F453799
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 489 | 238 | 489 | 128 |
Family's Representative Sequence
| Representative Sequence | 3300027907|Ga0207428_10018969|Ga0207428_100189696 |
| Length | 113 |
| Sequence | MARIAGVDLPQAKMVWVGLTYIYGIGPSRARTILGKAEVGEAVRVKDLTEDVEGDLRKETAQNIKRLMEIGSYRGQRHRRGLPVRGQRTHTNSRTRKGPRGSAVAGKKKATKK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 2 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 8 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 10 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 26 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 39 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 40 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 41 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 42 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 43 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 44 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 45 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 46 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 47 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 49 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 52 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 54 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 55 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 56 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 57 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 58 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 59 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 60 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 61 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 62 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 64 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 65 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 80 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 81 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 82 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 83 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 84 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 85 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 86 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 119 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 122 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 123 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 124 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 125 | 3300030879 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 126 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 127 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 128 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 129 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 130 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 131 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 132 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 133 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 134 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 135 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 136 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 137 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 138 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 139 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 140 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 141 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 142 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 143 | 3300033529 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 144 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 145 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 146 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 147 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 148 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 149 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 150 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 151 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 152 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 153 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 154 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 155 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 156 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 157 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 158 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 159 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 160 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 161 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 162 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 163 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 164 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 165 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 166 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 167 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 168 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 169 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 170 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 171 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 172 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 184 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 185 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 186 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 187 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 188 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 189 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 190 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 191 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 192 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 193 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 194 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 195 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 196 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 197 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 198 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 199 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 200 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 201 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 202 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 203 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 204 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 205 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 206 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 207 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 208 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 209 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 210 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 211 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 212 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 213 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 214 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 215 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 216 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 217 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 218 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 219 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 220 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 221 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 222 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 223 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 224 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 225 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 226 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 227 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 228 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 229 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 230 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 231 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 232 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 233 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 235 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 236 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 237 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 238 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.93 |
| Metatranscriptomes | 3.07 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.64 |
| Nodule | 0 |
| Rhizoplane | 2.86 |
| Rhizosphere | 94.48 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.02 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0058859_11694013 | 3300004798 | Bacteria | 1065 |
| 2 | Ga0065707_10357816 | 3300005295 | Bacteria | 908 |
| 3 | Ga0070676_11313617 | 3300005328 | Bacteria | 553 |
| 4 | Ga0070670_100473795 | 3300005331 | Bacteria | 1111 |
| 5 | Ga0070666_10335049 | 3300005335 | Bacteria | 1081 |
| 6 | Ga0070689_100045106 | 3300005340 | Bacteria | 3393 |
| 7 | Ga0070689_100334614 | 3300005340 | Bacteria | 1267 |
| 8 | Ga0070689_100616796 | 3300005340 | Bacteria | 941 |
| 9 | Ga0070691_10054652 | 3300005341 | Bacteria | 1912 |
| 10 | Ga0070691_10082304 | 3300005341 | Bacteria | 1578 |
| 11 | Ga0070687_100493480 | 3300005343 | Bacteria | 823 |
| 12 | Ga0070692_10812568 | 3300005345 | Bacteria | 639 |
| 13 | Ga0070668_100330308 | 3300005347 | Bacteria | 1286 |
| 14 | Ga0070668_100691367 | 3300005347 | Bacteria | 899 |
| 15 | Ga0070669_100000040 | 3300005353 | Bacteria | 130277 |
| 16 | Ga0070669_100053560 | 3300005353 | Bacteria | 2953 |
| 17 | Ga0070675_100944972 | 3300005354 | Bacteria | 791 |
| 18 | Ga0070674_100909368 | 3300005356 | Bacteria | 767 |
| 19 | Ga0070673_102415976 | 3300005364 | Bacteria | 500 |
| 20 | Ga0070688_101379182 | 3300005365 | Bacteria | 571 |
| 21 | Ga0070703_10033221 | 3300005406 | Bacteria | 1570 |
| 22 | Ga0070703_10115343 | 3300005406 | Bacteria | 967 |
| 23 | Ga0070709_10000076 | 3300005434 | Bacteria | 74077 |
| 24 | Ga0070713_100405506 | 3300005436 | Bacteria | 1274 |
| 25 | Ga0070701_10436839 | 3300005438 | Bacteria | 837 |
| 26 | Ga0070701_10505983 | 3300005438 | Bacteria | 785 |
| 27 | Ga0070705_100041163 | 3300005440 | Bacteria | 2632 |
| 28 | Ga0070705_101526616 | 3300005440 | Bacteria | 560 |
| 29 | Ga0070694_100088712 | 3300005444 | Bacteria | 2166 |
| 30 | Ga0070694_100140367 | 3300005444 | Bacteria | 1754 |
| 31 | Ga0070708_100044427 | 3300005445 | Bacteria | 3907 |
| 32 | Ga0070708_100154649 | 3300005445 | Bacteria | 2134 |
| 33 | Ga0070708_100535546 | 3300005445 | Bacteria | 1105 |
| 34 | Ga0070662_100149516 | 3300005457 | Bacteria | 1817 |
| 35 | Ga0070681_10173825 | 3300005458 | Bacteria | 2075 |
| 36 | Ga0068867_100135410 | 3300005459 | Bacteria | 1919 |
| 37 | Ga0068867_100261950 | 3300005459 | Bacteria | 1410 |
| 38 | Ga0068867_100845303 | 3300005459 | Bacteria | 820 |
| 39 | Ga0070685_10991612 | 3300005466 | Bacteria | 630 |
| 40 | Ga0070685_11138776 | 3300005466 | Bacteria | 591 |
| 41 | Ga0070706_100018387 | 3300005467 | Bacteria | 6447 |
| 42 | Ga0070706_101523590 | 3300005467 | Bacteria | 611 |
| 43 | Ga0070707_100022826 | 3300005468 | Bacteria | 5917 |
| 44 | Ga0070707_100357124 | 3300005468 | Bacteria | 1419 |
| 45 | Ga0070699_100295036 | 3300005518 | Bacteria | 1454 |
| 46 | Ga0070699_100720843 | 3300005518 | Bacteria | 911 |
| 47 | Ga0070699_101658276 | 3300005518 | Bacteria | 586 |
| 48 | Ga0070679_100249628 | 3300005530 | Bacteria | 1731 |
| 49 | Ga0070697_100006926 | 3300005536 | Bacteria | 8814 |
| 50 | Ga0070697_100081647 | 3300005536 | Bacteria | 2664 |
| 51 | Ga0070672_100017473 | 3300005543 | Bacteria | 5165 |
| 52 | Ga0070672_101126589 | 3300005543 | Bacteria | 698 |
| 53 | Ga0070686_100391237 | 3300005544 | Bacteria | 1055 |
| 54 | Ga0070686_101057689 | 3300005544 | Bacteria | 668 |
| 55 | Ga0070695_100027392 | 3300005545 | Bacteria | 3529 |
| 56 | Ga0070695_100053750 | 3300005545 | Bacteria | 2590 |
| 57 | Ga0070695_100633634 | 3300005545 | Bacteria | 842 |
| 58 | Ga0070696_100850264 | 3300005546 | Bacteria | 754 |
| 59 | Ga0070693_100257074 | 3300005547 | Bacteria | 1160 |
| 60 | Ga0070704_100050661 | 3300005549 | Bacteria | 2920 |
| 61 | Ga0068857_101235547 | 3300005577 | Bacteria | 724 |
| 62 | Ga0068854_100460348 | 3300005578 | Bacteria | 1064 |
| 63 | Ga0068852_101489805 | 3300005616 | Bacteria | 699 |
| 64 | Ga0068859_100051052 | 3300005617 | Bacteria | 4156 |
| 65 | Ga0068859_100204669 | 3300005617 | Bacteria | 2059 |
| 66 | Ga0068859_100380949 | 3300005617 | Bacteria | 1506 |
| 67 | Ga0068864_101441096 | 3300005618 | Bacteria | 691 |
| 68 | Ga0068861_100329340 | 3300005719 | Bacteria | 1333 |
| 69 | Ga0068861_100569653 | 3300005719 | Bacteria | 1035 |
| 70 | Ga0068863_100247091 | 3300005841 | Bacteria | 1723 |
| 71 | Ga0068860_100001095 | 3300005843 | Bacteria | 29820 |
| 72 | Ga0068860_100118474 | 3300005843 | Bacteria | 2534 |
| 73 | Ga0068860_101098040 | 3300005843 | Bacteria | 815 |
| 74 | Ga0068862_100075037 | 3300005844 | Bacteria | 2924 |
| 75 | Ga0068862_100088509 | 3300005844 | Bacteria | 2694 |
| 76 | Ga0068862_100484759 | 3300005844 | Bacteria | 1171 |
| 77 | Ga0068862_100567358 | 3300005844 | Bacteria | 1086 |
| 78 | Ga0068862_100651170 | 3300005844 | Bacteria | 1016 |
| 79 | Ga0070717_10169568 | 3300006028 | Bacteria | 1898 |
| 80 | Ga0075365_10303155 | 3300006038 | Bacteria | 1124 |
| 81 | Ga0070715_10875108 | 3300006163 | Bacteria | 551 |
| 82 | Ga0070716_100297026 | 3300006173 | Bacteria | 1122 |
| 83 | Ga0070716_100921549 | 3300006173 | Bacteria | 686 |
| 84 | Ga0075362_10205365 | 3300006177 | Bacteria | 960 |
| 85 | Ga0097621_101643689 | 3300006237 | Bacteria | 611 |
| 86 | Ga0075370_10827939 | 3300006353 | Bacteria | 565 |
| 87 | Ga0075428_100059180 | 3300006844 | Bacteria | 4195 |
| 88 | Ga0075428_100080470 | 3300006844 | Bacteria | 3556 |
| 89 | Ga0075428_100122430 | 3300006844 | Bacteria | 2832 |
| 90 | Ga0075430_101195178 | 3300006846 | Bacteria | 626 |
| 91 | Ga0075431_100000559 | 3300006847 | Bacteria | 31330 |
| 92 | Ga0075431_100000830 | 3300006847 | Bacteria | 26982 |
| 93 | Ga0075431_100054006 | 3300006847 | Bacteria | 4143 |
| 94 | Ga0075431_100144024 | 3300006847 | Bacteria | 2456 |
| 95 | Ga0075433_10000942 | 3300006852 | Bacteria | 20529 |
| 96 | Ga0075433_10113005 | 3300006852 | Bacteria | 2409 |
| 97 | Ga0075433_10142633 | 3300006852 | Bacteria | 2129 |
| 98 | Ga0075433_10272502 | 3300006852 | Bacteria | 1500 |
| 99 | Ga0075433_10575211 | 3300006852 | Bacteria | 990 |
| 100 | Ga0075433_10626555 | 3300006852 | Bacteria | 943 |
| 101 | Ga0075433_10877713 | 3300006852 | Bacteria | 783 |
| 102 | Ga0075433_11012403 | 3300006852 | Bacteria | 723 |
| 103 | Ga0075434_100000540 | 3300006871 | Bacteria | 28804 |
| 104 | Ga0075434_100100485 | 3300006871 | Bacteria | 2898 |
| 105 | Ga0075434_100241265 | 3300006871 | Bacteria | 1827 |
| 106 | Ga0075434_100315706 | 3300006871 | Bacteria | 1583 |
| 107 | Ga0075429_100000958 | 3300006880 | Bacteria | 22882 |
| 108 | Ga0075429_100031652 | 3300006880 | Bacteria | 4597 |
| 109 | Ga0075429_100207508 | 3300006880 | Bacteria | 1716 |
| 110 | Ga0075429_100541879 | 3300006880 | Bacteria | 1020 |
| 111 | Ga0075429_100565322 | 3300006880 | Bacteria | 997 |
| 112 | Ga0075429_100868244 | 3300006880 | Bacteria | 790 |
| 113 | Ga0068865_102146788 | 3300006881 | Bacteria | 508 |
| 114 | Ga0075436_100003766 | 3300006914 | Bacteria | 10400 |
| 115 | Ga0075436_100014542 | 3300006914 | Bacteria | 5393 |
| 116 | Ga0075436_100241891 | 3300006914 | Bacteria | 1284 |
| 117 | Ga0075436_100853593 | 3300006914 | Bacteria | 680 |
| 118 | Ga0097620_100051049 | 3300006931 | Bacteria | 4156 |
| 119 | Ga0097620_100204649 | 3300006931 | Bacteria | 2059 |
| 120 | Ga0097620_100380948 | 3300006931 | Bacteria | 1506 |
| 121 | Ga0075435_100049777 | 3300007076 | Bacteria | 3371 |
| 122 | Ga0075435_100131116 | 3300007076 | Bacteria | 2098 |
| 123 | Ga0075435_100159963 | 3300007076 | Bacteria | 1896 |
| 124 | Ga0075435_100288601 | 3300007076 | Bacteria | 1401 |
| 125 | Ga0075435_101561172 | 3300007076 | Bacteria | 579 |
| 126 | Ga0099794_10016939 | 3300007265 | Bacteria | 3240 |
| 127 | Ga0099794_10046646 | 3300007265 | Bacteria | 2076 |
| 128 | Ga0111539_10001562 | 3300009094 | Bacteria | 30480 |
| 129 | Ga0111539_10166330 | 3300009094 | Bacteria | 2578 |
| 130 | Ga0111539_10198602 | 3300009094 | Bacteria | 2339 |
| 131 | Ga0111539_10678949 | 3300009094 | Bacteria | 1199 |
| 132 | Ga0111539_11859785 | 3300009094 | Bacteria | 698 |
| 133 | Ga0105245_13282318 | 3300009098 | Bacteria | 501 |
| 134 | Ga0114129_10000487 | 3300009147 | Bacteria | 47969 |
| 135 | Ga0114129_10005736 | 3300009147 | Bacteria | 17593 |
| 136 | Ga0114129_10048865 | 3300009147 | Bacteria | 5946 |
| 137 | Ga0114129_10310164 | 3300009147 | Bacteria | 2100 |
| 138 | Ga0114129_10361737 | 3300009147 | Bacteria | 1920 |
| 139 | Ga0114129_10432311 | 3300009147 | Bacteria | 1729 |
| 140 | Ga0114129_10688091 | 3300009147 | Bacteria | 1316 |
| 141 | Ga0114129_10957561 | 3300009147 | Bacteria | 1081 |
| 142 | Ga0114129_11690513 | 3300009147 | Bacteria | 772 |
| 143 | Ga0114129_12929874 | 3300009147 | Bacteria | 563 |
| 144 | Ga0105243_10099548 | 3300009148 | Bacteria | 2410 |
| 145 | Ga0105243_10438078 | 3300009148 | Bacteria | 1223 |
| 146 | Ga0105243_12495547 | 3300009148 | Bacteria | 556 |
| 147 | Ga0105241_10326078 | 3300009174 | Bacteria | 1326 |
| 148 | Ga0105242_10510359 | 3300009176 | Bacteria | 1145 |
| 149 | Ga0105249_10195019 | 3300009553 | Bacteria | 1979 |
| 150 | Ga0105249_10453981 | 3300009553 | Bacteria | 1321 |
| 151 | Ga0105249_10566968 | 3300009553 | Bacteria | 1187 |
| 152 | Ga0105249_10567534 | 3300009553 | Bacteria | 1187 |
| 153 | Ga0105249_11157194 | 3300009553 | Bacteria | 844 |
| 154 | Ga0157378_10072155 | 3300013297 | Bacteria | 3102 |
| 155 | Ga0157378_10238495 | 3300013297 | Bacteria | 1736 |
| 156 | Ga0163162_11430973 | 3300013306 | Bacteria | 787 |
| 157 | Ga0163163_10762127 | 3300014325 | Bacteria | 1031 |
| 158 | Ga0157380_10086091 | 3300014326 | Bacteria | 2581 |
| 159 | Ga0157380_10667205 | 3300014326 | Bacteria | 1040 |
| 160 | Ga0157380_11304113 | 3300014326 | Bacteria | 773 |
| 161 | Ga0157380_11724950 | 3300014326 | Bacteria | 684 |
| 162 | Ga0157377_10277347 | 3300014745 | Bacteria | 1097 |
| 163 | Ga0157377_10441783 | 3300014745 | Bacteria | 896 |
| 164 | Ga0157379_11120482 | 3300014968 | Bacteria | 754 |
| 165 | Ga0163161_10034313 | 3300017792 | Bacteria | 3629 |
| 166 | Ga0197907_10385060 | 3300020069 | Bacteria | 738 |
| 167 | Ga0197907_10393945 | 3300020069 | Bacteria | 781 |
| 168 | Ga0206356_10519156 | 3300020070 | Bacteria | 1649 |
| 169 | Ga0206352_10606892 | 3300020078 | Bacteria | 691 |
| 170 | Ga0206350_10593989 | 3300020080 | Bacteria | 1714 |
| 171 | Ga0206354_11180814 | 3300020081 | Bacteria | 737 |
| 172 | Ga0206353_11994876 | 3300020082 | Bacteria | 892 |
| 173 | Ga0213876_10756303 | 3300021384 | Bacteria | 517 |
| 174 | Ga0207692_10027695 | 3300025898 | Bacteria | 2673 |
| 175 | Ga0207642_10081741 | 3300025899 | Bacteria | 1571 |
| 176 | Ga0207642_10379313 | 3300025899 | Bacteria | 841 |
| 177 | Ga0207699_10000182 | 3300025906 | Bacteria | 38240 |
| 178 | Ga0207645_10711138 | 3300025907 | Bacteria | 683 |
| 179 | Ga0207684_10013113 | 3300025910 | Bacteria | 7173 |
| 180 | Ga0207654_10414559 | 3300025911 | Bacteria | 939 |
| 181 | Ga0207707_10126663 | 3300025912 | Bacteria | 2234 |
| 182 | Ga0207660_10014904 | 3300025917 | Bacteria | 5124 |
| 183 | Ga0207660_10184142 | 3300025917 | Bacteria | 1623 |
| 184 | Ga0207662_10389882 | 3300025918 | Bacteria | 942 |
| 185 | Ga0207662_10458235 | 3300025918 | Bacteria | 873 |
| 186 | Ga0207652_10797988 | 3300025921 | Bacteria | 838 |
| 187 | Ga0207646_10008198 | 3300025922 | Bacteria | 10499 |
| 188 | Ga0207681_10000015 | 3300025923 | Bacteria | 352892 |
| 189 | Ga0207681_10006319 | 3300025923 | Bacteria | 7273 |
| 190 | Ga0207681_10392587 | 3300025923 | Bacteria | 1119 |
| 191 | Ga0207681_10698486 | 3300025923 | Bacteria | 843 |
| 192 | Ga0207681_11234550 | 3300025923 | Bacteria | 628 |
| 193 | Ga0207706_10032004 | 3300025933 | Bacteria | 4685 |
| 194 | Ga0207706_10901376 | 3300025933 | Bacteria | 747 |
| 195 | Ga0207686_10969072 | 3300025934 | Bacteria | 689 |
| 196 | Ga0207709_10257932 | 3300025935 | Bacteria | 1277 |
| 197 | Ga0207709_10734464 | 3300025935 | Bacteria | 792 |
| 198 | Ga0207709_10989971 | 3300025935 | Bacteria | 687 |
| 199 | Ga0207670_10002638 | 3300025936 | Bacteria | 9436 |
| 200 | Ga0207670_10219050 | 3300025936 | Bacteria | 1456 |
| 201 | Ga0207670_10570144 | 3300025936 | Bacteria | 927 |
| 202 | Ga0207704_10437706 | 3300025938 | Bacteria | 1040 |
| 203 | Ga0207704_10536490 | 3300025938 | Bacteria | 949 |
| 204 | Ga0207665_10339790 | 3300025939 | Bacteria | 1131 |
| 205 | Ga0207665_11068361 | 3300025939 | Bacteria | 643 |
| 206 | Ga0207665_11187448 | 3300025939 | Bacteria | 609 |
| 207 | Ga0207691_10039365 | 3300025940 | Bacteria | 4374 |
| 208 | Ga0207689_11496977 | 3300025942 | Bacteria | 564 |
| 209 | Ga0207712_10168100 | 3300025961 | Bacteria | 1711 |
| 210 | Ga0207712_11251387 | 3300025961 | Bacteria | 663 |
| 211 | Ga0207668_10245837 | 3300025972 | Bacteria | 1450 |
| 212 | Ga0207640_10495608 | 3300025981 | Bacteria | 1016 |
| 213 | Ga0207708_10138140 | 3300026075 | Bacteria | 1910 |
| 214 | Ga0207641_10083509 | 3300026088 | Bacteria | 2778 |
| 215 | Ga0207641_12303576 | 3300026088 | Bacteria | 538 |
| 216 | Ga0207648_10096337 | 3300026089 | Bacteria | 2589 |
| 217 | Ga0207648_10501498 | 3300026089 | Bacteria | 1111 |
| 218 | Ga0207676_11344174 | 3300026095 | Bacteria | 710 |
| 219 | Ga0207675_100077523 | 3300026118 | Bacteria | 3113 |
| 220 | Ga0207675_100881889 | 3300026118 | Bacteria | 910 |
| 221 | Ga0207675_100920676 | 3300026118 | Bacteria | 891 |
| 222 | Ga0207675_101123068 | 3300026118 | Bacteria | 806 |
| 223 | Ga0207683_10391721 | 3300026121 | Bacteria | 1277 |
| 224 | Ga0209588_1054995 | 3300027671 | Bacteria | 1286 |
| 225 | Ga0209971_1012896 | 3300027682 | Bacteria | 1980 |
| 226 | Ga0209998_10011435 | 3300027717 | Bacteria | 1837 |
| 227 | Ga0207428_10000095 | 3300027907 | Bacteria | 123199 |
| 228 | Ga0207428_10018969 | 3300027907 | Bacteria | 5866 |
| 229 | Ga0207428_10030020 | 3300027907 | Bacteria | 4497 |
| 230 | Ga0268265_10080941 | 3300028380 | Bacteria | 2563 |
| 231 | Ga0268265_10176968 | 3300028380 | Bacteria | 1829 |
| 232 | Ga0268265_10357759 | 3300028380 | Bacteria | 1335 |
| 233 | Ga0268265_10417546 | 3300028380 | Bacteria | 1245 |
| 234 | Ga0268265_10439776 | 3300028380 | Bacteria | 1215 |
| 235 | Ga0268265_10788541 | 3300028380 | Bacteria | 925 |
| 236 | Ga0268265_10918485 | 3300028380 | Bacteria | 860 |
| 237 | Ga0268265_11250720 | 3300028380 | Bacteria | 741 |
| 238 | Ga0268265_11280811 | 3300028380 | Bacteria | 733 |
| 239 | Ga0268264_10006187 | 3300028381 | Bacteria | 10112 |
| 240 | Ga0268264_10107687 | 3300028381 | Bacteria | 2435 |
| 241 | Ga0268264_10464585 | 3300028381 | Bacteria | 1228 |
| 242 | Ga0268264_11591073 | 3300028381 | Bacteria | 664 |
| 243 | Ga0265319_1051652 | 3300028563 | Bacteria | 1355 |
| 244 | Ga0265338_10013775 | 3300028800 | Bacteria | 9086 |
| 245 | Ga0265338_10083576 | 3300028800 | Bacteria | 2670 |
| 246 | Ga0265338_10262339 | 3300028800 | Bacteria | 1269 |
| 247 | Ga0265762_1031320 | 3300030760 | Bacteria | 1011 |
| 248 | Ga0265770_1008077 | 3300030878 | Bacteria | 1493 |
| 249 | Ga0265765_1040198 | 3300030879 | Unclassified | 619 |
| 250 | Ga0265760_10014127 | 3300031090 | Bacteria | 2285 |
| 251 | Ga0265760_10027358 | 3300031090 | Bacteria | 1671 |
| 252 | Ga0265320_10057274 | 3300031240 | Bacteria | 1870 |
| 253 | Ga0265325_10005096 | 3300031241 | Bacteria | 8175 |
| 254 | Ga0265340_10426111 | 3300031247 | Unclassified | 585 |
| 255 | Ga0265331_10483681 | 3300031250 | Bacteria | 557 |
| 256 | Ga0265316_10526189 | 3300031344 | Bacteria | 843 |
| 257 | Ga0307408_100006038 | 3300031548 | Bacteria | 8058 |
| 258 | Ga0316579_10589494 | 3300031691 | Bacteria | 538 |
| 259 | Ga0316576_10009047 | 3300031727 | Bacteria | 6406 |
| 260 | Ga0316578_10370332 | 3300031728 | Bacteria | 851 |
| 261 | Ga0307405_10664932 | 3300031731 | Bacteria | 858 |
| 262 | Ga0307405_11098088 | 3300031731 | Bacteria | 683 |
| 263 | Ga0307413_10220858 | 3300031824 | Bacteria | 1384 |
| 264 | Ga0307406_10492724 | 3300031901 | Bacteria | 992 |
| 265 | Ga0307406_11853673 | 3300031901 | Bacteria | 537 |
| 266 | Ga0307407_10521068 | 3300031903 | Bacteria | 874 |
| 267 | Ga0307416_100014518 | 3300032002 | Bacteria | 5404 |
| 268 | Ga0307416_101632951 | 3300032002 | Bacteria | 750 |
| 269 | Ga0307416_101720279 | 3300032002 | Bacteria | 732 |
| 270 | Ga0307416_103841409 | 3300032002 | Bacteria | 503 |
| 271 | Ga0307411_10385887 | 3300032005 | Bacteria | 1153 |
| 272 | Ga0307415_100800608 | 3300032126 | Bacteria | 860 |
| 273 | Ga0307415_101643990 | 3300032126 | Bacteria | 618 |
| 274 | Ga0316587_1006542 | 3300033529 | Bacteria | 1783 |
| 275 | Ga0373930_0042025 | 3300034816 | Bacteria | 977 |
| 276 | Ga0373948_0195365 | 3300034817 | Bacteria | 525 |
| 277 | Ga0373938_0163675 | 3300034957 | Bacteria | 599 |
| 278 | Ga0373928_0098420 | 3300035084 | Bacteria | 760 |
| 279 | Ga0373929_0000002 | 3300035085 | Bacteria | 683932 |
| 280 | Ga0373929_0056158 | 3300035085 | Bacteria | 911 |
| 281 | Ga0373940_0183431 | 3300035088 | Bacteria | 681 |
| 282 | Ga0373949_0103414 | 3300035090 | Bacteria | 783 |
| 283 | Ga0373951_0027592 | 3300035091 | Bacteria | 1326 |
| 284 | Ga0373952_0029614 | 3300035092 | Bacteria | 1208 |
| 285 | Ga0373932_0109838 | 3300035112 | Bacteria | 907 |
| 286 | Ga0373939_0042449 | 3300035114 | Bacteria | 1375 |
| 287 | Ga0373939_0149833 | 3300035114 | Bacteria | 848 |
| 288 | Ga0373939_0418183 | 3300035114 | Bacteria | 558 |
| 289 | Ga0373941_0116747 | 3300035115 | Bacteria | 947 |
| 290 | Ga0373960_0458417 | 3300035121 | Bacteria | 501 |
| 291 | Ga0373942_0056674 | 3300035207 | Bacteria | 1113 |
| 292 | Ga0373942_0165841 | 3300035207 | Bacteria | 717 |
| 293 | Ga0373961_0096676 | 3300035241 | Bacteria | 951 |
| 294 | Ga0373961_0141750 | 3300035241 | Bacteria | 813 |
| 295 | Ga0373962_0157815 | 3300035242 | Bacteria | 747 |
| 296 | Ga0316574_0737456 | 3300035398 | Bacteria | 602 |
| 297 | Ga0373931_0060834 | 3300035691 | Bacteria | 2035 |
| 298 | Ga0373931_0147774 | 3300035691 | Bacteria | 1367 |
| 299 | Ga0373931_0428683 | 3300035691 | Bacteria | 842 |
| 300 | Ga0436365_0483746 | 3300039437 | Bacteria | 716 |
| 301 | Ga0436365_1145587 | 3300039437 | Bacteria | 1542 |
| 302 | Ga0451804_0227137 | 3300041463 | Bacteria | 698 |
| 303 | Ga0451807_0219658 | 3300041486 | Bacteria | 891 |
| 304 | Ga0451849_1569559 | 3300041505 | Bacteria | 1151 |
| 305 | Ga0439460_0179496 | 3300042461 | Bacteria | 715 |
| 306 | Ga0451577_0008521 | 3300042876 | Bacteria | 9973 |
| 307 | Ga0451577_0074792 | 3300042876 | Bacteria | 3021 |
| 308 | Ga0451577_0128474 | 3300042876 | Bacteria | 2272 |
| 309 | Ga0451577_0164698 | 3300042876 | Bacteria | 1997 |
| 310 | Ga0453683_0284141 | 3300044673 | Bacteria | 1057 |
| 311 | Ga0466963_0760677 | 3300044694 | Bacteria | 683 |
| 312 | Ga0453684_0015628 | 3300044712 | Bacteria | 11973 |
| 313 | Ga0453684_0102461 | 3300044712 | Bacteria | 3500 |
| 314 | Ga0453684_0397698 | 3300044712 | Bacteria | 1544 |
| 315 | Ga0453684_0447373 | 3300044712 | Bacteria | 1439 |
| 316 | Ga0453684_0505584 | 3300044712 | Bacteria | 1337 |
| 317 | Ga0453684_0516244 | 3300044712 | Bacteria | 1321 |
| 318 | Ga0451576_0073213 | 3300045051 | Bacteria | 3565 |
| 319 | Ga0451576_0934390 | 3300045051 | Bacteria | 910 |
| 320 | Ga0451576_0962207 | 3300045051 | Bacteria | 895 |
| 321 | Ga0451576_1256499 | 3300045051 | Bacteria | 772 |
| 322 | Ga0495638_0000070 | 3300046460 | Bacteria | 166954 |
| 323 | Ga0495580_0000020 | 3300046472 | Bacteria | 91314 |
| 324 | Ga0495605_0316014 | 3300046474 | Bacteria | 659 |
| 325 | Ga0495584_0239393 | 3300046491 | Bacteria | 923 |
| 326 | Ga0495663_0364140 | 3300046525 | Bacteria | 528 |
| 327 | Ga0495642_0018331 | 3300046528 | Bacteria | 2740 |
| 328 | Ga0495642_0101210 | 3300046528 | Bacteria | 1226 |
| 329 | Ga0495654_0054197 | 3300046530 | Bacteria | 1946 |
| 330 | Ga0495633_0307512 | 3300046558 | Bacteria | 720 |
| 331 | Ga0495669_0057655 | 3300046684 | Bacteria | 1752 |
| 332 | Ga0495636_0083167 | 3300047318 | Bacteria | 1381 |
| 333 | Ga0495685_075047 | 3300047447 | Bacteria | 1130 |
| 334 | Ga0496102_0008904 | 3300048905 | Bacteria | 8613 |
| 335 | Ga0496106_0088560 | 3300048909 | Bacteria | 2386 |
| 336 | Ga0496106_0145917 | 3300048909 | Bacteria | 1864 |
| 337 | Ga0496106_0245610 | 3300048909 | Bacteria | 1430 |
| 338 | Ga0496106_1098350 | 3300048909 | Bacteria | 623 |
| 339 | Ga0496107_0212305 | 3300048910 | Bacteria | 1439 |
| 340 | Ga0496108_1104141 | 3300048911 | Bacteria | 674 |
| 341 | Ga0496110_0810117 | 3300048913 | Bacteria | 841 |
| 342 | Ga0496111_0552800 | 3300048914 | Bacteria | 845 |
| 343 | Ga0496113_0449860 | 3300048916 | Bacteria | 1035 |
| 344 | Ga0496114_0434360 | 3300048917 | Bacteria | 1163 |
| 345 | Ga0496115_0961042 | 3300048918 | Bacteria | 655 |
| 346 | Ga0501309_082924 | 3300049129 | Bacteria | 539 |
| 347 | Ga0501298_037609 | 3300049521 | Bacteria | 972 |
| 348 | Ga0501299_076560 | 3300049522 | Bacteria | 736 |
| 349 | Ga0501031_0509644 | 3300049568 | Bacteria | 776 |
| 350 | Ga0501033_0103166 | 3300049570 | Bacteria | 2080 |
| 351 | Ga0501033_0740766 | 3300049570 | Bacteria | 667 |
| 352 | Ga0501034_0344808 | 3300049571 | Bacteria | 1419 |
| 353 | Ga0501036_0338873 | 3300049572 | Bacteria | 1256 |
| 354 | Ga0501037_0462587 | 3300049573 | Bacteria | 864 |
| 355 | Ga0501039_0323329 | 3300049575 | Bacteria | 1212 |
| 356 | Ga0501039_0450898 | 3300049575 | Bacteria | 1010 |
| 357 | Ga0501040_0028534 | 3300049576 | Bacteria | 3763 |
| 358 | Ga0501040_0197689 | 3300049576 | Bacteria | 1427 |
| 359 | Ga0501041_0239340 | 3300049577 | Bacteria | 1140 |
| 360 | Ga0501041_0473209 | 3300049577 | Bacteria | 796 |
| 361 | Ga0501041_0676366 | 3300049577 | Bacteria | 660 |
| 362 | Ga0501041_0715964 | 3300049577 | Bacteria | 641 |
| 363 | Ga0501042_0090743 | 3300049578 | Bacteria | 2193 |
| 364 | Ga0501042_0114196 | 3300049578 | Bacteria | 1944 |
| 365 | Ga0501042_0164575 | 3300049578 | Bacteria | 1600 |
| 366 | Ga0501042_0613445 | 3300049578 | Bacteria | 791 |
| 367 | Ga0501043_0264946 | 3300049579 | Bacteria | 1320 |
| 368 | Ga0501046_0031144 | 3300049580 | Bacteria | 4327 |
| 369 | Ga0501046_0272777 | 3300049580 | Bacteria | 1240 |
| 370 | Ga0501046_0386879 | 3300049580 | Bacteria | 1012 |
| 371 | Ga0501048_0098552 | 3300049582 | Bacteria | 2062 |
| 372 | Ga0501048_0207923 | 3300049582 | Bacteria | 1388 |
| 373 | Ga0501048_0361217 | 3300049582 | Bacteria | 1036 |
| 374 | Ga0501048_0484125 | 3300049582 | Bacteria | 887 |
| 375 | Ga0501068_0306383 | 3300049584 | Bacteria | 1017 |
| 376 | Ga0501068_0834259 | 3300049584 | Bacteria | 605 |
| 377 | Ga0501071_0469442 | 3300049587 | Bacteria | 964 |
| 378 | Ga0501072_0080353 | 3300049588 | Bacteria | 2583 |
| 379 | Ga0501072_0083794 | 3300049588 | Bacteria | 2527 |
| 380 | Ga0501072_0711407 | 3300049588 | Bacteria | 789 |
| 381 | Ga0501072_1164017 | 3300049588 | Bacteria | 599 |
| 382 | Ga0501073_1159050 | 3300049589 | Bacteria | 531 |
| 383 | Ga0501074_0057257 | 3300049590 | Bacteria | 2808 |
| 384 | Ga0501074_0106046 | 3300049590 | Bacteria | 2012 |
| 385 | Ga0501074_0498271 | 3300049590 | Bacteria | 863 |
| 386 | Ga0501075_0237500 | 3300049591 | Bacteria | 1389 |
| 387 | Ga0501075_0325766 | 3300049591 | Bacteria | 1171 |
| 388 | Ga0501075_0463076 | 3300049591 | Bacteria | 967 |
| 389 | Ga0501075_0603598 | 3300049591 | Bacteria | 837 |
| 390 | Ga0501075_0826462 | 3300049591 | Bacteria | 705 |
| 391 | Ga0501075_0936432 | 3300049591 | Bacteria | 658 |
| 392 | Ga0501075_1354437 | 3300049591 | Bacteria | 539 |
| 393 | Ga0501076_0035569 | 3300049592 | Bacteria | 3896 |
| 394 | Ga0501076_0055917 | 3300049592 | Bacteria | 3130 |
| 395 | Ga0501076_0154531 | 3300049592 | Bacteria | 1867 |
| 396 | Ga0501076_1811873 | 3300049592 | Bacteria | 500 |
| 397 | Ga0501077_0007584 | 3300049593 | Bacteria | 6697 |
| 398 | Ga0501077_0083282 | 3300049593 | Bacteria | 2027 |
| 399 | Ga0501077_0159248 | 3300049593 | Bacteria | 1433 |
| 400 | Ga0501077_0267093 | 3300049593 | Bacteria | 1088 |
| 401 | Ga0501077_0868892 | 3300049593 | Bacteria | 580 |
| 402 | Ga0501206_037163 | 3300049653 | Bacteria | 741 |
| 403 | Ga0501079_0143613 | 3300049741 | Bacteria | 1859 |
| 404 | Ga0501079_0193171 | 3300049741 | Bacteria | 1589 |
| 405 | Ga0501079_0521412 | 3300049741 | Bacteria | 934 |
| 406 | Ga0501079_0595766 | 3300049741 | Bacteria | 870 |
| 407 | Ga0501081_0022514 | 3300049743 | Bacteria | 4217 |
| 408 | Ga0501081_0229160 | 3300049743 | Bacteria | 1352 |
| 409 | Ga0501081_0287292 | 3300049743 | Bacteria | 1205 |
| 410 | Ga0501081_0504552 | 3300049743 | Bacteria | 902 |
| 411 | Ga0501081_0510666 | 3300049743 | Bacteria | 896 |
| 412 | Ga0501081_1476616 | 3300049743 | Bacteria | 516 |
| 413 | Ga0501083_0495949 | 3300049744 | Bacteria | 795 |
| 414 | Ga0501083_0885527 | 3300049744 | Bacteria | 581 |
| 415 | Ga0501045_0040738 | 3300049824 | Bacteria | 3379 |
| 416 | Ga0501045_0100030 | 3300049824 | Bacteria | 2146 |
| 417 | Ga0501045_0155559 | 3300049824 | Bacteria | 1701 |
| 418 | Ga0501045_0921272 | 3300049824 | Bacteria | 642 |
| 419 | Ga0501045_0958904 | 3300049824 | Bacteria | 628 |
| 420 | nmdc:mga03n38_704014_c1 | 3300050490 | Bacteria | 582 |
| 421 | nmdc:mga00v17_194114_c1 | 3300050491 | Bacteria | 1312 |
| 422 | nmdc:mga0yw44_504814_c1 | 3300050492 | Bacteria | 821 |
| 423 | nmdc:mga07m45_621918_c1 | 3300050496 | Bacteria | 623 |
| 424 | nmdc:mga05p37_1175160_c1 | 3300050507 | Bacteria | 795 |
| 425 | nmdc:mga05p37_265117_c1 | 3300050507 | Bacteria | 2054 |
| 426 | nmdc:mga05p37_34830_c1 | 3300050507 | Bacteria | 6168 |
| 427 | nmdc:mga05p37_36644_c1 | 3300050507 | Bacteria | 6016 |
| 428 | nmdc:mga05p37_475287_c1 | 3300050507 | Bacteria | 1441 |
| 429 | nmdc:mga05p37_525833_c1 | 3300050507 | Bacteria | 1352 |
| 430 | nmdc:mga05p37_534460_c1 | 3300050507 | Bacteria | 1338 |
| 431 | nmdc:mga09592_228394_c1 | 3300050508 | Bacteria | 1612 |
| 432 | nmdc:mga09592_3243_c1 | 3300050508 | Bacteria | 13156 |
| 433 | nmdc:mga09592_565813_c1 | 3300050508 | Bacteria | 976 |
| 434 | nmdc:mga09592_745271_c1 | 3300050508 | Bacteria | 831 |
| 435 | nmdc:mga09592_85366_c1 | 3300050508 | Bacteria | 2693 |
| 436 | nmdc:mga0qj67_1189581_c1 | 3300050509 | Bacteria | 593 |
| 437 | nmdc:mga0qj67_271462_c1 | 3300050509 | Bacteria | 1375 |
| 438 | nmdc:mga0qj67_541240_c1 | 3300050509 | Bacteria | 934 |
| 439 | nmdc:mga06r32_1854711_c1 | 3300050510 | Bacteria | 538 |
| 440 | nmdc:mga06r32_514567_c1 | 3300050510 | Bacteria | 1173 |
| 441 | nmdc:mga06r32_772581_c1 | 3300050510 | Bacteria | 923 |
| 442 | nmdc:mga06r32_9698_c1 | 3300050510 | Bacteria | 8699 |
| 443 | nmdc:mga08y16_108447_c1 | 3300050511 | Bacteria | 2891 |
| 444 | nmdc:mga08y16_284966_c1 | 3300050511 | Bacteria | 1704 |
| 445 | nmdc:mga08y16_4138_c1 | 3300050511 | Bacteria | 15145 |
| 446 | nmdc:mga08y16_49297_c1 | 3300050511 | Bacteria | 4408 |
| 447 | nmdc:mga0n895_141118_c1 | 3300050512 | Bacteria | 2438 |
| 448 | nmdc:mga0n895_35352_c1 | 3300050512 | Bacteria | 4817 |
| 449 | nmdc:mga0n895_378731_c1 | 3300050512 | Bacteria | 1432 |
| 450 | nmdc:mga0n895_431419_c1 | 3300050512 | Bacteria | 1332 |
| 451 | nmdc:mga0n895_44242_c1 | 3300050512 | Bacteria | 4342 |
| 452 | nmdc:mga0n895_52788_c1 | 3300050512 | Bacteria | 3992 |
| 453 | nmdc:mga0n895_6339_c1 | 3300050512 | Bacteria | 10036 |
| 454 | nmdc:mga0n895_890373_c1 | 3300050512 | Bacteria | 876 |
| 455 | nmdc:mga0rr50_1080197_c1 | 3300050513 | Bacteria | 683 |
| 456 | nmdc:mga0rr50_120876_c1 | 3300050513 | Bacteria | 2085 |
| 457 | nmdc:mga0rr50_150046_c1 | 3300050513 | Bacteria | 1883 |
| 458 | nmdc:mga0rr50_167846_c1 | 3300050513 | Bacteria | 1786 |
| 459 | nmdc:mga0rr50_47202_c1 | 3300050513 | Bacteria | 3175 |
| 460 | nmdc:mga0rr50_89376_c1 | 3300050513 | Bacteria | 2395 |
| 461 | nmdc:mga08x19_332653_c1 | 3300050514 | Bacteria | 1058 |
| 462 | nmdc:mga08x19_48403_c1 | 3300050514 | Bacteria | 2724 |
| 463 | nmdc:mga08x19_501432_c1 | 3300050514 | Bacteria | 857 |
| 464 | nmdc:mga08x19_54576_c1 | 3300050514 | Bacteria | 2573 |
| 465 | nmdc:mga08x19_845467_c1 | 3300050514 | Bacteria | 650 |
| 466 | nmdc:mga0a205_127636_c2 | 3300050515 | Bacteria | 1472 |
| 467 | nmdc:mga0a205_166956_c1 | 3300050515 | Bacteria | 2097 |
| 468 | nmdc:mga0a205_196758_c1 | 3300050515 | Bacteria | 1907 |
| 469 | nmdc:mga0a205_2218_c1 | 3300050515 | Bacteria | 17084 |
| 470 | nmdc:mga0a205_244674_c1 | 3300050515 | Bacteria | 1674 |
| 471 | nmdc:mga0a205_377274_c1 | 3300050515 | Bacteria | 1283 |
| 472 | Ga0495655_0198227 | 3300053083 | Bacteria | 655 |
| 473 | Ga0500622_0463227 | 3300053156 | Bacteria | 502 |
| 474 | Ga0501084_0145080 | 3300054114 | Bacteria | 1999 |
| 475 | Ga0501084_0438205 | 3300054114 | Bacteria | 1105 |
| 476 | Ga0501084_1024144 | 3300054114 | Bacteria | 694 |
| 477 | Ga0501084_1053740 | 3300054114 | Bacteria | 683 |
| 478 | Ga0590075_010908 | 3300059424 | Bacteria | 2192 |
| 479 | Ga0501082_0306978 | 3300060353 | Bacteria | 1382 |
| 480 | Ga0501082_0460501 | 3300060353 | Bacteria | 1111 |
| 481 | Ga0501082_0532868 | 3300060353 | Bacteria | 1027 |
| 482 | Ga0501082_0533543 | 3300060353 | Bacteria | 1026 |
| 483 | Ga0530510_0003221 | 3300061734 | Bacteria | 11210 |
| 484 | Ga0530510_0011866 | 3300061734 | Bacteria | 6113 |
| 485 | Ga0530510_0013167 | 3300061734 | Bacteria | 5817 |
| 486 | Ga0530510_0071922 | 3300061734 | Bacteria | 2511 |
| 487 | Ga0530510_0085710 | 3300061734 | Bacteria | 2295 |
| 488 | Ga0530510_0727795 | 3300061734 | Bacteria | 756 |
| 489 | Ga0530510_1252907 | 3300061734 | Bacteria | 569 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049743 | Ga0501081_1476616 | Ga0501081_1476616_24_401 | 107 |
| 2 | 3300027907 | Ga0207428_10018969 | Ga0207428_100189696 | 109 |
| 3 | 3300049591 | Ga0501075_0325766 | Ga0501075_0325766_16_399 | 109 |
| 4 | 3300050511 | nmdc:mga08y16_108447_c1 | nmdc:mga08y16_108447_c1_888_1271 | 109 |
| 5 | 3300039437 | Ga0436365_1145587 | Ga0436365_1145587_27_371 | 110 |
| 6 | 3300035398 | Ga0316574_0737456 | Ga0316574_0737456_226_570 | 114 |
| 7 | 3300046460 | Ga0495638_0000070 | Ga0495638_0000070_84994_85380 | 114 |
| 8 | 3300028380 | Ga0268265_11280811 | Ga0268265_112808113 | 115 |
| 9 | 3300050507 | nmdc:mga05p37_34830_c1 | nmdc:mga05p37_34830_c1_3214_3633 | 115 |
| 10 | 3300050508 | nmdc:mga09592_3243_c1 | nmdc:mga09592_3243_c1_1015_1434 | 115 |
| 11 | 3300050510 | nmdc:mga06r32_772581_c1 | nmdc:mga06r32_772581_c1_57_476 | 115 |
| 12 | 3300050512 | nmdc:mga0n895_6339_c1 | nmdc:mga0n895_6339_c1_5683_6102 | 115 |
| 13 | 3300050513 | nmdc:mga0rr50_120876_c1 | nmdc:mga0rr50_120876_c1_1410_1829 | 115 |
| 14 | 3300050514 | nmdc:mga08x19_501432_c1 | nmdc:mga08x19_501432_c1_24_443 | 115 |
| 15 | 3300050515 | nmdc:mga0a205_2218_c1 | nmdc:mga0a205_2218_c1_3935_4354 | 115 |
| 16 | 3300050515 | nmdc:mga0a205_127636_c2 | nmdc:mga0a205_127636_c2_851_1267 | 116 |
| 17 | 3300009147 | Ga0114129_10000487 | Ga0114129_1000048741 | 118 |
| 18 | 3300049582 | Ga0501048_0361217 | Ga0501048_0361217_120_515 | 118 |
| 19 | 3300049584 | Ga0501068_0306383 | Ga0501068_0306383_491_886 | 118 |
| 20 | 3300049588 | Ga0501072_0711407 | Ga0501072_0711407_187_594 | 118 |
| 21 | 3300049590 | Ga0501074_0498271 | Ga0501074_0498271_261_656 | 118 |
| 22 | 3300049591 | Ga0501075_0826462 | Ga0501075_0826462_248_655 | 118 |
| 23 | 3300049593 | Ga0501077_0159248 | Ga0501077_0159248_919_1326 | 118 |
| 24 | 3300049593 | Ga0501077_0267093 | Ga0501077_0267093_37_432 | 118 |
| 25 | 3300049741 | Ga0501079_0193171 | Ga0501079_0193171_1069_1464 | 118 |
| 26 | 3300049824 | Ga0501045_0958904 | Ga0501045_0958904_109_504 | 118 |
| 27 | 3300050508 | nmdc:mga09592_565813_c1 | nmdc:mga09592_565813_c1_567_962 | 118 |
| 28 | 3300054114 | Ga0501084_0438205 | Ga0501084_0438205_19_414 | 118 |
| 29 | 3300060353 | Ga0501082_0460501 | Ga0501082_0460501_482_889 | 118 |
| 30 | 3300061734 | Ga0530510_0003221 | Ga0530510_0003221_3396_3803 | 118 |
| 31 | 3300061734 | Ga0530510_0727795 | Ga0530510_0727795_32_427 | 118 |
| 32 | 3300006846 | Ga0075430_101195178 | Ga0075430_1011951782 | 119 |
| 33 | 3300009147 | Ga0114129_10361737 | Ga0114129_103617374 | 119 |
| 34 | 3300050507 | nmdc:mga05p37_1175160_c1 | nmdc:mga05p37_1175160_c1_188_601 | 119 |
| 35 | 3300050509 | nmdc:mga0qj67_541240_c1 | nmdc:mga0qj67_541240_c1_40_453 | 119 |
| 36 | 3300006852 | Ga0075433_10626555 | Ga0075433_106265552 | 120 |
| 37 | 3300009094 | Ga0111539_10001562 | Ga0111539_1000156210 | 120 |
| 38 | 3300027907 | Ga0207428_10000095 | Ga0207428_1000009526 | 120 |
| 39 | 3300050490 | nmdc:mga03n38_704014_c1 | nmdc:mga03n38_704014_c1_91_459 | 120 |
| 40 | 3300050511 | nmdc:mga08y16_49297_c1 | nmdc:mga08y16_49297_c1_1049_1480 | 120 |
| 41 | 3300050515 | nmdc:mga0a205_244674_c1 | nmdc:mga0a205_244674_c1_366_797 | 120 |
| 42 | 3300005331 | Ga0070670_100473795 | Ga0070670_1004737953 | 121 |
| 43 | 3300005347 | Ga0070668_100330308 | Ga0070668_1003303083 | 121 |
| 44 | 3300005530 | Ga0070679_100249628 | Ga0070679_1002496282 | 121 |
| 45 | 3300005545 | Ga0070695_100053750 | Ga0070695_1000537504 | 121 |
| 46 | 3300006847 | Ga0075431_100054006 | Ga0075431_1000540066 | 121 |
| 47 | 3300006852 | Ga0075433_10000942 | Ga0075433_1000094215 | 121 |
| 48 | 3300006852 | Ga0075433_10113005 | Ga0075433_101130053 | 121 |
| 49 | 3300006871 | Ga0075434_100000540 | Ga0075434_10000054012 | 121 |
| 50 | 3300006871 | Ga0075434_100315706 | Ga0075434_1003157063 | 121 |
| 51 | 3300006880 | Ga0075429_100000958 | Ga0075429_10000095822 | 121 |
| 52 | 3300006914 | Ga0075436_100241891 | Ga0075436_1002418912 | 121 |
| 53 | 3300009147 | Ga0114129_10005736 | Ga0114129_1000573611 | 121 |
| 54 | 3300014745 | Ga0157377_10441783 | Ga0157377_104417832 | 121 |
| 55 | 3300025921 | Ga0207652_10797988 | Ga0207652_107979882 | 121 |
| 56 | 3300025961 | Ga0207712_11251387 | Ga0207712_112513872 | 121 |
| 57 | 3300026095 | Ga0207676_11344174 | Ga0207676_113441742 | 121 |
| 58 | 3300026118 | Ga0207675_100077523 | Ga0207675_1000775236 | 121 |
| 59 | 3300027907 | Ga0207428_10030020 | Ga0207428_100300205 | 121 |
| 60 | 3300032002 | Ga0307416_103841409 | Ga0307416_1038414091 | 121 |
| 61 | 3300032126 | Ga0307415_101643990 | Ga0307415_1016439901 | 121 |
| 62 | 3300042876 | Ga0451577_0164698 | Ga0451577_0164698_1260_1628 | 121 |
| 63 | 3300046474 | Ga0495605_0316014 | Ga0495605_0316014_152_586 | 121 |
| 64 | 3300046528 | Ga0495642_0018331 | Ga0495642_0018331_2173_2598 | 121 |
| 65 | 3300046530 | Ga0495654_0054197 | Ga0495654_0054197_402_776 | 121 |
| 66 | 3300049568 | Ga0501031_0509644 | Ga0501031_0509644_312_734 | 121 |
| 67 | 3300049575 | Ga0501039_0450898 | Ga0501039_0450898_46_468 | 121 |
| 68 | 3300049582 | Ga0501048_0207923 | Ga0501048_0207923_934_1356 | 121 |
| 69 | 3300049588 | Ga0501072_0083794 | Ga0501072_0083794_215_637 | 121 |
| 70 | 3300049589 | Ga0501073_1159050 | Ga0501073_1159050_63_491 | 121 |
| 71 | 3300049590 | Ga0501074_0106046 | Ga0501074_0106046_420_842 | 121 |
| 72 | 3300049592 | Ga0501076_0055917 | Ga0501076_0055917_243_665 | 121 |
| 73 | 3300049743 | Ga0501081_0287292 | Ga0501081_0287292_657_1085 | 121 |
| 74 | 3300050509 | nmdc:mga0qj67_271462_c1 | nmdc:mga0qj67_271462_c1_299_724 | 121 |
| 75 | 3300050511 | nmdc:mga08y16_4138_c1 | nmdc:mga08y16_4138_c1_6478_6903 | 121 |
| 76 | 3300050512 | nmdc:mga0n895_52788_c1 | nmdc:mga0n895_52788_c1_3377_3799 | 121 |
| 77 | 3300050513 | nmdc:mga0rr50_167846_c1 | nmdc:mga0rr50_167846_c1_1187_1609 | 121 |
| 78 | 3300050515 | nmdc:mga0a205_166956_c1 | nmdc:mga0a205_166956_c1_799_1221 | 121 |
| 79 | 3300053156 | Ga0500622_0463227 | Ga0500622_0463227_100_468 | 121 |
| 80 | 3300054114 | Ga0501084_0145080 | Ga0501084_0145080_974_1396 | 121 |
| 81 | 3300060353 | Ga0501082_0533543 | Ga0501082_0533543_310_732 | 121 |
| 82 | 3300061734 | Ga0530510_0085710 | Ga0530510_0085710_627_1049 | 121 |
| 83 | 3300005295 | Ga0065707_10357816 | Ga0065707_103578162 | 122 |
| 84 | 3300006852 | Ga0075433_10142633 | Ga0075433_101426334 | 122 |
| 85 | 3300006852 | Ga0075433_11012403 | Ga0075433_110124032 | 122 |
| 86 | 3300006871 | Ga0075434_100241265 | Ga0075434_1002412653 | 122 |
| 87 | 3300006914 | Ga0075436_100014542 | Ga0075436_10001454210 | 122 |
| 88 | 3300006914 | Ga0075436_100853593 | Ga0075436_1008535931 | 122 |
| 89 | 3300007076 | Ga0075435_100131116 | Ga0075435_1001311163 | 122 |
| 90 | 3300007076 | Ga0075435_100159963 | Ga0075435_1001599633 | 122 |
| 91 | 3300007265 | Ga0099794_10016939 | Ga0099794_100169396 | 122 |
| 92 | 3300009147 | Ga0114129_10688091 | Ga0114129_106880913 | 122 |
| 93 | 3300013297 | Ga0157378_10072155 | Ga0157378_100721556 | 122 |
| 94 | 3300020069 | Ga0197907_10385060 | Ga0197907_103850601 | 122 |
| 95 | 3300020069 | Ga0197907_10393945 | Ga0197907_103939452 | 122 |
| 96 | 3300020070 | Ga0206356_10519156 | Ga0206356_105191562 | 122 |
| 97 | 3300020078 | Ga0206352_10606892 | Ga0206352_106068922 | 122 |
| 98 | 3300020080 | Ga0206350_10593989 | Ga0206350_105939893 | 122 |
| 99 | 3300020081 | Ga0206354_11180814 | Ga0206354_111808142 | 122 |
| 100 | 3300020082 | Ga0206353_11994876 | Ga0206353_119948762 | 122 |
| 101 | 3300025923 | Ga0207681_10698486 | Ga0207681_106984862 | 122 |
| 102 | 3300025938 | Ga0207704_10536490 | Ga0207704_105364902 | 122 |
| 103 | 3300028381 | Ga0268264_10464585 | Ga0268264_104645853 | 122 |
| 104 | 3300031691 | Ga0316579_10589494 | Ga0316579_105894941 | 122 |
| 105 | 3300031727 | Ga0316576_10009047 | Ga0316576_100090473 | 122 |
| 106 | 3300031728 | Ga0316578_10370332 | Ga0316578_103703322 | 122 |
| 107 | 3300035090 | Ga0373949_0103414 | Ga0373949_0103414_211_645 | 122 |
| 108 | 3300035092 | Ga0373952_0029614 | Ga0373952_0029614_218_652 | 122 |
| 109 | 3300035112 | Ga0373932_0109838 | Ga0373932_0109838_436_870 | 122 |
| 110 | 3300035114 | Ga0373939_0418183 | Ga0373939_0418183_82_516 | 122 |
| 111 | 3300035691 | Ga0373931_0147774 | Ga0373931_0147774_664_1098 | 122 |
| 112 | 3300042876 | Ga0451577_0128474 | Ga0451577_0128474_1078_1512 | 122 |
| 113 | 3300044673 | Ga0453683_0284141 | Ga0453683_0284141_183_554 | 122 |
| 114 | 3300044694 | Ga0466963_0760677 | Ga0466963_0760677_37_414 | 122 |
| 115 | 3300044712 | Ga0453684_0447373 | Ga0453684_0447373_112_546 | 122 |
| 116 | 3300044712 | Ga0453684_0516244 | Ga0453684_0516244_258_626 | 122 |
| 117 | 3300045051 | Ga0451576_0073213 | Ga0451576_0073213_2843_3277 | 122 |
| 118 | 3300045051 | Ga0451576_1256499 | Ga0451576_1256499_50_484 | 122 |
| 119 | 3300046491 | Ga0495584_0239393 | Ga0495584_0239393_292_717 | 122 |
| 120 | 3300046528 | Ga0495642_0101210 | Ga0495642_0101210_501_935 | 122 |
| 121 | 3300046558 | Ga0495633_0307512 | Ga0495633_0307512_178_612 | 122 |
| 122 | 3300047318 | Ga0495636_0083167 | Ga0495636_0083167_765_1193 | 122 |
| 123 | 3300048909 | Ga0496106_1098350 | Ga0496106_1098350_120_554 | 122 |
| 124 | 3300049584 | Ga0501068_0834259 | Ga0501068_0834259_110_484 | 122 |
| 125 | 3300049591 | Ga0501075_0936432 | Ga0501075_0936432_55_432 | 122 |
| 126 | 3300050507 | nmdc:mga05p37_265117_c1 | nmdc:mga05p37_265117_c1_1256_1690 | 122 |
| 127 | 3300050508 | nmdc:mga09592_228394_c1 | nmdc:mga09592_228394_c1_959_1393 | 122 |
| 128 | 3300050512 | nmdc:mga0n895_141118_c1 | nmdc:mga0n895_141118_c1_1346_1780 | 122 |
| 129 | 3300050513 | nmdc:mga0rr50_47202_c1 | nmdc:mga0rr50_47202_c1_149_583 | 122 |
| 130 | 3300050514 | nmdc:mga08x19_332653_c1 | nmdc:mga08x19_332653_c1_147_581 | 122 |
| 131 | 3300050514 | nmdc:mga08x19_48403_c1 | nmdc:mga08x19_48403_c1_19_450 | 122 |
| 132 | 3300050515 | nmdc:mga0a205_196758_c1 | nmdc:mga0a205_196758_c1_1393_1827 | 122 |
| 133 | 3300005335 | Ga0070666_10335049 | Ga0070666_103350491 | 123 |
| 134 | 3300005340 | Ga0070689_100045106 | Ga0070689_1000451064 | 123 |
| 135 | 3300005340 | Ga0070689_100334614 | Ga0070689_1003346142 | 123 |
| 136 | 3300005341 | Ga0070691_10054652 | Ga0070691_100546522 | 123 |
| 137 | 3300005353 | Ga0070669_100000040 | Ga0070669_10000004026 | 123 |
| 138 | 3300005354 | Ga0070675_100944972 | Ga0070675_1009449721 | 123 |
| 139 | 3300005356 | Ga0070674_100909368 | Ga0070674_1009093682 | 123 |
| 140 | 3300005364 | Ga0070673_102415976 | Ga0070673_1024159761 | 123 |
| 141 | 3300005406 | Ga0070703_10115343 | Ga0070703_101153431 | 123 |
| 142 | 3300005434 | Ga0070709_10000076 | Ga0070709_1000007650 | 123 |
| 143 | 3300005436 | Ga0070713_100405506 | Ga0070713_1004055062 | 123 |
| 144 | 3300005438 | Ga0070701_10436839 | Ga0070701_104368391 | 123 |
| 145 | 3300005444 | Ga0070694_100140367 | Ga0070694_1001403673 | 123 |
| 146 | 3300005445 | Ga0070708_100154649 | Ga0070708_1001546493 | 123 |
| 147 | 3300005459 | Ga0068867_100135410 | Ga0068867_1001354104 | 123 |
| 148 | 3300005466 | Ga0070685_10991612 | Ga0070685_109916122 | 123 |
| 149 | 3300005466 | Ga0070685_11138776 | Ga0070685_111387761 | 123 |
| 150 | 3300005467 | Ga0070706_100018387 | Ga0070706_1000183877 | 123 |
| 151 | 3300005518 | Ga0070699_100295036 | Ga0070699_1002950362 | 123 |
| 152 | 3300005518 | Ga0070699_100720843 | Ga0070699_1007208432 | 123 |
| 153 | 3300005544 | Ga0070686_100391237 | Ga0070686_1003912372 | 123 |
| 154 | 3300005544 | Ga0070686_101057689 | Ga0070686_1010576891 | 123 |
| 155 | 3300005545 | Ga0070695_100027392 | Ga0070695_1000273923 | 123 |
| 156 | 3300005545 | Ga0070695_100633634 | Ga0070695_1006336342 | 123 |
| 157 | 3300005546 | Ga0070696_100850264 | Ga0070696_1008502642 | 123 |
| 158 | 3300005547 | Ga0070693_100257074 | Ga0070693_1002570741 | 123 |
| 159 | 3300005577 | Ga0068857_101235547 | Ga0068857_1012355472 | 123 |
| 160 | 3300005616 | Ga0068852_101489805 | Ga0068852_1014898052 | 123 |
| 161 | 3300005617 | Ga0068859_100051052 | Ga0068859_1000510526 | 123 |
| 162 | 3300005617 | Ga0068859_100204669 | Ga0068859_1002046694 | 123 |
| 163 | 3300005618 | Ga0068864_101441096 | Ga0068864_1014410963 | 123 |
| 164 | 3300005719 | Ga0068861_100329340 | Ga0068861_1003293404 | 123 |
| 165 | 3300005843 | Ga0068860_100001095 | Ga0068860_10000109526 | 123 |
| 166 | 3300005844 | Ga0068862_100075037 | Ga0068862_1000750373 | 123 |
| 167 | 3300005844 | Ga0068862_100651170 | Ga0068862_1006511702 | 123 |
| 168 | 3300006028 | Ga0070717_10169568 | Ga0070717_101695683 | 123 |
| 169 | 3300006163 | Ga0070715_10875108 | Ga0070715_108751082 | 123 |
| 170 | 3300006173 | Ga0070716_100297026 | Ga0070716_1002970262 | 123 |
| 171 | 3300006173 | Ga0070716_100921549 | Ga0070716_1009215492 | 123 |
| 172 | 3300006177 | Ga0075362_10205365 | Ga0075362_102053652 | 123 |
| 173 | 3300006237 | Ga0097621_101643689 | Ga0097621_1016436892 | 123 |
| 174 | 3300006353 | Ga0075370_10827939 | Ga0075370_108279392 | 123 |
| 175 | 3300006844 | Ga0075428_100080470 | Ga0075428_1000804705 | 123 |
| 176 | 3300006847 | Ga0075431_100000830 | Ga0075431_10000083014 | 123 |
| 177 | 3300006852 | Ga0075433_10272502 | Ga0075433_102725021 | 123 |
| 178 | 3300006852 | Ga0075433_10877713 | Ga0075433_108777131 | 123 |
| 179 | 3300006871 | Ga0075434_100100485 | Ga0075434_1001004855 | 123 |
| 180 | 3300006880 | Ga0075429_100207508 | Ga0075429_1002075083 | 123 |
| 181 | 3300006880 | Ga0075429_100565322 | Ga0075429_1005653222 | 123 |
| 182 | 3300006880 | Ga0075429_100868244 | Ga0075429_1008682442 | 123 |
| 183 | 3300006881 | Ga0068865_102146788 | Ga0068865_1021467881 | 123 |
| 184 | 3300006914 | Ga0075436_100003766 | Ga0075436_10000376622 | 123 |
| 185 | 3300006931 | Ga0097620_100051049 | Ga0097620_1000510496 | 123 |
| 186 | 3300006931 | Ga0097620_100204649 | Ga0097620_1002046494 | 123 |
| 187 | 3300007076 | Ga0075435_100288601 | Ga0075435_1002886014 | 123 |
| 188 | 3300007076 | Ga0075435_101561172 | Ga0075435_1015611721 | 123 |
| 189 | 3300009094 | Ga0111539_10198602 | Ga0111539_101986021 | 123 |
| 190 | 3300009094 | Ga0111539_10678949 | Ga0111539_106789491 | 123 |
| 191 | 3300009147 | Ga0114129_10432311 | Ga0114129_104323112 | 123 |
| 192 | 3300009147 | Ga0114129_10957561 | Ga0114129_109575612 | 123 |
| 193 | 3300009147 | Ga0114129_12929874 | Ga0114129_129298742 | 123 |
| 194 | 3300009148 | Ga0105243_10438078 | Ga0105243_104380783 | 123 |
| 195 | 3300009148 | Ga0105243_12495547 | Ga0105243_124955472 | 123 |
| 196 | 3300009176 | Ga0105242_10510359 | Ga0105242_105103594 | 123 |
| 197 | 3300009553 | Ga0105249_10453981 | Ga0105249_104539813 | 123 |
| 198 | 3300009553 | Ga0105249_10566968 | Ga0105249_105669685 | 123 |
| 199 | 3300009553 | Ga0105249_11157194 | Ga0105249_111571942 | 123 |
| 200 | 3300013297 | Ga0157378_10238495 | Ga0157378_102384953 | 123 |
| 201 | 3300014325 | Ga0163163_10762127 | Ga0163163_107621272 | 123 |
| 202 | 3300014326 | Ga0157380_10667205 | Ga0157380_106672052 | 123 |
| 203 | 3300014326 | Ga0157380_11304113 | Ga0157380_113041132 | 123 |
| 204 | 3300014745 | Ga0157377_10277347 | Ga0157377_102773471 | 123 |
| 205 | 3300014968 | Ga0157379_11120482 | Ga0157379_111204822 | 123 |
| 206 | 3300021384 | Ga0213876_10756303 | Ga0213876_107563031 | 123 |
| 207 | 3300025898 | Ga0207692_10027695 | Ga0207692_100276951 | 123 |
| 208 | 3300025906 | Ga0207699_10000182 | Ga0207699_1000018226 | 123 |
| 209 | 3300025907 | Ga0207645_10711138 | Ga0207645_107111381 | 123 |
| 210 | 3300025910 | Ga0207684_10013113 | Ga0207684_100131135 | 123 |
| 211 | 3300025917 | Ga0207660_10184142 | Ga0207660_101841423 | 123 |
| 212 | 3300025918 | Ga0207662_10389882 | Ga0207662_103898822 | 123 |
| 213 | 3300025923 | Ga0207681_10000015 | Ga0207681_10000015273 | 123 |
| 214 | 3300025923 | Ga0207681_11234550 | Ga0207681_112345501 | 123 |
| 215 | 3300025933 | Ga0207706_10901376 | Ga0207706_109013762 | 123 |
| 216 | 3300025935 | Ga0207709_10989971 | Ga0207709_109899712 | 123 |
| 217 | 3300025936 | Ga0207670_10002638 | Ga0207670_100026387 | 123 |
| 218 | 3300025936 | Ga0207670_10219050 | Ga0207670_102190502 | 123 |
| 219 | 3300025936 | Ga0207670_10570144 | Ga0207670_105701442 | 123 |
| 220 | 3300025939 | Ga0207665_10339790 | Ga0207665_103397902 | 123 |
| 221 | 3300025939 | Ga0207665_11068361 | Ga0207665_110683611 | 123 |
| 222 | 3300025939 | Ga0207665_11187448 | Ga0207665_111874482 | 123 |
| 223 | 3300025942 | Ga0207689_11496977 | Ga0207689_114969771 | 123 |
| 224 | 3300025961 | Ga0207712_10168100 | Ga0207712_101681003 | 123 |
| 225 | 3300025981 | Ga0207640_10495608 | Ga0207640_104956082 | 123 |
| 226 | 3300026075 | Ga0207708_10138140 | Ga0207708_101381403 | 123 |
| 227 | 3300026088 | Ga0207641_12303576 | Ga0207641_123035761 | 123 |
| 228 | 3300026118 | Ga0207675_100881889 | Ga0207675_1008818893 | 123 |
| 229 | 3300026118 | Ga0207675_100920676 | Ga0207675_1009206762 | 123 |
| 230 | 3300026121 | Ga0207683_10391721 | Ga0207683_103917212 | 123 |
| 231 | 3300027682 | Ga0209971_1012896 | Ga0209971_10128963 | 123 |
| 232 | 3300027717 | Ga0209998_10011435 | Ga0209998_100114352 | 123 |
| 233 | 3300028380 | Ga0268265_10176968 | Ga0268265_101769682 | 123 |
| 234 | 3300028380 | Ga0268265_10788541 | Ga0268265_107885412 | 123 |
| 235 | 3300028380 | Ga0268265_11250720 | Ga0268265_112507202 | 123 |
| 236 | 3300028381 | Ga0268264_10006187 | Ga0268264_1000618720 | 123 |
| 237 | 3300028381 | Ga0268264_11591073 | Ga0268264_115910731 | 123 |
| 238 | 3300028563 | Ga0265319_1051652 | Ga0265319_10516522 | 123 |
| 239 | 3300028800 | Ga0265338_10013775 | Ga0265338_100137754 | 123 |
| 240 | 3300028800 | Ga0265338_10083576 | Ga0265338_100835762 | 123 |
| 241 | 3300028800 | Ga0265338_10262339 | Ga0265338_102623391 | 123 |
| 242 | 3300030760 | Ga0265762_1031320 | Ga0265762_10313202 | 123 |
| 243 | 3300030878 | Ga0265770_1008077 | Ga0265770_10080772 | 123 |
| 244 | 3300030879 | Ga0265765_1040198 | Ga0265765_10401982 | 123 |
| 245 | 3300031090 | Ga0265760_10014127 | Ga0265760_100141272 | 123 |
| 246 | 3300031090 | Ga0265760_10027358 | Ga0265760_100273582 | 123 |
| 247 | 3300031240 | Ga0265320_10057274 | Ga0265320_100572744 | 123 |
| 248 | 3300031241 | Ga0265325_10005096 | Ga0265325_1000509610 | 123 |
| 249 | 3300031247 | Ga0265340_10426111 | Ga0265340_104261112 | 123 |
| 250 | 3300031250 | Ga0265331_10483681 | Ga0265331_104836812 | 123 |
| 251 | 3300031344 | Ga0265316_10526189 | Ga0265316_105261891 | 123 |
| 252 | 3300032002 | Ga0307416_101632951 | Ga0307416_1016329512 | 123 |
| 253 | 3300032002 | Ga0307416_101720279 | Ga0307416_1017202793 | 123 |
| 254 | 3300033529 | Ga0316587_1006542 | Ga0316587_10065423 | 123 |
| 255 | 3300034817 | Ga0373948_0195365 | Ga0373948_0195365_63_479 | 123 |
| 256 | 3300034957 | Ga0373938_0163675 | Ga0373938_0163675_41_424 | 123 |
| 257 | 3300035085 | Ga0373929_0000002 | Ga0373929_0000002_185096_185479 | 123 |
| 258 | 3300035114 | Ga0373939_0149833 | Ga0373939_0149833_373_792 | 123 |
| 259 | 3300035121 | Ga0373960_0458417 | Ga0373960_0458417_61_444 | 123 |
| 260 | 3300035207 | Ga0373942_0165841 | Ga0373942_0165841_16_435 | 123 |
| 261 | 3300035241 | Ga0373961_0096676 | Ga0373961_0096676_29_448 | 123 |
| 262 | 3300035242 | Ga0373962_0157815 | Ga0373962_0157815_159_542 | 123 |
| 263 | 3300035691 | Ga0373931_0428683 | Ga0373931_0428683_21_404 | 123 |
| 264 | 3300039437 | Ga0436365_0483746 | Ga0436365_0483746_302_685 | 123 |
| 265 | 3300041463 | Ga0451804_0227137 | Ga0451804_0227137_14_397 | 123 |
| 266 | 3300041486 | Ga0451807_0219658 | Ga0451807_0219658_385_768 | 123 |
| 267 | 3300041505 | Ga0451849_1569559 | Ga0451849_1569559_137_520 | 123 |
| 268 | 3300042876 | Ga0451577_0008521 | Ga0451577_0008521_3823_4212 | 123 |
| 269 | 3300042876 | Ga0451577_0074792 | Ga0451577_0074792_2406_2789 | 123 |
| 270 | 3300044712 | Ga0453684_0015628 | Ga0453684_0015628_10803_11192 | 123 |
| 271 | 3300044712 | Ga0453684_0102461 | Ga0453684_0102461_761_1144 | 123 |
| 272 | 3300044712 | Ga0453684_0397698 | Ga0453684_0397698_414_806 | 123 |
| 273 | 3300045051 | Ga0451576_0962207 | Ga0451576_0962207_476_868 | 123 |
| 274 | 3300047447 | Ga0495685_075047 | Ga0495685_075047_282_698 | 123 |
| 275 | 3300048911 | Ga0496108_1104141 | Ga0496108_1104141_34_417 | 123 |
| 276 | 3300048914 | Ga0496111_0552800 | Ga0496111_0552800_423_806 | 123 |
| 277 | 3300048916 | Ga0496113_0449860 | Ga0496113_0449860_466_849 | 123 |
| 278 | 3300048918 | Ga0496115_0961042 | Ga0496115_0961042_102_488 | 123 |
| 279 | 3300049571 | Ga0501034_0344808 | Ga0501034_0344808_331_714 | 123 |
| 280 | 3300049577 | Ga0501041_0676366 | Ga0501041_0676366_18_398 | 123 |
| 281 | 3300049577 | Ga0501041_0715964 | Ga0501041_0715964_71_454 | 123 |
| 282 | 3300049580 | Ga0501046_0386879 | Ga0501046_0386879_543_926 | 123 |
| 283 | 3300049588 | Ga0501072_1164017 | Ga0501072_1164017_26_409 | 123 |
| 284 | 3300049591 | Ga0501075_0463076 | Ga0501075_0463076_438_818 | 123 |
| 285 | 3300049592 | Ga0501076_1811873 | Ga0501076_1811873_80_463 | 123 |
| 286 | 3300049741 | Ga0501079_0595766 | Ga0501079_0595766_398_778 | 123 |
| 287 | 3300049743 | Ga0501081_0229160 | Ga0501081_0229160_590_973 | 123 |
| 288 | 3300049744 | Ga0501083_0885527 | Ga0501083_0885527_18_401 | 123 |
| 289 | 3300049824 | Ga0501045_0921272 | Ga0501045_0921272_105_488 | 123 |
| 290 | 3300050496 | nmdc:mga07m45_621918_c1 | nmdc:mga07m45_621918_c1_80_463 | 123 |
| 291 | 3300050507 | nmdc:mga05p37_534460_c1 | nmdc:mga05p37_534460_c1_135_518 | 123 |
| 292 | 3300050508 | nmdc:mga09592_745271_c1 | nmdc:mga09592_745271_c1_289_672 | 123 |
| 293 | 3300050508 | nmdc:mga09592_85366_c1 | nmdc:mga09592_85366_c1_2033_2416 | 123 |
| 294 | 3300050510 | nmdc:mga06r32_1854711_c1 | nmdc:mga06r32_1854711_c1_131_514 | 123 |
| 295 | 3300050510 | nmdc:mga06r32_9698_c1 | nmdc:mga06r32_9698_c1_754_1137 | 123 |
| 296 | 3300050512 | nmdc:mga0n895_35352_c1 | nmdc:mga0n895_35352_c1_3856_4239 | 123 |
| 297 | 3300050512 | nmdc:mga0n895_431419_c1 | nmdc:mga0n895_431419_c1_765_1148 | 123 |
| 298 | 3300050512 | nmdc:mga0n895_44242_c1 | nmdc:mga0n895_44242_c1_564_986 | 123 |
| 299 | 3300050512 | nmdc:mga0n895_890373_c1 | nmdc:mga0n895_890373_c1_145_528 | 123 |
| 300 | 3300050513 | nmdc:mga0rr50_89376_c1 | nmdc:mga0rr50_89376_c1_1574_1957 | 123 |
| 301 | 3300050514 | nmdc:mga08x19_54576_c1 | nmdc:mga08x19_54576_c1_143_526 | 123 |
| 302 | 3300050515 | nmdc:mga0a205_377274_c1 | nmdc:mga0a205_377274_c1_470_853 | 123 |
| 303 | 3300053083 | Ga0495655_0198227 | Ga0495655_0198227_162_545 | 123 |
| 304 | 3300054114 | Ga0501084_1024144 | Ga0501084_1024144_56_436 | 123 |
| 305 | 3300054114 | Ga0501084_1053740 | Ga0501084_1053740_35_418 | 123 |
| 306 | 3300004798 | Ga0058859_11694013 | Ga0058859_116940133 | 124 |
| 307 | 3300005328 | Ga0070676_11313617 | Ga0070676_113136171 | 124 |
| 308 | 3300005340 | Ga0070689_100616796 | Ga0070689_1006167962 | 124 |
| 309 | 3300005341 | Ga0070691_10082304 | Ga0070691_100823043 | 124 |
| 310 | 3300005343 | Ga0070687_100493480 | Ga0070687_1004934802 | 124 |
| 311 | 3300005345 | Ga0070692_10812568 | Ga0070692_108125681 | 124 |
| 312 | 3300005347 | Ga0070668_100691367 | Ga0070668_1006913672 | 124 |
| 313 | 3300005353 | Ga0070669_100053560 | Ga0070669_1000535602 | 124 |
| 314 | 3300005365 | Ga0070688_101379182 | Ga0070688_1013791821 | 124 |
| 315 | 3300005406 | Ga0070703_10033221 | Ga0070703_100332211 | 124 |
| 316 | 3300005438 | Ga0070701_10505983 | Ga0070701_105059832 | 124 |
| 317 | 3300005440 | Ga0070705_100041163 | Ga0070705_1000411632 | 124 |
| 318 | 3300005440 | Ga0070705_101526616 | Ga0070705_1015266161 | 124 |
| 319 | 3300005444 | Ga0070694_100088712 | Ga0070694_1000887123 | 124 |
| 320 | 3300005445 | Ga0070708_100044427 | Ga0070708_1000444274 | 124 |
| 321 | 3300005445 | Ga0070708_100535546 | Ga0070708_1005355462 | 124 |
| 322 | 3300005457 | Ga0070662_100149516 | Ga0070662_1001495162 | 124 |
| 323 | 3300005458 | Ga0070681_10173825 | Ga0070681_101738253 | 124 |
| 324 | 3300005459 | Ga0068867_100261950 | Ga0068867_1002619502 | 124 |
| 325 | 3300005459 | Ga0068867_100845303 | Ga0068867_1008453032 | 124 |
| 326 | 3300005467 | Ga0070706_101523590 | Ga0070706_1015235901 | 124 |
| 327 | 3300005468 | Ga0070707_100022826 | Ga0070707_1000228261 | 124 |
| 328 | 3300005468 | Ga0070707_100357124 | Ga0070707_1003571242 | 124 |
| 329 | 3300005518 | Ga0070699_101658276 | Ga0070699_1016582762 | 124 |
| 330 | 3300005536 | Ga0070697_100006926 | Ga0070697_1000069264 | 124 |
| 331 | 3300005536 | Ga0070697_100081647 | Ga0070697_1000816473 | 124 |
| 332 | 3300005543 | Ga0070672_100017473 | Ga0070672_10001747310 | 124 |
| 333 | 3300005543 | Ga0070672_101126589 | Ga0070672_1011265891 | 124 |
| 334 | 3300005549 | Ga0070704_100050661 | Ga0070704_1000506614 | 124 |
| 335 | 3300005578 | Ga0068854_100460348 | Ga0068854_1004603482 | 124 |
| 336 | 3300005617 | Ga0068859_100380949 | Ga0068859_1003809494 | 124 |
| 337 | 3300005719 | Ga0068861_100569653 | Ga0068861_1005696532 | 124 |
| 338 | 3300005841 | Ga0068863_100247091 | Ga0068863_1002470913 | 124 |
| 339 | 3300005843 | Ga0068860_100118474 | Ga0068860_1001184744 | 124 |
| 340 | 3300005843 | Ga0068860_101098040 | Ga0068860_1010980401 | 124 |
| 341 | 3300005844 | Ga0068862_100088509 | Ga0068862_1000885093 | 124 |
| 342 | 3300005844 | Ga0068862_100484759 | Ga0068862_1004847593 | 124 |
| 343 | 3300005844 | Ga0068862_100567358 | Ga0068862_1005673584 | 124 |
| 344 | 3300006038 | Ga0075365_10303155 | Ga0075365_103031552 | 124 |
| 345 | 3300006844 | Ga0075428_100059180 | Ga0075428_1000591805 | 124 |
| 346 | 3300006844 | Ga0075428_100122430 | Ga0075428_1001224304 | 124 |
| 347 | 3300006847 | Ga0075431_100000559 | Ga0075431_10000055918 | 124 |
| 348 | 3300006847 | Ga0075431_100144024 | Ga0075431_1001440243 | 124 |
| 349 | 3300006852 | Ga0075433_10575211 | Ga0075433_105752113 | 124 |
| 350 | 3300006880 | Ga0075429_100031652 | Ga0075429_1000316526 | 124 |
| 351 | 3300006880 | Ga0075429_100541879 | Ga0075429_1005418791 | 124 |
| 352 | 3300006931 | Ga0097620_100380948 | Ga0097620_1003809484 | 124 |
| 353 | 3300007076 | Ga0075435_100049777 | Ga0075435_1000497774 | 124 |
| 354 | 3300007265 | Ga0099794_10046646 | Ga0099794_100466463 | 124 |
| 355 | 3300009094 | Ga0111539_10166330 | Ga0111539_101663304 | 124 |
| 356 | 3300009094 | Ga0111539_11859785 | Ga0111539_118597853 | 124 |
| 357 | 3300009098 | Ga0105245_13282318 | Ga0105245_132823181 | 124 |
| 358 | 3300009147 | Ga0114129_10048865 | Ga0114129_100488652 | 124 |
| 359 | 3300009147 | Ga0114129_10310164 | Ga0114129_103101644 | 124 |
| 360 | 3300009147 | Ga0114129_11690513 | Ga0114129_116905133 | 124 |
| 361 | 3300009148 | Ga0105243_10099548 | Ga0105243_100995483 | 124 |
| 362 | 3300009174 | Ga0105241_10326078 | Ga0105241_103260783 | 124 |
| 363 | 3300009553 | Ga0105249_10195019 | Ga0105249_101950195 | 124 |
| 364 | 3300009553 | Ga0105249_10567534 | Ga0105249_105675344 | 124 |
| 365 | 3300013306 | Ga0163162_11430973 | Ga0163162_114309731 | 124 |
| 366 | 3300014326 | Ga0157380_10086091 | Ga0157380_100860916 | 124 |
| 367 | 3300014326 | Ga0157380_11724950 | Ga0157380_117249501 | 124 |
| 368 | 3300017792 | Ga0163161_10034313 | Ga0163161_100343134 | 124 |
| 369 | 3300025899 | Ga0207642_10081741 | Ga0207642_100817412 | 124 |
| 370 | 3300025899 | Ga0207642_10379313 | Ga0207642_103793132 | 124 |
| 371 | 3300025911 | Ga0207654_10414559 | Ga0207654_104145593 | 124 |
| 372 | 3300025912 | Ga0207707_10126663 | Ga0207707_101266633 | 124 |
| 373 | 3300025917 | Ga0207660_10014904 | Ga0207660_100149047 | 124 |
| 374 | 3300025918 | Ga0207662_10458235 | Ga0207662_104582352 | 124 |
| 375 | 3300025922 | Ga0207646_10008198 | Ga0207646_100081987 | 124 |
| 376 | 3300025923 | Ga0207681_10006319 | Ga0207681_100063197 | 124 |
| 377 | 3300025923 | Ga0207681_10392587 | Ga0207681_103925873 | 124 |
| 378 | 3300025933 | Ga0207706_10032004 | Ga0207706_100320048 | 124 |
| 379 | 3300025934 | Ga0207686_10969072 | Ga0207686_109690722 | 124 |
| 380 | 3300025935 | Ga0207709_10257932 | Ga0207709_102579324 | 124 |
| 381 | 3300025935 | Ga0207709_10734464 | Ga0207709_107344642 | 124 |
| 382 | 3300025938 | Ga0207704_10437706 | Ga0207704_104377062 | 124 |
| 383 | 3300025940 | Ga0207691_10039365 | Ga0207691_100393653 | 124 |
| 384 | 3300025972 | Ga0207668_10245837 | Ga0207668_102458372 | 124 |
| 385 | 3300026088 | Ga0207641_10083509 | Ga0207641_100835096 | 124 |
| 386 | 3300026089 | Ga0207648_10096337 | Ga0207648_100963373 | 124 |
| 387 | 3300026089 | Ga0207648_10501498 | Ga0207648_105014982 | 124 |
| 388 | 3300026118 | Ga0207675_101123068 | Ga0207675_1011230682 | 124 |
| 389 | 3300027671 | Ga0209588_1054995 | Ga0209588_10549952 | 124 |
| 390 | 3300028380 | Ga0268265_10080941 | Ga0268265_100809413 | 124 |
| 391 | 3300028380 | Ga0268265_10357759 | Ga0268265_103577594 | 124 |
| 392 | 3300028380 | Ga0268265_10417546 | Ga0268265_104175464 | 124 |
| 393 | 3300028380 | Ga0268265_10439776 | Ga0268265_104397763 | 124 |
| 394 | 3300028380 | Ga0268265_10918485 | Ga0268265_109184851 | 124 |
| 395 | 3300028381 | Ga0268264_10107687 | Ga0268264_101076873 | 124 |
| 396 | 3300031548 | Ga0307408_100006038 | Ga0307408_1000060385 | 124 |
| 397 | 3300031731 | Ga0307405_10664932 | Ga0307405_106649322 | 124 |
| 398 | 3300031731 | Ga0307405_11098088 | Ga0307405_110980881 | 124 |
| 399 | 3300031824 | Ga0307413_10220858 | Ga0307413_102208581 | 124 |
| 400 | 3300031901 | Ga0307406_10492724 | Ga0307406_104927243 | 124 |
| 401 | 3300031901 | Ga0307406_11853673 | Ga0307406_118536731 | 124 |
| 402 | 3300031903 | Ga0307407_10521068 | Ga0307407_105210681 | 124 |
| 403 | 3300032002 | Ga0307416_100014518 | Ga0307416_1000145184 | 124 |
| 404 | 3300032005 | Ga0307411_10385887 | Ga0307411_103858873 | 124 |
| 405 | 3300032126 | Ga0307415_100800608 | Ga0307415_1008006081 | 124 |
| 406 | 3300034816 | Ga0373930_0042025 | Ga0373930_0042025_156_572 | 124 |
| 407 | 3300035084 | Ga0373928_0098420 | Ga0373928_0098420_241_675 | 124 |
| 408 | 3300035085 | Ga0373929_0056158 | Ga0373929_0056158_472_888 | 124 |
| 409 | 3300035088 | Ga0373940_0183431 | Ga0373940_0183431_32_448 | 124 |
| 410 | 3300035091 | Ga0373951_0027592 | Ga0373951_0027592_285_701 | 124 |
| 411 | 3300035114 | Ga0373939_0042449 | Ga0373939_0042449_247_663 | 124 |
| 412 | 3300035115 | Ga0373941_0116747 | Ga0373941_0116747_59_475 | 124 |
| 413 | 3300035207 | Ga0373942_0056674 | Ga0373942_0056674_230_646 | 124 |
| 414 | 3300035241 | Ga0373961_0141750 | Ga0373961_0141750_261_677 | 124 |
| 415 | 3300035691 | Ga0373931_0060834 | Ga0373931_0060834_1347_1763 | 124 |
| 416 | 3300042461 | Ga0439460_0179496 | Ga0439460_0179496_105_524 | 124 |
| 417 | 3300044712 | Ga0453684_0505584 | Ga0453684_0505584_32_448 | 124 |
| 418 | 3300045051 | Ga0451576_0934390 | Ga0451576_0934390_159_572 | 124 |
| 419 | 3300046472 | Ga0495580_0000020 | Ga0495580_0000020_78413_78847 | 124 |
| 420 | 3300046525 | Ga0495663_0364140 | Ga0495663_0364140_30_446 | 124 |
| 421 | 3300046684 | Ga0495669_0057655 | Ga0495669_0057655_667_1089 | 124 |
| 422 | 3300048905 | Ga0496102_0008904 | Ga0496102_0008904_1376_1792 | 124 |
| 423 | 3300048909 | Ga0496106_0088560 | Ga0496106_0088560_1344_1760 | 124 |
| 424 | 3300048909 | Ga0496106_0145917 | Ga0496106_0145917_937_1356 | 124 |
| 425 | 3300048909 | Ga0496106_0245610 | Ga0496106_0245610_299_715 | 124 |
| 426 | 3300048910 | Ga0496107_0212305 | Ga0496107_0212305_432_848 | 124 |
| 427 | 3300048913 | Ga0496110_0810117 | Ga0496110_0810117_184_603 | 124 |
| 428 | 3300048917 | Ga0496114_0434360 | Ga0496114_0434360_461_877 | 124 |
| 429 | 3300049129 | Ga0501309_082924 | Ga0501309_082924_24_443 | 124 |
| 430 | 3300049521 | Ga0501298_037609 | Ga0501298_037609_22_441 | 124 |
| 431 | 3300049522 | Ga0501299_076560 | Ga0501299_076560_280_687 | 124 |
| 432 | 3300049570 | Ga0501033_0103166 | Ga0501033_0103166_431_856 | 124 |
| 433 | 3300049570 | Ga0501033_0740766 | Ga0501033_0740766_223_630 | 124 |
| 434 | 3300049572 | Ga0501036_0338873 | Ga0501036_0338873_383_805 | 124 |
| 435 | 3300049573 | Ga0501037_0462587 | Ga0501037_0462587_164_586 | 124 |
| 436 | 3300049575 | Ga0501039_0323329 | Ga0501039_0323329_700_1125 | 124 |
| 437 | 3300049576 | Ga0501040_0028534 | Ga0501040_0028534_2437_2844 | 124 |
| 438 | 3300049576 | Ga0501040_0197689 | Ga0501040_0197689_484_885 | 124 |
| 439 | 3300049577 | Ga0501041_0239340 | Ga0501041_0239340_656_1081 | 124 |
| 440 | 3300049577 | Ga0501041_0473209 | Ga0501041_0473209_267_689 | 124 |
| 441 | 3300049578 | Ga0501042_0090743 | Ga0501042_0090743_971_1372 | 124 |
| 442 | 3300049578 | Ga0501042_0114196 | Ga0501042_0114196_798_1223 | 124 |
| 443 | 3300049578 | Ga0501042_0164575 | Ga0501042_0164575_33_455 | 124 |
| 444 | 3300049578 | Ga0501042_0613445 | Ga0501042_0613445_151_555 | 124 |
| 445 | 3300049579 | Ga0501043_0264946 | Ga0501043_0264946_378_803 | 124 |
| 446 | 3300049580 | Ga0501046_0031144 | Ga0501046_0031144_680_1105 | 124 |
| 447 | 3300049580 | Ga0501046_0272777 | Ga0501046_0272777_539_940 | 124 |
| 448 | 3300049582 | Ga0501048_0098552 | Ga0501048_0098552_584_1009 | 124 |
| 449 | 3300049582 | Ga0501048_0484125 | Ga0501048_0484125_189_590 | 124 |
| 450 | 3300049587 | Ga0501071_0469442 | Ga0501071_0469442_67_492 | 124 |
| 451 | 3300049588 | Ga0501072_0080353 | Ga0501072_0080353_1934_2359 | 124 |
| 452 | 3300049590 | Ga0501074_0057257 | Ga0501074_0057257_808_1233 | 124 |
| 453 | 3300049591 | Ga0501075_0237500 | Ga0501075_0237500_510_932 | 124 |
| 454 | 3300049591 | Ga0501075_0603598 | Ga0501075_0603598_241_648 | 124 |
| 455 | 3300049591 | Ga0501075_1354437 | Ga0501075_1354437_100_513 | 124 |
| 456 | 3300049592 | Ga0501076_0035569 | Ga0501076_0035569_3232_3657 | 124 |
| 457 | 3300049592 | Ga0501076_0154531 | Ga0501076_0154531_382_804 | 124 |
| 458 | 3300049593 | Ga0501077_0007584 | Ga0501077_0007584_3575_4000 | 124 |
| 459 | 3300049593 | Ga0501077_0083282 | Ga0501077_0083282_1053_1475 | 124 |
| 460 | 3300049593 | Ga0501077_0868892 | Ga0501077_0868892_148_549 | 124 |
| 461 | 3300049653 | Ga0501206_037163 | Ga0501206_037163_26_433 | 124 |
| 462 | 3300049741 | Ga0501079_0143613 | Ga0501079_0143613_1195_1620 | 124 |
| 463 | 3300049741 | Ga0501079_0521412 | Ga0501079_0521412_394_816 | 124 |
| 464 | 3300049743 | Ga0501081_0022514 | Ga0501081_0022514_337_762 | 124 |
| 465 | 3300049743 | Ga0501081_0504552 | Ga0501081_0504552_391_792 | 124 |
| 466 | 3300049743 | Ga0501081_0510666 | Ga0501081_0510666_271_672 | 124 |
| 467 | 3300049744 | Ga0501083_0495949 | Ga0501083_0495949_295_720 | 124 |
| 468 | 3300049824 | Ga0501045_0040738 | Ga0501045_0040738_1089_1514 | 124 |
| 469 | 3300049824 | Ga0501045_0100030 | Ga0501045_0100030_467_868 | 124 |
| 470 | 3300049824 | Ga0501045_0155559 | Ga0501045_0155559_461_862 | 124 |
| 471 | 3300050491 | nmdc:mga00v17_194114_c1 | nmdc:mga00v17_194114_c1_800_1183 | 124 |
| 472 | 3300050492 | nmdc:mga0yw44_504814_c1 | nmdc:mga0yw44_504814_c1_214_597 | 124 |
| 473 | 3300050507 | nmdc:mga05p37_36644_c1 | nmdc:mga05p37_36644_c1_5398_5823 | 124 |
| 474 | 3300050507 | nmdc:mga05p37_475287_c1 | nmdc:mga05p37_475287_c1_337_756 | 124 |
| 475 | 3300050507 | nmdc:mga05p37_525833_c1 | nmdc:mga05p37_525833_c1_895_1308 | 124 |
| 476 | 3300050509 | nmdc:mga0qj67_1189581_c1 | nmdc:mga0qj67_1189581_c1_74_499 | 124 |
| 477 | 3300050510 | nmdc:mga06r32_514567_c1 | nmdc:mga06r32_514567_c1_128_553 | 124 |
| 478 | 3300050511 | nmdc:mga08y16_284966_c1 | nmdc:mga08y16_284966_c1_811_1236 | 124 |
| 479 | 3300050512 | nmdc:mga0n895_378731_c1 | nmdc:mga0n895_378731_c1_27_440 | 124 |
| 480 | 3300050513 | nmdc:mga0rr50_1080197_c1 | nmdc:mga0rr50_1080197_c1_45_473 | 124 |
| 481 | 3300050513 | nmdc:mga0rr50_150046_c1 | nmdc:mga0rr50_150046_c1_424_837 | 124 |
| 482 | 3300050514 | nmdc:mga08x19_845467_c1 | nmdc:mga08x19_845467_c1_23_436 | 124 |
| 483 | 3300059424 | Ga0590075_010908 | Ga0590075_010908_905_1321 | 124 |
| 484 | 3300060353 | Ga0501082_0306978 | Ga0501082_0306978_800_1219 | 124 |
| 485 | 3300060353 | Ga0501082_0532868 | Ga0501082_0532868_350_751 | 124 |
| 486 | 3300061734 | Ga0530510_0011866 | Ga0530510_0011866_3430_3855 | 124 |
| 487 | 3300061734 | Ga0530510_0013167 | Ga0530510_0013167_230_652 | 124 |
| 488 | 3300061734 | Ga0530510_0071922 | Ga0530510_0071922_1687_2115 | 124 |
| 489 | 3300061734 | Ga0530510_1252907 | Ga0530510_1252907_81_497 | 124 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6zqf-assembly1.cif.gz_DS | cryo-em structure of the 90s pre-ribosome from saccharomyces cerevisiae, state dis-b (poly-ala) | 0.9451 | 3 | 61 |
| 6rxy-assembly1.cif.gz_Cl | cryo-em structure of the 90s pre-ribosome (kre33-noc4) from chaetomium thermophilum, state a | 0.9339 | 13 | 61 |
| 4cis-assembly1.cif.gz_B | structure of mutm in complex with carbocyclic 8-oxo-g containing dna | 0.9306 | 25 | 60 |
| 1kfv-assembly1.cif.gz_A | crystal structure of lactococcus lactis formamido-pyrimidine dna glycosylase (alias fpg or mutm) non covalently bound to an ap site containing dna. | 0.9268 | 24 | 60 |
| 3gq4-assembly1.cif.gz_A | sequence-matched mutm lesion recognition complex 5 (lrc5) | 0.9195 | 12 | 58 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1i94M01 | Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; | 0.9722 | 14 | 63 | 1.10.8.50 |
| af_P54019_1_77_1.10.8.50 | Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; | 0.9607 | 3 | 61 | 1.10.8.50 |
| af_Q2FW30_1_70_1.10.8.50 | Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; | 0.9457 | 1 | 70 | 1.10.8.50 |
| af_A0A1D8PQQ5_1_82_1.10.8.50 | Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; | 0.9429 | 3 | 61 | 1.10.8.50 |
| af_Q9CA19_32_100_1.10.8.50 | Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; | 0.9411 | 3 | 62 | 1.10.8.50 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3C1LP09-F1-model_v4 | 30S ribosomal protein S13 | 0.9959 | 1 | 62 |
GO:0000731
GO:0003677 GO:0003723 GO:0003735 GO:0005524 GO:0005840 GO:0006261 GO:0006412 GO:0008047 GO:0016887 GO:0017116 GO:1990904 |
| AF-A0A2H9MEC9-F1-model_v4 | 30S ribosomal protein S13 | 0.9867 | 3 | 61 |
GO:0003723
GO:0003735 GO:0005829 GO:0006412 GO:0015935 |
| AF-A0A7C2W8B0-F1-model_v4 | 30S ribosomal protein S13 | 0.9862 | 1 | 63 |
GO:0003723
GO:0003735 GO:0005829 GO:0006412 GO:0015935 |
| AF-A0A356L1I2-F1-model_v4 | 30S ribosomal protein S13 | 0.9859 | 1 | 62 |
GO:0000049
GO:0003735 GO:0005840 GO:0006412 GO:1990904 |
| AF-A0A7C1JM66-F1-model_v4 | 30S ribosomal protein S13 | 0.9854 | 1 | 60 |
GO:0003723
GO:0003735 GO:0005840 GO:0006412 GO:1990904 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar