913 Bacteria 4286
401 Ga0496110_0045171 3300048913 Bacteria 3849
402 Ga0496110_0084996 3300048913 Bacteria 2825
403 Ga0496112_0029171 3300048915 Bacteria 5334
404 Ga0496112_0120230 3300048915 Bacteria 2597
405 Ga0496113_0009875 3300048916 Bacteria 6287
406 Ga0496114_0036651 3300048917 Bacteria 4055
407 Ga0496114_0091723 3300048917 Bacteria 2580
408 Ga0496115_0011772 3300048918 Bacteria 6570
409 Ga0496117_0002769 3300048920 Bacteria 21471
410 Ga0496118_0000305 3300048921 Bacteria 85218
411 Ga0496119_0000067 3300048922 Bacteria 162404
412 Ga0496119_0060791 3300048922 Bacteria 2260
413 Ga0496120_0007134 3300048923 Bacteria 8379
414 Ga0496121_0002395 3300048924 Bacteria 28736
415 Ga0496121_0008200 3300048924 Bacteria 12393
416 Ga0496122_0025736 3300048925 Bacteria 5098
417 Ga0496123_0023262 3300048926 Bacteria 4747
418 Ga0496124_0000181 3300048927 Bacteria 124426
419 Ga0496124_0017914 3300048927 Bacteria 6655
420 Ga0496124_0089940 3300048927 Bacteria 2505
421 Ga0496125_0015834 3300048928 Bacteria 7265
422 Ga0496126_0000006 3300048929 Bacteria 798804
423 Ga0496126_0000022 3300048929 Bacteria 464393
424 Ga0496126_0066323 3300048929 Bacteria 3228
425 Ga0496126_0104962 3300048929 Bacteria 2468
426 Ga0501031_0016190 3300049568 Bacteria 4844
427 Ga0501032_0027433 3300049569 Bacteria 3913
428 Ga0501032_0106683 3300049569 Bacteria 1855
429 Ga0501034_0092550 3300049571 Bacteria 3020
430 Ga0501034_0170282 3300049571 Bacteria 2145
431 Ga0501036_0014180 3300049572 Bacteria 6630
432 Ga0501037_0002775 3300049573 Bacteria 12677
433 Ga0501042_0003261 3300049578 Bacteria 10146
434 Ga0501043_0015008 3300049579 Bacteria 6066
435 Ga0501043_0036507 3300049579 Bacteria 3866
436 Ga0501043_0051302 3300049579 Bacteria 3241
437 Ga0501043_0168028 3300049579 Bacteria 1712
438 Ga0501046_0005245 3300049580 Bacteria 11584
439 Ga0501047_0028259 3300049581 Bacteria 5406
440 Ga0501047_0081562 3300049581 Bacteria 3109
441 Ga0501047_0139996 3300049581 Bacteria 2298
442 Ga0501048_0006537 3300049582 Bacteria 8860
443 Ga0501070_0051568 3300049586 Bacteria 3415
444 Ga0501074_0012564 3300049590 Bacteria 6156
445 Ga0501035_0039288 3300049822 Bacteria 4283
446 Ga0501035_0063927 3300049822 Bacteria 3272
447 Ga0501044_0005889 3300049823 Bacteria 13582
448 Ga0501044_0013056 3300049823 Bacteria 8988
449 Ga0501044_0211552 3300049823 Bacteria 1893
450 nmdc:mga07m45_22160_c1 3300050496 Bacteria 2869
451 nmdc:mga05p37_175073_c1 3300050507 Bacteria 2614
452 nmdc:mga08y16_247298_c1 3300050511 Bacteria 1843
453 nmdc:mga0n895_80780_c1 3300050512 Bacteria 3240
454 Ga0495601_0013938 3300053077 Bacteria 4841
455 Ga0495601_0054465 3300053077 Bacteria 2531
456 Ga0495612_0000785 3300053078 Bacteria 12917
457 Ga0495612_0017058 3300053078 Bacteria 2908
458 Ga0495595_0005969 3300053084 Bacteria 4943
459 Ga0495619_0001722 3300053085 Bacteria 14519
460 Ga0495619_0013124 3300053085 Bacteria 5221
461 Ga0500556_0000297 3300053104 Bacteria 38005
462 Ga0500559_0020325 3300053136 Bacteria 2807
463 Ga0500616_0001122 3300053153 Bacteria 27590
464 Ga0500616_0002259 3300053153 Bacteria 16379
465 Ga0500616_0017917 3300053153 Bacteria 4010
466 Ga0587128_002641 3300059630 Bacteria 1891
467 Ga0466962_0000229 3300061719 Bacteria 23340
468 2566994410 2565956761 Bacteria 6601618
469 2738890864 2738541308 Bacteria 7020677
470 2753303127 2751185788 Bacteria 4541048
471 2819745475 2818991472 Bacteria 10089953
472 2862183524 2862178590 Bacteria 8583590
473 2867351627 2867346516 Bacteria 7608576
474 2904431850 2904430863 Bacteria 3486923
475 2904504364 2904501621 Bacteria 3401437
476 2904537537 2904535858 Bacteria 6308016
477 2908676586 2908674828 Bacteria 3382763
478 2909077290 2909074476 Bacteria 3436050
479 2919041688 2919039151 Bacteria 3391018
480 2919042447 2919042368 Bacteria 3905917
481 2922558819 2922554459 Bacteria 6683962
482 2928106122 2928104781 Bacteria 3877447
483 2928502931 2928500415 Bacteria 3384541
484 2956941123 2956939328 Bacteria 3474458
485 2984551500 2984551494 Bacteria 3877562
486 2995464650 2995463766 Bacteria 8577691
487 3001120811 3001119090 Bacteria 3449530
488 8047711161 8047710418 Bacteria 11023148
489 Ga0373925_0000187
490 Ga0070658_10000378
491 Ga0070658_10001947
492 Ga0070658_10062357
493 Ga0070658_10092286
494 Ga0070683_100050273
495 Ga0070683_100083693
496 Ga0068869_100119708
497 Ga0070666_10035799
498 Ga0070680_100058716
499 Ga0070682_100035053
500 Ga0068868_100028737
501 Ga0068868_100180805
502 Ga0070660_100064933
503 Ga0070689_100075385
504 Ga0070691_10022440
505 Ga0070687_100029062
506 Ga0070661_100030074
507 Ga0070661_100103944
508 Ga0070669_100076033
509 Ga0070675_100107638
510 Ga0070671_100062480
511 Ga0070674_100058289
512 Ga0070673_100024457
513 Ga0070659_100023826
514 Ga0070709_10018237
515 Ga0070709_10028188
516 Ga0070709_10033954
517 Ga0070709_10067631
518 Ga0070714_100000570
519 Ga0070714_100004084
520 Ga0070714_100005780
521 Ga0070714_100025944
522 Ga0070714_100057040
523 Ga0070714_100062305
524 Ga0070714_100155656
525 Ga0070713_100002609
526 Ga0070713_100006262
527 Ga0070713_100026486
528 Ga0070713_100037922
529 Ga0070713_100084113
530 Ga0070710_10003973
531 Ga0070710_10026476
532 Ga0070701_10072504
533 Ga0070711_100005289
534 Ga0070711_100010368
535 Ga0070711_100019072
536 Ga0070711_100067949
537 Ga0070700_100035993
538 Ga0070708_100139823
539 Ga0070662_100186332
540 Ga0070681_10006005
541 Ga0070681_10132048
542 Ga0068867_100162162
543 Ga0070706_100007826
544 Ga0070706_100025104
545 Ga0070706_100122049
546 Ga0070707_100053728
547 Ga0070698_100004685
548 Ga0070698_100016800
549 Ga0070698_100024510
550 Ga0070698_100166436
551 Ga0070699_100002019
552 Ga0070679_100073729
553 Ga0070684_100040669
554 Ga0070697_100006252
555 Ga0068853_100204563
556 Ga0070672_100124890
557 Ga0070695_100025229
558 Ga0070696_100013693
559 Ga0070665_100109419
560 Ga0070665_100186180
561 Ga0070664_100197090
562 Ga0068857_100038064
563 Ga0070702_100043192
564 Ga0070702_100088578
565 Ga0068852_100063759
566 Ga0068852_100097969
567 Ga0068852_100167657
568 Ga0068864_100074070
569 Ga0068866_10004229
570 Ga0068861_100064602
571 Ga0068863_100111637
572 Ga0068860_100168132
573 Ga0081455_10052513
574 Ga0081540_1000207
575 Ga0081539_10003686
576 Ga0070717_10005679
577 Ga0070717_10024314
578 Ga0070717_10044736
579 Ga0070717_10081183
580 Ga0070717_10142030
581 Ga0075363_100017283
582 Ga0070715_10011654
583 Ga0070715_10020016
584 Ga0070716_100002488
585 Ga0070716_100016997
586 Ga0070716_100025241
587 Ga0070712_100023009
588 Ga0068871_100033227
589 Ga0075428_100189495
590 Ga0075434_100064005
591 Ga0068865_100009740
592 Ga0075436_100045164
593 Ga0075435_100019165
594 Ga0099794_10066174
595 Ga0105251_10018226
596 Ga0105240_10073372
597 Ga0114129_10223746
598 Ga0114129_10469663
599 Ga0105243_10021515
600 Ga0105237_10069802
601 Ga0105238_10141123
602 Ga0105249_10007357
603 Ga0105239_10100800
604 Ga0105239_10261451
605 Ga0157373_10051849
606 Ga0157371_10015377
607 Ga0157371_10038341
608 Ga0157370_10007571
609 Ga0157369_10000069
610 Ga0157369_10003393
611 Ga0157369_10007659
612 Ga0157378_10059769
613 Ga0157378_10231591
614 Ga0157375_10076785
615 Ga0182008_10000359
616 Ga0157376_10094959
617 Ga0206353_10085966
618 Ga0206353_11386727
619 Ga0213876_10009499
620 Ga0213875_10000798
621 Ga0224712_10007316
622 Ga0207653_10013660
623 Ga0207692_10000906
624 Ga0207692_10005030
625 Ga0207692_10006061
626 Ga0207692_10037918
627 Ga0207692_10053696
628 Ga0207642_10015848
629 Ga0207647_10017931
630 Ga0207647_10025589
631 Ga0207647_10053103
632 Ga0207699_10003014
633 Ga0207699_10009906
634 Ga0207699_10030926
635 Ga0207699_10032256
636 Ga0207705_10000678
637 Ga0207705_10055058
638 Ga0207705_10087978
639 Ga0207684_10006632
640 Ga0207684_10028612
641 Ga0207684_10059672
642 Ga0207707_10006595
643 Ga0207671_10039590
644 Ga0207693_10004576
645 Ga0207693_10004898
646 Ga0207693_10013772
647 Ga0207693_10016585
648 Ga0207693_10065451
649 Ga0207663_10019719
650 Ga0207663_10023406
651 Ga0207663_10054785
652 Ga0207660_10035472
653 Ga0207660_10047022
654 Ga0207660_10111348
655 Ga0207662_10003512
656 Ga0207657_10062040
657 Ga0207657_10091252
658 Ga0207652_10046425
659 Ga0207646_10048567
660 Ga0207646_10073990
661 Ga0207646_10097945
662 Ga0207646_10098118
663 Ga0207700_10001528
664 Ga0207700_10001538
665 Ga0207700_10006435
666 Ga0207700_10008453
667 Ga0207700_10039271
668 Ga0207700_10100729
669 Ga0207700_10201899
670 Ga0207664_10000393
671 Ga0207664_10005236
672 Ga0207664_10005346
673 Ga0207664_10064385
674 Ga0207664_10167068
675 Ga0207706_10038432
676 Ga0207709_10019364
677 Ga0207670_10026316
678 Ga0207670_10029384
679 Ga0207665_10000212
680 Ga0207665_10006913
681 Ga0207665_10013192
682 Ga0207665_10037667
683 Ga0207689_10036192
684 Ga0207679_10154210
685 Ga0207668_10168361
686 Ga0207703_10108990
687 Ga0207678_10022076
688 Ga0207708_10047258
689 Ga0207708_10071953
690 Ga0207702_10035406
691 Ga0207648_10056266
692 Ga0207648_10199592
693 Ga0207674_10065525
694 Ga0207675_100040767
695 Ga0207683_10007169
696 Ga0268266_10085014
697 Ga0265337_1001081
698 Ga0265319_1003326
699 Ga0265334_10002659
700 Ga0265318_10015674
701 Ga0265323_10003290
702 Ga0307515_10044760
703 Ga0307515_10096464
704 Ga0265338_10004968
705 Ga0265338_10006296
706 Ga0265338_10011528
707 Ga0265338_10014647
708 Ga0265760_10008485
709 Ga0265332_10002648
710 Ga0265340_10000441
711 Ga0265316_10011657
712 Ga0307513_10000611
713 Ga0307513_10044553
714 Ga0265313_10021481
715 Ga0265314_10015077
716 Ga0307405_10005443
717 Ga0307415_100082687
718 Ga0307415_100096919
719 Ga0307507_10147312
720 Ga0373926_0001648
721 Ga0373934_0014191
722 Ga0373934_0020629
723 Ga0373944_0002827
724 Ga0373949_0013357
725 Ga0373923_0000808
726 Ga0373923_0012638
727 Ga0373936_0001331
728 Ga0373953_0001360
729 Ga0373954_0026848
730 Ga0373954_0043345
731 Ga0373957_0005490
732 Ga0373957_0043414
733 Ga0373943_0001615
734 Ga0373943_0046412
735 Ga0373946_0001268
736 Ga0373955_0006096
737 Ga0373955_0039891
738 Ga0373955_0116118
739 Ga0373924_0001451
740 Ga0373924_0024269
741 Ga0373931_0047133
742 Ga0373935_0006596
743 Ga0373927_0006247
744 Ga0373927_0116584
745 Ga0373933_0008868
746 Ga0373947_0004132
747 Ga0373947_0062692
748 Ga0373947_0076818
749 Ga0373937_0102936
750 Ga0373937_0134112
751 Ga0373925_0005916
752 Ga0373925_0014271
753 Ga0436364_0097302
754 Ga0436364_0148605
755 Ga0436364_0902744
756 Ga0436364_1272522
757 Ga0395901_0279422
758 Ga0436365_0555616
759 Ga0466969_0057707
760 Ga0466965_0001297
761 Ga0466966_0006396
762 Ga0466961_0028360
763 Ga0466963_0002572
764 Ga0466964_0032020
765 Ga0466971_0000317
766 Ga0466971_0005888
767 Ga0466970_0001425
768 Ga0466970_0004661
769 Ga0466957_0077939
770 Ga0466959_0000999
771 Ga0466959_0084693
772 Ga0466958_0000669
773 Ga0466967_0004644
774 Ga0466967_0006610
775 Ga0466967_0031715
776 Ga0466967_0120357
777 Ga0466967_0200682
778 Ga0495592_0005094
779 Ga0495592_0024327
780 Ga0495592_0148595
781 Ga0495641_0012006
782 Ga0495651_0041096
783 Ga0495651_0060939
784 Ga0495653_0020193
785 Ga0495653_0051764
786 Ga0495653_0053389
787 Ga0495653_0185747
788 Ga0495580_0008335
789 Ga0495582_0002313
790 Ga0495639_0002420
791 Ga0495662_0003217
792 Ga0495662_0027177
793 Ga0495664_0007827
794 Ga0495664_0026785
795 Ga0495594_0016824
796 Ga0495608_0001849
797 Ga0495608_0004213
798 Ga0495608_0005548
799 Ga0495608_0009867
800 Ga0495628_0008460
801 Ga0495630_0012121
802 Ga0495630_0015920
803 Ga0495632_0044441
804 Ga0495666_0025670
805 Ga0495652_0000731
806 Ga0495652_0002650
807 Ga0495652_0006985
808 Ga0495652_0180146
809 Ga0495665_0002348
810 Ga0495586_0003300
811 Ga0495587_0007734
812 Ga0495587_0016493
813 Ga0495645_0006572
814 Ga0495645_0010981
815 Ga0495645_0011785
816 Ga0495645_0052819
817 Ga0495645_0090926
818 Ga0495667_0000535
819 Ga0495667_0009414
820 Ga0495667_0022588
821 Ga0495634_0050877
822 Ga0495634_0053890
823 Ga0495635_0002697
824 Ga0495635_0015425
825 Ga0495635_0016198
826 Ga0495635_0021219
827 Ga0495657_0003052
828 Ga0495657_0039714
829 Ga0495657_0097727
830 Ga0495599_0045294
831 Ga0495623_0009760
832 Ga0495623_0012894
833 Ga0495623_0026213
834 Ga0495646_0001297
835 Ga0495646_0023764
836 Ga0495646_0066351
837 Ga0495647_0007394
838 Ga0495658_0028946
839 Ga0495669_0011147
840 Ga0495613_0007907
841 Ga0495613_0013311
842 Ga0495613_0081003
843 Ga0495624_0005534
844 Ga0495624_0023863
845 Ga0495624_0082378
846 Ga0495600_0002380
847 Ga0495600_0016249
848 Ga0495600_0019125
849 Ga0495600_0024468
850 Ga0495600_0053307
851 Ga0495581_0004968
852 Ga0495581_0048601
853 Ga0495604_0009559
854 Ga0495604_0053602
855 Ga0495604_0081055
856 Ga0495674_0004789
857 Ga0495674_0009685
858 Ga0495674_0185599
859 Ga0495676_0054604
860 Ga0495680_0001524
861 Ga0495680_0047753
862 Ga0495680_0145617
863 Ga0495675_0004210
864 Ga0495684_0109455
865 Ga0495686_0096193
866 Ga0495593_0001410
867 Ga0495593_0002029
868 Ga0495602_0005369
869 Ga0495602_0148249
870 Ga0495614_0002852
871 Ga0495614_0025359
872 Ga0496100_0031025
873 Ga0496101_0026826
874 Ga0496101_0084293
875 Ga0496102_0055904
876 Ga0496102_0177529
877 Ga0496104_0057107
878 Ga0496105_0000929
879 Ga0496105_0175891
880 Ga0496107_0057174
881 Ga0496108_0000020
882 Ga0496108_0004023
883 Ga0496108_0020765
884 Ga0496108_0107486
885 Ga0496109_0037074
886 Ga0496109_0085108
887 Ga0496109_0115116
888 Ga0496110_0036190
889 Ga0496110_0045171
890 Ga0496110_0084996
891 Ga0496112_0029171
892 Ga0496112_0120230
893 Ga0496113_0009875
894 Ga0496114_0036651
895 Ga0496114_0091723
896 Ga0496115_0011772
897 Ga0496117_0002769
898 Ga0496118_0000305
899 Ga0496119_0000067
900 Ga0496119_0060791
901 Ga0496120_0007134
902 Ga0496121_0002395
903 Ga0496121_0008200
904 Ga0496122_0025736
905 Ga0496123_0023262
906 Ga0496124_0000181
907 Ga0496124_0017914
908 Ga0496124_0089940
909 Ga0496125_0015834
910 Ga0496126_0000006
911 Ga0496126_0000022
912 Ga0496126_0066323
913 Ga0496126_0104962
914 Ga0501031_0016190
915 Ga0501032_0027433
916 Ga0501032_0106683
917 Ga0501034_0092550
918 Ga0501034_0170282
919 Ga0501036_0014180
920 Ga0501037_0002775
921 Ga0501042_0003261
922 Ga0501043_0015008
923 Ga0501043_0036507
924 Ga0501043_0051302
925 Ga0501043_0168028
926 Ga0501046_0005245
927 Ga0501047_0028259
928 Ga0501047_0081562
929 Ga0501047_0139996
930 Ga0501048_0006537
931 Ga0501070_0051568
932 Ga0501074_0012564
933 Ga0501035_0039288
934 Ga0501035_0063927
935 Ga0501044_0005889
936 Ga0501044_0013056
937 Ga0501044_0211552
938 nmdc:mga07m45_22160_c1
939 nmdc:mga05p37_175073_c1
940 nmdc:mga08y16_247298_c1
941 nmdc:mga0n895_80780_c1
942 Ga0495601_0013938
943 Ga0495601_0054465
944 Ga0495612_0000785
945 Ga0495612_0017058
946 Ga0495595_0005969
947 Ga0495619_0001722
948 Ga0495619_0013124
949 Ga0500556_0000297
950 Ga0500559_0020325
951 Ga0500616_0001122
952 Ga0500616_0002259
953 Ga0500616_0017917
954 Ga0587128_002641
955 Ga0466962_0000229
956 2566994410
957 2738890864
958 2753303127
959 2819745475
960 2862183524
961 2867351627
962 2904431850
963 2904504364
964 2904537537
965 2908676586
966 2909077290
967 2919041688
968 2919042447
969 2922558819
970 2928106122
971 2928502931
972 2956941123
973 2984551500
974 2995464650
975 3001120811
976 8047711161

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07690

MFS_1

Major Facilitator Superfamily

46

432

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
7y58-assembly1.cif.gz_A cryoem structure of qaca (d411n), an antibacterial efflux transporter from staphylococcus aureus 0.8759 8 474
7d5q-assembly1.cif.gz_A structure of norc transporter (k398a mutant) in an outward-open conformation in complex with a single-chain indian camelid antibody 0.8684 23 476
7d5q-assembly2.cif.gz_B structure of norc transporter (k398a mutant) in an outward-open conformation in complex with a single-chain indian camelid antibody 0.8669 24 476
7d5q-assembly1.cif.gz_A structure of norc transporter (k398a mutant) in an outward-open conformation in complex with a single-chain indian camelid antibody 0.8645 23 476
7d5q-assembly2.cif.gz_B structure of norc transporter (k398a mutant) in an outward-open conformation in complex with a single-chain indian camelid antibody 0.863 24 476
ID Description Score Start End Superfamily
af_P9WG87_21_208_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9712 27 211 1.20.1250.20
af_P9WG89_46_282_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9576 27 258 1.20.1250.20
af_Q2FW85_14_250_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9544 25 258 1.20.1250.20
af_P36554_12_217_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9513 27 225 1.20.1250.20
af_Q2G199_12_244_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9492 25 254 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A3C0UV67-F1-model_v4 MFS transporter 0.9481 20 237 GO:0005886
GO:0022857
AF-A0A7S1EV08-F1-model_v4 Major facilitator superfamily (MFS) profile domain-containing protein 0.9358 21 200 GO:0016020
GO:0022857
AF-A0A7Y8L4N8-F1-model_v4 MFS transporter 0.9325 21 160 GO:0012505
GO:0016020
GO:0035435
GO:0061513
AF-E6JCD2-F1-model_v4 deleted 0.9268 25 208
AF-A0A6N3RVD1-F1-model_v4 deleted 0.9258 13 211

Map