F453799

General Info

Members Datasets Scaffolds Average Seq Length
489 238 489 128

Family's Representative Sequence

Representative Sequence 3300027907|Ga0207428_10018969|Ga0207428_100189696
Length 113
Sequence MARIAGVDLPQAKMVWVGLTYIYGIGPSRARTILGKAEVGEAVRVKDLTEDVEGDLRKETAQNIKRLMEIGSYRGQRHRRGLPVRGQRTHTNSRTRKGPRGSAVAGKKKATKK

Samples

Sample ID Description Type Environment
1 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
48 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
49 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
50 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
51 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
64 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
76 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
79 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
86 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
119 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
122 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
123 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
124 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
125 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
126 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
127 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
128 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
129 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
130 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
131 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
132 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
133 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
134 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
135 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
136 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
137 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
138 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
139 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
140 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
141 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
142 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
143 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
144 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
145 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
146 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
147 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
148 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
149 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
150 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
151 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
152 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
153 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
154 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
155 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
156 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
157 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
158 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
159 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
160 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
161 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
162 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
163 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
164 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
165 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
166 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
167 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
168 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
169 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
170 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
171 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
172 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
173 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
174 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
175 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
176 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
177 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
178 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
179 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
180 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
181 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
182 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
183 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
184 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
185 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
186 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
187 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
188 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
189 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
190 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
191 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
192 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
193 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
194 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
195 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
208 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
209 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
210 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
211 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
212 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
213 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
214 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
215 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
216 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
217 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
218 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
219 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
220 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
221 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
222 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
223 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
224 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
225 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
226 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
227 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
228 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
229 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
230 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
231 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
232 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
233 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
234 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
235 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
236 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
237 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
238 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.93
Metatranscriptomes 3.07
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.64
Nodule 0
Rhizoplane 2.86
Rhizosphere 94.48
Stem 0
Stem Tuber 0
Unclassified 1.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0058859_11694013 3300004798 Bacteria 1065
2 Ga0065707_10357816 3300005295 Bacteria 908
3 Ga0070676_11313617 3300005328 Bacteria 553
4 Ga0070670_100473795 3300005331 Bacteria 1111
5 Ga0070666_10335049 3300005335 Bacteria 1081
6 Ga0070689_100045106 3300005340 Bacteria 3393
7 Ga0070689_100334614 3300005340 Bacteria 1267
8 Ga0070689_100616796 3300005340 Bacteria 941
9 Ga0070691_10054652 3300005341 Bacteria 1912
10 Ga0070691_10082304 3300005341 Bacteria 1578
11 Ga0070687_100493480 3300005343 Bacteria 823
12 Ga0070692_10812568 3300005345 Bacteria 639
13 Ga0070668_100330308 3300005347 Bacteria 1286
14 Ga0070668_100691367 3300005347 Bacteria 899
15 Ga0070669_100000040 3300005353 Bacteria 130277
16 Ga0070669_100053560 3300005353 Bacteria 2953
17 Ga0070675_100944972 3300005354 Bacteria 791
18 Ga0070674_100909368 3300005356 Bacteria 767
19 Ga0070673_102415976 3300005364 Bacteria 500
20 Ga0070688_101379182 3300005365 Bacteria 571
21 Ga0070703_10033221 3300005406 Bacteria 1570
22 Ga0070703_10115343 3300005406 Bacteria 967
23 Ga0070709_10000076 3300005434 Bacteria 74077
24 Ga0070713_100405506 3300005436 Bacteria 1274
25 Ga0070701_10436839 3300005438 Bacteria 837
26 Ga0070701_10505983 3300005438 Bacteria 785
27 Ga0070705_100041163 3300005440 Bacteria 2632
28 Ga0070705_101526616 3300005440 Bacteria 560
29 Ga0070694_100088712 3300005444 Bacteria 2166
30 Ga0070694_100140367 3300005444 Bacteria 1754
31 Ga0070708_100044427 3300005445 Bacteria 3907
32 Ga0070708_100154649 3300005445 Bacteria 2134
33 Ga0070708_100535546 3300005445 Bacteria 1105
34 Ga0070662_100149516 3300005457 Bacteria 1817
35 Ga0070681_10173825 3300005458 Bacteria 2075
36 Ga0068867_100135410 3300005459 Bacteria 1919
37 Ga0068867_100261950 3300005459 Bacteria 1410
38 Ga0068867_100845303 3300005459 Bacteria 820
39 Ga0070685_10991612 3300005466 Bacteria 630
40 Ga0070685_11138776 3300005466 Bacteria 591
41 Ga0070706_100018387 3300005467 Bacteria 6447
42 Ga0070706_101523590 3300005467 Bacteria 611
43 Ga0070707_100022826 3300005468 Bacteria 5917
44 Ga0070707_100357124 3300005468 Bacteria 1419
45 Ga0070699_100295036 3300005518 Bacteria 1454
46 Ga0070699_100720843 3300005518 Bacteria 911
47 Ga0070699_101658276 3300005518 Bacteria 586
48 Ga0070679_100249628 3300005530 Bacteria 1731
49 Ga0070697_100006926 3300005536 Bacteria 8814
50 Ga0070697_100081647 3300005536 Bacteria 2664
51 Ga0070672_100017473 3300005543 Bacteria 5165
52 Ga0070672_101126589 3300005543 Bacteria 698
53 Ga0070686_100391237 3300005544 Bacteria 1055
54 Ga0070686_101057689 3300005544 Bacteria 668
55 Ga0070695_100027392 3300005545 Bacteria 3529
56 Ga0070695_100053750 3300005545 Bacteria 2590
57 Ga0070695_100633634 3300005545 Bacteria 842
58 Ga0070696_100850264 3300005546 Bacteria 754
59 Ga0070693_100257074 3300005547 Bacteria 1160
60 Ga0070704_100050661 3300005549 Bacteria 2920
61 Ga0068857_101235547 3300005577 Bacteria 724
62 Ga0068854_100460348 3300005578 Bacteria 1064
63 Ga0068852_101489805 3300005616 Bacteria 699
64 Ga0068859_100051052 3300005617 Bacteria 4156
65 Ga0068859_100204669 3300005617 Bacteria 2059
66 Ga0068859_100380949 3300005617 Bacteria 1506
67 Ga0068864_101441096 3300005618 Bacteria 691
68 Ga0068861_100329340 3300005719 Bacteria 1333
69 Ga0068861_100569653 3300005719 Bacteria 1035
70 Ga0068863_100247091 3300005841 Bacteria 1723
71 Ga0068860_100001095 3300005843 Bacteria 29820
72 Ga0068860_100118474 3300005843 Bacteria 2534
73 Ga0068860_101098040 3300005843 Bacteria 815
74 Ga0068862_100075037 3300005844 Bacteria 2924
75 Ga0068862_100088509 3300005844 Bacteria 2694
76 Ga0068862_100484759 3300005844 Bacteria 1171
77 Ga0068862_100567358 3300005844 Bacteria 1086
78 Ga0068862_100651170 3300005844 Bacteria 1016
79 Ga0070717_10169568 3300006028 Bacteria 1898
80 Ga0075365_10303155 3300006038 Bacteria 1124
81 Ga0070715_10875108 3300006163 Bacteria 551
82 Ga0070716_100297026 3300006173 Bacteria 1122
83 Ga0070716_100921549 3300006173 Bacteria 686
84 Ga0075362_10205365 3300006177 Bacteria 960
85 Ga0097621_101643689 3300006237 Bacteria 611
86 Ga0075370_10827939 3300006353 Bacteria 565
87 Ga0075428_100059180 3300006844 Bacteria 4195
88 Ga0075428_100080470 3300006844 Bacteria 3556
89 Ga0075428_100122430 3300006844 Bacteria 2832
90 Ga0075430_101195178 3300006846 Bacteria 626
91 Ga0075431_100000559 3300006847 Bacteria 31330
92 Ga0075431_100000830 3300006847 Bacteria 26982
93 Ga0075431_100054006 3300006847 Bacteria 4143
94 Ga0075431_100144024 3300006847 Bacteria 2456
95 Ga0075433_10000942 3300006852 Bacteria 20529
96 Ga0075433_10113005 3300006852 Bacteria 2409
97 Ga0075433_10142633 3300006852 Bacteria 2129
98 Ga0075433_10272502 3300006852 Bacteria 1500
99 Ga0075433_10575211 3300006852 Bacteria 990
100 Ga0075433_10626555 3300006852 Bacteria 943
101 Ga0075433_10877713 3300006852 Bacteria 783
102 Ga0075433_11012403 3300006852 Bacteria 723
103 Ga0075434_100000540 3300006871 Bacteria 28804
104 Ga0075434_100100485 3300006871 Bacteria 2898
105 Ga0075434_100241265 3300006871 Bacteria 1827
106 Ga0075434_100315706 3300006871 Bacteria 1583
107 Ga0075429_100000958 3300006880 Bacteria 22882
108 Ga0075429_100031652 3300006880 Bacteria 4597
109 Ga0075429_100207508 3300006880 Bacteria 1716
110 Ga0075429_100541879 3300006880 Bacteria 1020
111 Ga0075429_100565322 3300006880 Bacteria 997
112 Ga0075429_100868244 3300006880 Bacteria 790
113 Ga0068865_102146788 3300006881 Bacteria 508
114 Ga0075436_100003766 3300006914 Bacteria 10400
115 Ga0075436_100014542 3300006914 Bacteria 5393
116 Ga0075436_100241891 3300006914 Bacteria 1284
117 Ga0075436_100853593 3300006914 Bacteria 680
118 Ga0097620_100051049 3300006931 Bacteria 4156
119 Ga0097620_100204649 3300006931 Bacteria 2059
120 Ga0097620_100380948 3300006931 Bacteria 1506
121 Ga0075435_100049777 3300007076 Bacteria 3371
122 Ga0075435_100131116 3300007076 Bacteria 2098
123 Ga0075435_100159963 3300007076 Bacteria 1896
124 Ga0075435_100288601 3300007076 Bacteria 1401
125 Ga0075435_101561172 3300007076 Bacteria 579
126 Ga0099794_10016939 3300007265 Bacteria 3240
127 Ga0099794_10046646 3300007265 Bacteria 2076
128 Ga0111539_10001562 3300009094 Bacteria 30480
129 Ga0111539_10166330 3300009094 Bacteria 2578
130 Ga0111539_10198602 3300009094 Bacteria 2339
131 Ga0111539_10678949 3300009094 Bacteria 1199
132 Ga0111539_11859785 3300009094 Bacteria 698
133 Ga0105245_13282318 3300009098 Bacteria 501
134 Ga0114129_10000487 3300009147 Bacteria 47969
135 Ga0114129_10005736 3300009147 Bacteria 17593
136 Ga0114129_10048865 3300009147 Bacteria 5946
137 Ga0114129_10310164 3300009147 Bacteria 2100
138 Ga0114129_10361737 3300009147 Bacteria 1920
139 Ga0114129_10432311 3300009147 Bacteria 1729
140 Ga0114129_10688091 3300009147 Bacteria 1316
141 Ga0114129_10957561 3300009147 Bacteria 1081
142 Ga0114129_11690513 3300009147 Bacteria 772
143 Ga0114129_12929874 3300009147 Bacteria 563
144 Ga0105243_10099548 3300009148 Bacteria 2410
145 Ga0105243_10438078 3300009148 Bacteria 1223
146 Ga0105243_12495547 3300009148 Bacteria 556
147 Ga0105241_10326078 3300009174 Bacteria 1326
148 Ga0105242_10510359 3300009176 Bacteria 1145
149 Ga0105249_10195019 3300009553 Bacteria 1979
150 Ga0105249_10453981 3300009553 Bacteria 1321
151 Ga0105249_10566968 3300009553 Bacteria 1187
152 Ga0105249_10567534 3300009553 Bacteria 1187
153 Ga0105249_11157194 3300009553 Bacteria 844
154 Ga0157378_10072155 3300013297 Bacteria 3102
155 Ga0157378_10238495 3300013297 Bacteria 1736
156 Ga0163162_11430973 3300013306 Bacteria 787
157 Ga0163163_10762127 3300014325 Bacteria 1031
158 Ga0157380_10086091 3300014326 Bacteria 2581
159 Ga0157380_10667205 3300014326 Bacteria 1040
160 Ga0157380_11304113 3300014326 Bacteria 773
161 Ga0157380_11724950 3300014326 Bacteria 684
162 Ga0157377_10277347 3300014745 Bacteria 1097
163 Ga0157377_10441783 3300014745 Bacteria 896
164 Ga0157379_11120482 3300014968 Bacteria 754
165 Ga0163161_10034313 3300017792 Bacteria 3629
166 Ga0197907_10385060 3300020069 Bacteria 738
167 Ga0197907_10393945 3300020069 Bacteria 781
168 Ga0206356_10519156 3300020070 Bacteria 1649
169 Ga0206352_10606892 3300020078 Bacteria 691
170 Ga0206350_10593989 3300020080 Bacteria 1714
171 Ga0206354_11180814 3300020081 Bacteria 737
172 Ga0206353_11994876 3300020082 Bacteria 892
173 Ga0213876_10756303 3300021384 Bacteria 517
174 Ga0207692_10027695 3300025898 Bacteria 2673
175 Ga0207642_10081741 3300025899 Bacteria 1571
176 Ga0207642_10379313 3300025899 Bacteria 841
177 Ga0207699_10000182 3300025906 Bacteria 38240
178 Ga0207645_10711138 3300025907 Bacteria 683
179 Ga0207684_10013113 3300025910 Bacteria 7173
180 Ga0207654_10414559 3300025911 Bacteria 939
181 Ga0207707_10126663 3300025912 Bacteria 2234
182 Ga0207660_10014904 3300025917 Bacteria 5124
183 Ga0207660_10184142 3300025917 Bacteria 1623
184 Ga0207662_10389882 3300025918 Bacteria 942
185 Ga0207662_10458235 3300025918 Bacteria 873
186 Ga0207652_10797988 3300025921 Bacteria 838
187 Ga0207646_10008198 3300025922 Bacteria 10499
188 Ga0207681_10000015 3300025923 Bacteria 352892
189 Ga0207681_10006319 3300025923 Bacteria 7273
190 Ga0207681_10392587 3300025923 Bacteria 1119
191 Ga0207681_10698486 3300025923 Bacteria 843
192 Ga0207681_11234550 3300025923 Bacteria 628
193 Ga0207706_10032004 3300025933 Bacteria 4685
194 Ga0207706_10901376 3300025933 Bacteria 747
195 Ga0207686_10969072 3300025934 Bacteria 689
196 Ga0207709_10257932 3300025935 Bacteria 1277
197 Ga0207709_10734464 3300025935 Bacteria 792
198 Ga0207709_10989971 3300025935 Bacteria 687
199 Ga0207670_10002638 3300025936 Bacteria 9436
200 Ga0207670_10219050 3300025936 Bacteria 1456
201 Ga0207670_10570144 3300025936 Bacteria 927
202 Ga0207704_10437706 3300025938 Bacteria 1040
203 Ga0207704_10536490 3300025938 Bacteria 949
204 Ga0207665_10339790 3300025939 Bacteria 1131
205 Ga0207665_11068361 3300025939 Bacteria 643
206 Ga0207665_11187448 3300025939 Bacteria 609
207 Ga0207691_10039365 3300025940 Bacteria 4374
208 Ga0207689_11496977 3300025942 Bacteria 564
209 Ga0207712_10168100 3300025961 Bacteria 1711
210 Ga0207712_11251387 3300025961 Bacteria 663
211 Ga0207668_10245837 3300025972 Bacteria 1450
212 Ga0207640_10495608 3300025981 Bacteria 1016
213 Ga0207708_10138140 3300026075 Bacteria 1910
214 Ga0207641_10083509 3300026088 Bacteria 2778
215 Ga0207641_12303576 3300026088 Bacteria 538
216 Ga0207648_10096337 3300026089 Bacteria 2589
217 Ga0207648_10501498 3300026089 Bacteria 1111
218 Ga0207676_11344174 3300026095 Bacteria 710
219 Ga0207675_100077523 3300026118 Bacteria 3113
220 Ga0207675_100881889 3300026118 Bacteria 910
221 Ga0207675_100920676 3300026118 Bacteria 891
222 Ga0207675_101123068 3300026118 Bacteria 806
223 Ga0207683_10391721 3300026121 Bacteria 1277
224 Ga0209588_1054995 3300027671 Bacteria 1286
225 Ga0209971_1012896 3300027682 Bacteria 1980
226 Ga0209998_10011435 3300027717 Bacteria 1837
227 Ga0207428_10000095 3300027907 Bacteria 123199
228 Ga0207428_10018969 3300027907 Bacteria 5866
229 Ga0207428_10030020 3300027907 Bacteria 4497
230 Ga0268265_10080941 3300028380 Bacteria 2563
231 Ga0268265_10176968 3300028380 Bacteria 1829
232 Ga0268265_10357759 3300028380 Bacteria 1335
233 Ga0268265_10417546 3300028380 Bacteria 1245
234 Ga0268265_10439776 3300028380 Bacteria 1215
235 Ga0268265_10788541 3300028380 Bacteria 925
236 Ga0268265_10918485 3300028380 Bacteria 860
237 Ga0268265_11250720 3300028380 Bacteria 741
238 Ga0268265_11280811 3300028380 Bacteria 733
239 Ga0268264_10006187 3300028381 Bacteria 10112
240 Ga0268264_10107687 3300028381 Bacteria 2435
241 Ga0268264_10464585 3300028381 Bacteria 1228
242 Ga0268264_11591073 3300028381 Bacteria 664
243 Ga0265319_1051652 3300028563 Bacteria 1355
244 Ga0265338_10013775 3300028800 Bacteria 9086
245 Ga0265338_10083576 3300028800 Bacteria 2670
246 Ga0265338_10262339 3300028800 Bacteria 1269
247 Ga0265762_1031320 3300030760 Bacteria 1011
248 Ga0265770_1008077 3300030878 Bacteria 1493
249 Ga0265765_1040198 3300030879 Unclassified 619
250 Ga0265760_10014127 3300031090 Bacteria 2285
251 Ga0265760_10027358 3300031090 Bacteria 1671
252 Ga0265320_10057274 3300031240 Bacteria 1870
253 Ga0265325_10005096 3300031241 Bacteria 8175
254 Ga0265340_10426111 3300031247 Unclassified 585
255 Ga0265331_10483681 3300031250 Bacteria 557
256 Ga0265316_10526189 3300031344 Bacteria 843
257 Ga0307408_100006038 3300031548 Bacteria 8058
258 Ga0316579_10589494 3300031691 Bacteria 538
259 Ga0316576_10009047 3300031727 Bacteria 6406
260 Ga0316578_10370332 3300031728 Bacteria 851
261 Ga0307405_10664932 3300031731 Bacteria 858
262 Ga0307405_11098088 3300031731 Bacteria 683
263 Ga0307413_10220858 3300031824 Bacteria 1384
264 Ga0307406_10492724 3300031901 Bacteria 992
265 Ga0307406_11853673 3300031901 Bacteria 537
266 Ga0307407_10521068 3300031903 Bacteria 874
267 Ga0307416_100014518 3300032002 Bacteria 5404
268 Ga0307416_101632951 3300032002 Bacteria 750
269 Ga0307416_101720279 3300032002 Bacteria 732
270 Ga0307416_103841409 3300032002 Bacteria 503
271 Ga0307411_10385887 3300032005 Bacteria 1153
272 Ga0307415_100800608 3300032126 Bacteria 860
273 Ga0307415_101643990 3300032126 Bacteria 618
274 Ga0316587_1006542 3300033529 Bacteria 1783
275 Ga0373930_0042025 3300034816 Bacteria 977
276 Ga0373948_0195365 3300034817 Bacteria 525
277 Ga0373938_0163675 3300034957 Bacteria 599
278 Ga0373928_0098420 3300035084 Bacteria 760
279 Ga0373929_0000002 3300035085 Bacteria 683932
280 Ga0373929_0056158 3300035085 Bacteria 911
281 Ga0373940_0183431 3300035088 Bacteria 681
282 Ga0373949_0103414 3300035090 Bacteria 783
283 Ga0373951_0027592 3300035091 Bacteria 1326
284 Ga0373952_0029614 3300035092 Bacteria 1208
285 Ga0373932_0109838 3300035112 Bacteria 907
286 Ga0373939_0042449 3300035114 Bacteria 1375
287 Ga0373939_0149833 3300035114 Bacteria 848
288 Ga0373939_0418183 3300035114 Bacteria 558
289 Ga0373941_0116747 3300035115 Bacteria 947
290 Ga0373960_0458417 3300035121 Bacteria 501
291 Ga0373942_0056674 3300035207 Bacteria 1113
292 Ga0373942_0165841 3300035207 Bacteria 717
293 Ga0373961_0096676 3300035241 Bacteria 951
294 Ga0373961_0141750 3300035241 Bacteria 813
295 Ga0373962_0157815 3300035242 Bacteria 747
296 Ga0316574_0737456 3300035398 Bacteria 602
297 Ga0373931_0060834 3300035691 Bacteria 2035
298 Ga0373931_0147774 3300035691 Bacteria 1367
299 Ga0373931_0428683 3300035691 Bacteria 842
300 Ga0436365_0483746 3300039437 Bacteria 716
301 Ga0436365_1145587 3300039437 Bacteria 1542
302 Ga0451804_0227137 3300041463 Bacteria 698
303 Ga0451807_0219658 3300041486 Bacteria 891
304 Ga0451849_1569559 3300041505 Bacteria 1151
305 Ga0439460_0179496 3300042461 Bacteria 715
306 Ga0451577_0008521 3300042876 Bacteria 9973
307 Ga0451577_0074792 3300042876 Bacteria 3021
308 Ga0451577_0128474 3300042876 Bacteria 2272
309 Ga0451577_0164698 3300042876 Bacteria 1997
310 Ga0453683_0284141 3300044673 Bacteria 1057
311 Ga0466963_0760677 3300044694 Bacteria 683
312 Ga0453684_0015628 3300044712 Bacteria 11973
313 Ga0453684_0102461 3300044712 Bacteria 3500
314 Ga0453684_0397698 3300044712 Bacteria 1544
315 Ga0453684_0447373 3300044712 Bacteria 1439
316 Ga0453684_0505584 3300044712 Bacteria 1337
317 Ga0453684_0516244 3300044712 Bacteria 1321
318 Ga0451576_0073213 3300045051 Bacteria 3565
319 Ga0451576_0934390 3300045051 Bacteria 910
320 Ga0451576_0962207 3300045051 Bacteria 895
321 Ga0451576_1256499 3300045051 Bacteria 772
322 Ga0495638_0000070 3300046460 Bacteria 166954
323 Ga0495580_0000020 3300046472 Bacteria 91314
324 Ga0495605_0316014 3300046474 Bacteria 659
325 Ga0495584_0239393 3300046491 Bacteria 923
326 Ga0495663_0364140 3300046525 Bacteria 528
327 Ga0495642_0018331 3300046528 Bacteria 2740
328 Ga0495642_0101210 3300046528 Bacteria 1226
329 Ga0495654_0054197 3300046530 Bacteria 1946
330 Ga0495633_0307512 3300046558 Bacteria 720
331 Ga0495669_0057655 3300046684 Bacteria 1752
332 Ga0495636_0083167 3300047318 Bacteria 1381
333 Ga0495685_075047 3300047447 Bacteria 1130
334 Ga0496102_0008904 3300048905 Bacteria 8613
335 Ga0496106_0088560 3300048909 Bacteria 2386
336 Ga0496106_0145917 3300048909 Bacteria 1864
337 Ga0496106_0245610 3300048909 Bacteria 1430
338 Ga0496106_1098350 3300048909 Bacteria 623
339 Ga0496107_0212305 3300048910 Bacteria 1439
340 Ga0496108_1104141 3300048911 Bacteria 674
341 Ga0496110_0810117 3300048913 Bacteria 841
342 Ga0496111_0552800 3300048914 Bacteria 845
343 Ga0496113_0449860 3300048916 Bacteria 1035
344 Ga0496114_0434360 3300048917 Bacteria 1163
345 Ga0496115_0961042 3300048918 Bacteria 655
346 Ga0501309_082924 3300049129 Bacteria 539
347 Ga0501298_037609 3300049521 Bacteria 972
348 Ga0501299_076560 3300049522 Bacteria 736
349 Ga0501031_0509644 3300049568 Bacteria 776
350 Ga0501033_0103166 3300049570 Bacteria 2080
351 Ga0501033_0740766 3300049570 Bacteria 667
352 Ga0501034_0344808 3300049571 Bacteria 1419
353 Ga0501036_0338873 3300049572 Bacteria 1256
354 Ga0501037_0462587 3300049573 Bacteria 864
355 Ga0501039_0323329 3300049575 Bacteria 1212
356 Ga0501039_0450898 3300049575 Bacteria 1010
357 Ga0501040_0028534 3300049576 Bacteria 3763
358 Ga0501040_0197689 3300049576 Bacteria 1427
359 Ga0501041_0239340 3300049577 Bacteria 1140
360 Ga0501041_0473209 3300049577 Bacteria 796
361 Ga0501041_0676366 3300049577 Bacteria 660
362 Ga0501041_0715964 3300049577 Bacteria 641
363 Ga0501042_0090743 3300049578 Bacteria 2193
364 Ga0501042_0114196 3300049578 Bacteria 1944
365 Ga0501042_0164575 3300049578 Bacteria 1600
366 Ga0501042_0613445 3300049578 Bacteria 791
367 Ga0501043_0264946 3300049579 Bacteria 1320
368 Ga0501046_0031144 3300049580 Bacteria 4327
369 Ga0501046_0272777 3300049580 Bacteria 1240
370 Ga0501046_0386879 3300049580 Bacteria 1012
371 Ga0501048_0098552 3300049582 Bacteria 2062
372 Ga0501048_0207923 3300049582 Bacteria 1388
373 Ga0501048_0361217 3300049582 Bacteria 1036
374 Ga0501048_0484125 3300049582 Bacteria 887
375 Ga0501068_0306383 3300049584 Bacteria 1017
376 Ga0501068_0834259 3300049584 Bacteria 605
377 Ga0501071_0469442 3300049587 Bacteria 964
378 Ga0501072_0080353 3300049588 Bacteria 2583
379 Ga0501072_0083794 3300049588 Bacteria 2527
380 Ga0501072_0711407 3300049588 Bacteria 789
381 Ga0501072_1164017 3300049588 Bacteria 599
382 Ga0501073_1159050 3300049589 Bacteria 531
383 Ga0501074_0057257 3300049590 Bacteria 2808
384 Ga0501074_0106046 3300049590 Bacteria 2012
385 Ga0501074_0498271 3300049590 Bacteria 863
386 Ga0501075_0237500 3300049591 Bacteria 1389
387 Ga0501075_0325766 3300049591 Bacteria 1171
388 Ga0501075_0463076 3300049591 Bacteria 967
389 Ga0501075_0603598 3300049591 Bacteria 837
390 Ga0501075_0826462 3300049591 Bacteria 705
391 Ga0501075_0936432 3300049591 Bacteria 658
392 Ga0501075_1354437 3300049591 Bacteria 539
393 Ga0501076_0035569 3300049592 Bacteria 3896
394 Ga0501076_0055917 3300049592 Bacteria 3130
395 Ga0501076_0154531 3300049592 Bacteria 1867
396 Ga0501076_1811873 3300049592 Bacteria 500
397 Ga0501077_0007584 3300049593 Bacteria 6697
398 Ga0501077_0083282 3300049593 Bacteria 2027
399 Ga0501077_0159248 3300049593 Bacteria 1433
400 Ga0501077_0267093 3300049593 Bacteria 1088
401 Ga0501077_0868892 3300049593 Bacteria 580
402 Ga0501206_037163 3300049653 Bacteria 741
403 Ga0501079_0143613 3300049741 Bacteria 1859
404 Ga0501079_0193171 3300049741 Bacteria 1589
405 Ga0501079_0521412 3300049741 Bacteria 934
406 Ga0501079_0595766 3300049741 Bacteria 870
407 Ga0501081_0022514 3300049743 Bacteria 4217
408 Ga0501081_0229160 3300049743 Bacteria 1352
409 Ga0501081_0287292 3300049743 Bacteria 1205
410 Ga0501081_0504552 3300049743 Bacteria 902
411 Ga0501081_0510666 3300049743 Bacteria 896
412 Ga0501081_1476616 3300049743 Bacteria 516
413 Ga0501083_0495949 3300049744 Bacteria 795
414 Ga0501083_0885527 3300049744 Bacteria 581
415 Ga0501045_0040738 3300049824 Bacteria 3379
416 Ga0501045_0100030 3300049824 Bacteria 2146
417 Ga0501045_0155559 3300049824 Bacteria 1701
418 Ga0501045_0921272 3300049824 Bacteria 642
419 Ga0501045_0958904 3300049824 Bacteria 628
420 nmdc:mga03n38_704014_c1 3300050490 Bacteria 582
421 nmdc:mga00v17_194114_c1 3300050491 Bacteria 1312
422 nmdc:mga0yw44_504814_c1 3300050492 Bacteria 821
423 nmdc:mga07m45_621918_c1 3300050496 Bacteria 623
424 nmdc:mga05p37_1175160_c1 3300050507 Bacteria 795
425 nmdc:mga05p37_265117_c1 3300050507 Bacteria 2054
426 nmdc:mga05p37_34830_c1 3300050507 Bacteria 6168
427 nmdc:mga05p37_36644_c1 3300050507 Bacteria 6016
428 nmdc:mga05p37_475287_c1 3300050507 Bacteria 1441
429 nmdc:mga05p37_525833_c1 3300050507 Bacteria 1352
430 nmdc:mga05p37_534460_c1 3300050507 Bacteria 1338
431 nmdc:mga09592_228394_c1 3300050508 Bacteria 1612
432 nmdc:mga09592_3243_c1 3300050508 Bacteria 13156
433 nmdc:mga09592_565813_c1 3300050508 Bacteria 976
434 nmdc:mga09592_745271_c1 3300050508 Bacteria 831
435 nmdc:mga09592_85366_c1 3300050508 Bacteria 2693
436 nmdc:mga0qj67_1189581_c1 3300050509 Bacteria 593
437 nmdc:mga0qj67_271462_c1 3300050509 Bacteria 1375
438 nmdc:mga0qj67_541240_c1 3300050509 Bacteria 934
439 nmdc:mga06r32_1854711_c1 3300050510 Bacteria 538
440 nmdc:mga06r32_514567_c1 3300050510 Bacteria 1173
441 nmdc:mga06r32_772581_c1 3300050510 Bacteria 923
442 nmdc:mga06r32_9698_c1 3300050510 Bacteria 8699
443 nmdc:mga08y16_108447_c1 3300050511 Bacteria 2891
444 nmdc:mga08y16_284966_c1 3300050511 Bacteria 1704
445 nmdc:mga08y16_4138_c1 3300050511 Bacteria 15145
446 nmdc:mga08y16_49297_c1 3300050511 Bacteria 4408
447 nmdc:mga0n895_141118_c1 3300050512 Bacteria 2438
448 nmdc:mga0n895_35352_c1 3300050512 Bacteria 4817
449 nmdc:mga0n895_378731_c1 3300050512 Bacteria 1432
450 nmdc:mga0n895_431419_c1 3300050512 Bacteria 1332
451 nmdc:mga0n895_44242_c1 3300050512 Bacteria 4342
452 nmdc:mga0n895_52788_c1 3300050512 Bacteria 3992
453 nmdc:mga0n895_6339_c1 3300050512 Bacteria 10036
454 nmdc:mga0n895_890373_c1 3300050512 Bacteria 876
455 nmdc:mga0rr50_1080197_c1 3300050513 Bacteria 683
456 nmdc:mga0rr50_120876_c1 3300050513 Bacteria 2085
457 nmdc:mga0rr50_150046_c1 3300050513 Bacteria 1883
458 nmdc:mga0rr50_167846_c1 3300050513 Bacteria 1786
459 nmdc:mga0rr50_47202_c1 3300050513 Bacteria 3175
460 nmdc:mga0rr50_89376_c1 3300050513 Bacteria 2395
461 nmdc:mga08x19_332653_c1 3300050514 Bacteria 1058
462 nmdc:mga08x19_48403_c1 3300050514 Bacteria 2724
463 nmdc:mga08x19_501432_c1 3300050514 Bacteria 857
464 nmdc:mga08x19_54576_c1 3300050514 Bacteria 2573
465 nmdc:mga08x19_845467_c1 3300050514 Bacteria 650
466 nmdc:mga0a205_127636_c2 3300050515 Bacteria 1472
467 nmdc:mga0a205_166956_c1 3300050515 Bacteria 2097
468 nmdc:mga0a205_196758_c1 3300050515 Bacteria 1907
469 nmdc:mga0a205_2218_c1 3300050515 Bacteria 17084
470 nmdc:mga0a205_244674_c1 3300050515 Bacteria 1674
471 nmdc:mga0a205_377274_c1 3300050515 Bacteria 1283
472 Ga0495655_0198227 3300053083 Bacteria 655
473 Ga0500622_0463227 3300053156 Bacteria 502
474 Ga0501084_0145080 3300054114 Bacteria 1999
475 Ga0501084_0438205 3300054114 Bacteria 1105
476 Ga0501084_1024144 3300054114 Bacteria 694
477 Ga0501084_1053740 3300054114 Bacteria 683
478 Ga0590075_010908 3300059424 Bacteria 2192
479 Ga0501082_0306978 3300060353 Bacteria 1382
480 Ga0501082_0460501 3300060353 Bacteria 1111
481 Ga0501082_0532868 3300060353 Bacteria 1027
482 Ga0501082_0533543 3300060353 Bacteria 1026
483 Ga0530510_0003221 3300061734 Bacteria 11210
484 Ga0530510_0011866 3300061734 Bacteria 6113
485 Ga0530510_0013167 3300061734 Bacteria 5817
486 Ga0530510_0071922 3300061734 Bacteria 2511
487 Ga0530510_0085710 3300061734 Bacteria 2295
488 Ga0530510_0727795 3300061734 Bacteria 756
489 Ga0530510_1252907 3300061734 Bacteria 569

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049743 Ga0501081_1476616 Ga0501081_1476616_24_401 107
2 3300027907 Ga0207428_10018969 Ga0207428_100189696 109
3 3300049591 Ga0501075_0325766 Ga0501075_0325766_16_399 109
4 3300050511 nmdc:mga08y16_108447_c1 nmdc:mga08y16_108447_c1_888_1271 109
5 3300039437 Ga0436365_1145587 Ga0436365_1145587_27_371 110
6 3300035398 Ga0316574_0737456 Ga0316574_0737456_226_570 114
7 3300046460 Ga0495638_0000070 Ga0495638_0000070_84994_85380 114
8 3300028380 Ga0268265_11280811 Ga0268265_112808113 115
9 3300050507 nmdc:mga05p37_34830_c1 nmdc:mga05p37_34830_c1_3214_3633 115
10 3300050508 nmdc:mga09592_3243_c1 nmdc:mga09592_3243_c1_1015_1434 115
11 3300050510 nmdc:mga06r32_772581_c1 nmdc:mga06r32_772581_c1_57_476 115
12 3300050512 nmdc:mga0n895_6339_c1 nmdc:mga0n895_6339_c1_5683_6102 115
13 3300050513 nmdc:mga0rr50_120876_c1 nmdc:mga0rr50_120876_c1_1410_1829 115
14 3300050514 nmdc:mga08x19_501432_c1 nmdc:mga08x19_501432_c1_24_443 115
15 3300050515 nmdc:mga0a205_2218_c1 nmdc:mga0a205_2218_c1_3935_4354 115
16 3300050515 nmdc:mga0a205_127636_c2 nmdc:mga0a205_127636_c2_851_1267 116
17 3300009147 Ga0114129_10000487 Ga0114129_1000048741 118
18 3300049582 Ga0501048_0361217 Ga0501048_0361217_120_515 118
19 3300049584 Ga0501068_0306383 Ga0501068_0306383_491_886 118
20 3300049588 Ga0501072_0711407 Ga0501072_0711407_187_594 118
21 3300049590 Ga0501074_0498271 Ga0501074_0498271_261_656 118
22 3300049591 Ga0501075_0826462 Ga0501075_0826462_248_655 118
23 3300049593 Ga0501077_0159248 Ga0501077_0159248_919_1326 118
24 3300049593 Ga0501077_0267093 Ga0501077_0267093_37_432 118
25 3300049741 Ga0501079_0193171 Ga0501079_0193171_1069_1464 118
26 3300049824 Ga0501045_0958904 Ga0501045_0958904_109_504 118
27 3300050508 nmdc:mga09592_565813_c1 nmdc:mga09592_565813_c1_567_962 118
28 3300054114 Ga0501084_0438205 Ga0501084_0438205_19_414 118
29 3300060353 Ga0501082_0460501 Ga0501082_0460501_482_889 118
30 3300061734 Ga0530510_0003221 Ga0530510_0003221_3396_3803 118
31 3300061734 Ga0530510_0727795 Ga0530510_0727795_32_427 118
32 3300006846 Ga0075430_101195178 Ga0075430_1011951782 119
33 3300009147 Ga0114129_10361737 Ga0114129_103617374 119
34 3300050507 nmdc:mga05p37_1175160_c1 nmdc:mga05p37_1175160_c1_188_601 119
35 3300050509 nmdc:mga0qj67_541240_c1 nmdc:mga0qj67_541240_c1_40_453 119
36 3300006852 Ga0075433_10626555 Ga0075433_106265552 120
37 3300009094 Ga0111539_10001562 Ga0111539_1000156210 120
38 3300027907 Ga0207428_10000095 Ga0207428_1000009526 120
39 3300050490 nmdc:mga03n38_704014_c1 nmdc:mga03n38_704014_c1_91_459 120
40 3300050511 nmdc:mga08y16_49297_c1 nmdc:mga08y16_49297_c1_1049_1480 120
41 3300050515 nmdc:mga0a205_244674_c1 nmdc:mga0a205_244674_c1_366_797 120
42 3300005331 Ga0070670_100473795 Ga0070670_1004737953 121
43 3300005347 Ga0070668_100330308 Ga0070668_1003303083 121
44 3300005530 Ga0070679_100249628 Ga0070679_1002496282 121
45 3300005545 Ga0070695_100053750 Ga0070695_1000537504 121
46 3300006847 Ga0075431_100054006 Ga0075431_1000540066 121
47 3300006852 Ga0075433_10000942 Ga0075433_1000094215 121
48 3300006852 Ga0075433_10113005 Ga0075433_101130053 121
49 3300006871 Ga0075434_100000540 Ga0075434_10000054012 121
50 3300006871 Ga0075434_100315706 Ga0075434_1003157063 121
51 3300006880 Ga0075429_100000958 Ga0075429_10000095822 121
52 3300006914 Ga0075436_100241891 Ga0075436_1002418912 121
53 3300009147 Ga0114129_10005736 Ga0114129_1000573611 121
54 3300014745 Ga0157377_10441783 Ga0157377_104417832 121
55 3300025921 Ga0207652_10797988 Ga0207652_107979882 121
56 3300025961 Ga0207712_11251387 Ga0207712_112513872 121
57 3300026095 Ga0207676_11344174 Ga0207676_113441742 121
58 3300026118 Ga0207675_100077523 Ga0207675_1000775236 121
59 3300027907 Ga0207428_10030020 Ga0207428_100300205 121
60 3300032002 Ga0307416_103841409 Ga0307416_1038414091 121
61 3300032126 Ga0307415_101643990 Ga0307415_1016439901 121
62 3300042876 Ga0451577_0164698 Ga0451577_0164698_1260_1628 121
63 3300046474 Ga0495605_0316014 Ga0495605_0316014_152_586 121
64 3300046528 Ga0495642_0018331 Ga0495642_0018331_2173_2598 121
65 3300046530 Ga0495654_0054197 Ga0495654_0054197_402_776 121
66 3300049568 Ga0501031_0509644 Ga0501031_0509644_312_734 121
67 3300049575 Ga0501039_0450898 Ga0501039_0450898_46_468 121
68 3300049582 Ga0501048_0207923 Ga0501048_0207923_934_1356 121
69 3300049588 Ga0501072_0083794 Ga0501072_0083794_215_637 121
70 3300049589 Ga0501073_1159050 Ga0501073_1159050_63_491 121
71 3300049590 Ga0501074_0106046 Ga0501074_0106046_420_842 121
72 3300049592 Ga0501076_0055917 Ga0501076_0055917_243_665 121
73 3300049743 Ga0501081_0287292 Ga0501081_0287292_657_1085 121
74 3300050509 nmdc:mga0qj67_271462_c1 nmdc:mga0qj67_271462_c1_299_724 121
75 3300050511 nmdc:mga08y16_4138_c1 nmdc:mga08y16_4138_c1_6478_6903 121
76 3300050512 nmdc:mga0n895_52788_c1 nmdc:mga0n895_52788_c1_3377_3799 121
77 3300050513 nmdc:mga0rr50_167846_c1 nmdc:mga0rr50_167846_c1_1187_1609 121
78 3300050515 nmdc:mga0a205_166956_c1 nmdc:mga0a205_166956_c1_799_1221 121
79 3300053156 Ga0500622_0463227 Ga0500622_0463227_100_468 121
80 3300054114 Ga0501084_0145080 Ga0501084_0145080_974_1396 121
81 3300060353 Ga0501082_0533543 Ga0501082_0533543_310_732 121
82 3300061734 Ga0530510_0085710 Ga0530510_0085710_627_1049 121
83 3300005295 Ga0065707_10357816 Ga0065707_103578162 122
84 3300006852 Ga0075433_10142633 Ga0075433_101426334 122
85 3300006852 Ga0075433_11012403 Ga0075433_110124032 122
86 3300006871 Ga0075434_100241265 Ga0075434_1002412653 122
87 3300006914 Ga0075436_100014542 Ga0075436_10001454210 122
88 3300006914 Ga0075436_100853593 Ga0075436_1008535931 122
89 3300007076 Ga0075435_100131116 Ga0075435_1001311163 122
90 3300007076 Ga0075435_100159963 Ga0075435_1001599633 122
91 3300007265 Ga0099794_10016939 Ga0099794_100169396 122
92 3300009147 Ga0114129_10688091 Ga0114129_106880913 122
93 3300013297 Ga0157378_10072155 Ga0157378_100721556 122
94 3300020069 Ga0197907_10385060 Ga0197907_103850601 122
95 3300020069 Ga0197907_10393945 Ga0197907_103939452 122
96 3300020070 Ga0206356_10519156 Ga0206356_105191562 122
97 3300020078 Ga0206352_10606892 Ga0206352_106068922 122
98 3300020080 Ga0206350_10593989 Ga0206350_105939893 122
99 3300020081 Ga0206354_11180814 Ga0206354_111808142 122
100 3300020082 Ga0206353_11994876 Ga0206353_119948762 122
101 3300025923 Ga0207681_10698486 Ga0207681_106984862 122
102 3300025938 Ga0207704_10536490 Ga0207704_105364902 122
103 3300028381 Ga0268264_10464585 Ga0268264_104645853 122
104 3300031691 Ga0316579_10589494 Ga0316579_105894941 122
105 3300031727 Ga0316576_10009047 Ga0316576_100090473 122
106 3300031728 Ga0316578_10370332 Ga0316578_103703322 122
107 3300035090 Ga0373949_0103414 Ga0373949_0103414_211_645 122
108 3300035092 Ga0373952_0029614 Ga0373952_0029614_218_652 122
109 3300035112 Ga0373932_0109838 Ga0373932_0109838_436_870 122
110 3300035114 Ga0373939_0418183 Ga0373939_0418183_82_516 122
111 3300035691 Ga0373931_0147774 Ga0373931_0147774_664_1098 122
112 3300042876 Ga0451577_0128474 Ga0451577_0128474_1078_1512 122
113 3300044673 Ga0453683_0284141 Ga0453683_0284141_183_554 122
114 3300044694 Ga0466963_0760677 Ga0466963_0760677_37_414 122
115 3300044712 Ga0453684_0447373 Ga0453684_0447373_112_546 122
116 3300044712 Ga0453684_0516244 Ga0453684_0516244_258_626 122
117 3300045051 Ga0451576_0073213 Ga0451576_0073213_2843_3277 122
118 3300045051 Ga0451576_1256499 Ga0451576_1256499_50_484 122
119 3300046491 Ga0495584_0239393 Ga0495584_0239393_292_717 122
120 3300046528 Ga0495642_0101210 Ga0495642_0101210_501_935 122
121 3300046558 Ga0495633_0307512 Ga0495633_0307512_178_612 122
122 3300047318 Ga0495636_0083167 Ga0495636_0083167_765_1193 122
123 3300048909 Ga0496106_1098350 Ga0496106_1098350_120_554 122
124 3300049584 Ga0501068_0834259 Ga0501068_0834259_110_484 122
125 3300049591 Ga0501075_0936432 Ga0501075_0936432_55_432 122
126 3300050507 nmdc:mga05p37_265117_c1 nmdc:mga05p37_265117_c1_1256_1690 122
127 3300050508 nmdc:mga09592_228394_c1 nmdc:mga09592_228394_c1_959_1393 122
128 3300050512 nmdc:mga0n895_141118_c1 nmdc:mga0n895_141118_c1_1346_1780 122
129 3300050513 nmdc:mga0rr50_47202_c1 nmdc:mga0rr50_47202_c1_149_583 122
130 3300050514 nmdc:mga08x19_332653_c1 nmdc:mga08x19_332653_c1_147_581 122
131 3300050514 nmdc:mga08x19_48403_c1 nmdc:mga08x19_48403_c1_19_450 122
132 3300050515 nmdc:mga0a205_196758_c1 nmdc:mga0a205_196758_c1_1393_1827 122
133 3300005335 Ga0070666_10335049 Ga0070666_103350491 123
134 3300005340 Ga0070689_100045106 Ga0070689_1000451064 123
135 3300005340 Ga0070689_100334614 Ga0070689_1003346142 123
136 3300005341 Ga0070691_10054652 Ga0070691_100546522 123
137 3300005353 Ga0070669_100000040 Ga0070669_10000004026 123
138 3300005354 Ga0070675_100944972 Ga0070675_1009449721 123
139 3300005356 Ga0070674_100909368 Ga0070674_1009093682 123
140 3300005364 Ga0070673_102415976 Ga0070673_1024159761 123
141 3300005406 Ga0070703_10115343 Ga0070703_101153431 123
142 3300005434 Ga0070709_10000076 Ga0070709_1000007650 123
143 3300005436 Ga0070713_100405506 Ga0070713_1004055062 123
144 3300005438 Ga0070701_10436839 Ga0070701_104368391 123
145 3300005444 Ga0070694_100140367 Ga0070694_1001403673 123
146 3300005445 Ga0070708_100154649 Ga0070708_1001546493 123
147 3300005459 Ga0068867_100135410 Ga0068867_1001354104 123
148 3300005466 Ga0070685_10991612 Ga0070685_109916122 123
149 3300005466 Ga0070685_11138776 Ga0070685_111387761 123
150 3300005467 Ga0070706_100018387 Ga0070706_1000183877 123
151 3300005518 Ga0070699_100295036 Ga0070699_1002950362 123
152 3300005518 Ga0070699_100720843 Ga0070699_1007208432 123
153 3300005544 Ga0070686_100391237 Ga0070686_1003912372 123
154 3300005544 Ga0070686_101057689 Ga0070686_1010576891 123
155 3300005545 Ga0070695_100027392 Ga0070695_1000273923 123
156 3300005545 Ga0070695_100633634 Ga0070695_1006336342 123
157 3300005546 Ga0070696_100850264 Ga0070696_1008502642 123
158 3300005547 Ga0070693_100257074 Ga0070693_1002570741 123
159 3300005577 Ga0068857_101235547 Ga0068857_1012355472 123
160 3300005616 Ga0068852_101489805 Ga0068852_1014898052 123
161 3300005617 Ga0068859_100051052 Ga0068859_1000510526 123
162 3300005617 Ga0068859_100204669 Ga0068859_1002046694 123
163 3300005618 Ga0068864_101441096 Ga0068864_1014410963 123
164 3300005719 Ga0068861_100329340 Ga0068861_1003293404 123
165 3300005843 Ga0068860_100001095 Ga0068860_10000109526 123
166 3300005844 Ga0068862_100075037 Ga0068862_1000750373 123
167 3300005844 Ga0068862_100651170 Ga0068862_1006511702 123
168 3300006028 Ga0070717_10169568 Ga0070717_101695683 123
169 3300006163 Ga0070715_10875108 Ga0070715_108751082 123
170 3300006173 Ga0070716_100297026 Ga0070716_1002970262 123
171 3300006173 Ga0070716_100921549 Ga0070716_1009215492 123
172 3300006177 Ga0075362_10205365 Ga0075362_102053652 123
173 3300006237 Ga0097621_101643689 Ga0097621_1016436892 123
174 3300006353 Ga0075370_10827939 Ga0075370_108279392 123
175 3300006844 Ga0075428_100080470 Ga0075428_1000804705 123
176 3300006847 Ga0075431_100000830 Ga0075431_10000083014 123
177 3300006852 Ga0075433_10272502 Ga0075433_102725021 123
178 3300006852 Ga0075433_10877713 Ga0075433_108777131 123
179 3300006871 Ga0075434_100100485 Ga0075434_1001004855 123
180 3300006880 Ga0075429_100207508 Ga0075429_1002075083 123
181 3300006880 Ga0075429_100565322 Ga0075429_1005653222 123
182 3300006880 Ga0075429_100868244 Ga0075429_1008682442 123
183 3300006881 Ga0068865_102146788 Ga0068865_1021467881 123
184 3300006914 Ga0075436_100003766 Ga0075436_10000376622 123
185 3300006931 Ga0097620_100051049 Ga0097620_1000510496 123
186 3300006931 Ga0097620_100204649 Ga0097620_1002046494 123
187 3300007076 Ga0075435_100288601 Ga0075435_1002886014 123
188 3300007076 Ga0075435_101561172 Ga0075435_1015611721 123
189 3300009094 Ga0111539_10198602 Ga0111539_101986021 123
190 3300009094 Ga0111539_10678949 Ga0111539_106789491 123
191 3300009147 Ga0114129_10432311 Ga0114129_104323112 123
192 3300009147 Ga0114129_10957561 Ga0114129_109575612 123
193 3300009147 Ga0114129_12929874 Ga0114129_129298742 123
194 3300009148 Ga0105243_10438078 Ga0105243_104380783 123
195 3300009148 Ga0105243_12495547 Ga0105243_124955472 123
196 3300009176 Ga0105242_10510359 Ga0105242_105103594 123
197 3300009553 Ga0105249_10453981 Ga0105249_104539813 123
198 3300009553 Ga0105249_10566968 Ga0105249_105669685 123
199 3300009553 Ga0105249_11157194 Ga0105249_111571942 123
200 3300013297 Ga0157378_10238495 Ga0157378_102384953 123
201 3300014325 Ga0163163_10762127 Ga0163163_107621272 123
202 3300014326 Ga0157380_10667205 Ga0157380_106672052 123
203 3300014326 Ga0157380_11304113 Ga0157380_113041132 123
204 3300014745 Ga0157377_10277347 Ga0157377_102773471 123
205 3300014968 Ga0157379_11120482 Ga0157379_111204822 123
206 3300021384 Ga0213876_10756303 Ga0213876_107563031 123
207 3300025898 Ga0207692_10027695 Ga0207692_100276951 123
208 3300025906 Ga0207699_10000182 Ga0207699_1000018226 123
209 3300025907 Ga0207645_10711138 Ga0207645_107111381 123
210 3300025910 Ga0207684_10013113 Ga0207684_100131135 123
211 3300025917 Ga0207660_10184142 Ga0207660_101841423 123
212 3300025918 Ga0207662_10389882 Ga0207662_103898822 123
213 3300025923 Ga0207681_10000015 Ga0207681_10000015273 123
214 3300025923 Ga0207681_11234550 Ga0207681_112345501 123
215 3300025933 Ga0207706_10901376 Ga0207706_109013762 123
216 3300025935 Ga0207709_10989971 Ga0207709_109899712 123
217 3300025936 Ga0207670_10002638 Ga0207670_100026387 123
218 3300025936 Ga0207670_10219050 Ga0207670_102190502 123
219 3300025936 Ga0207670_10570144 Ga0207670_105701442 123
220 3300025939 Ga0207665_10339790 Ga0207665_103397902 123
221 3300025939 Ga0207665_11068361 Ga0207665_110683611 123
222 3300025939 Ga0207665_11187448 Ga0207665_111874482 123
223 3300025942 Ga0207689_11496977 Ga0207689_114969771 123
224 3300025961 Ga0207712_10168100 Ga0207712_101681003 123
225 3300025981 Ga0207640_10495608 Ga0207640_104956082 123
226 3300026075 Ga0207708_10138140 Ga0207708_101381403 123
227 3300026088 Ga0207641_12303576 Ga0207641_123035761 123
228 3300026118 Ga0207675_100881889 Ga0207675_1008818893 123
229 3300026118 Ga0207675_100920676 Ga0207675_1009206762 123
230 3300026121 Ga0207683_10391721 Ga0207683_103917212 123
231 3300027682 Ga0209971_1012896 Ga0209971_10128963 123
232 3300027717 Ga0209998_10011435 Ga0209998_100114352 123
233 3300028380 Ga0268265_10176968 Ga0268265_101769682 123
234 3300028380 Ga0268265_10788541 Ga0268265_107885412 123
235 3300028380 Ga0268265_11250720 Ga0268265_112507202 123
236 3300028381 Ga0268264_10006187 Ga0268264_1000618720 123
237 3300028381 Ga0268264_11591073 Ga0268264_115910731 123
238 3300028563 Ga0265319_1051652 Ga0265319_10516522 123
239 3300028800 Ga0265338_10013775 Ga0265338_100137754 123
240 3300028800 Ga0265338_10083576 Ga0265338_100835762 123
241 3300028800 Ga0265338_10262339 Ga0265338_102623391 123
242 3300030760 Ga0265762_1031320 Ga0265762_10313202 123
243 3300030878 Ga0265770_1008077 Ga0265770_10080772 123
244 3300030879 Ga0265765_1040198 Ga0265765_10401982 123
245 3300031090 Ga0265760_10014127 Ga0265760_100141272 123
246 3300031090 Ga0265760_10027358 Ga0265760_100273582 123
247 3300031240 Ga0265320_10057274 Ga0265320_100572744 123
248 3300031241 Ga0265325_10005096 Ga0265325_1000509610 123
249 3300031247 Ga0265340_10426111 Ga0265340_104261112 123
250 3300031250 Ga0265331_10483681 Ga0265331_104836812 123
251 3300031344 Ga0265316_10526189 Ga0265316_105261891 123
252 3300032002 Ga0307416_101632951 Ga0307416_1016329512 123
253 3300032002 Ga0307416_101720279 Ga0307416_1017202793 123
254 3300033529 Ga0316587_1006542 Ga0316587_10065423 123
255 3300034817 Ga0373948_0195365 Ga0373948_0195365_63_479 123
256 3300034957 Ga0373938_0163675 Ga0373938_0163675_41_424 123
257 3300035085 Ga0373929_0000002 Ga0373929_0000002_185096_185479 123
258 3300035114 Ga0373939_0149833 Ga0373939_0149833_373_792 123
259 3300035121 Ga0373960_0458417 Ga0373960_0458417_61_444 123
260 3300035207 Ga0373942_0165841 Ga0373942_0165841_16_435 123
261 3300035241 Ga0373961_0096676 Ga0373961_0096676_29_448 123
262 3300035242 Ga0373962_0157815 Ga0373962_0157815_159_542 123
263 3300035691 Ga0373931_0428683 Ga0373931_0428683_21_404 123
264 3300039437 Ga0436365_0483746 Ga0436365_0483746_302_685 123
265 3300041463 Ga0451804_0227137 Ga0451804_0227137_14_397 123
266 3300041486 Ga0451807_0219658 Ga0451807_0219658_385_768 123
267 3300041505 Ga0451849_1569559 Ga0451849_1569559_137_520 123
268 3300042876 Ga0451577_0008521 Ga0451577_0008521_3823_4212 123
269 3300042876 Ga0451577_0074792 Ga0451577_0074792_2406_2789 123
270 3300044712 Ga0453684_0015628 Ga0453684_0015628_10803_11192 123
271 3300044712 Ga0453684_0102461 Ga0453684_0102461_761_1144 123
272 3300044712 Ga0453684_0397698 Ga0453684_0397698_414_806 123
273 3300045051 Ga0451576_0962207 Ga0451576_0962207_476_868 123
274 3300047447 Ga0495685_075047 Ga0495685_075047_282_698 123
275 3300048911 Ga0496108_1104141 Ga0496108_1104141_34_417 123
276 3300048914 Ga0496111_0552800 Ga0496111_0552800_423_806 123
277 3300048916 Ga0496113_0449860 Ga0496113_0449860_466_849 123
278 3300048918 Ga0496115_0961042 Ga0496115_0961042_102_488 123
279 3300049571 Ga0501034_0344808 Ga0501034_0344808_331_714 123
280 3300049577 Ga0501041_0676366 Ga0501041_0676366_18_398 123
281 3300049577 Ga0501041_0715964 Ga0501041_0715964_71_454 123
282 3300049580 Ga0501046_0386879 Ga0501046_0386879_543_926 123
283 3300049588 Ga0501072_1164017 Ga0501072_1164017_26_409 123
284 3300049591 Ga0501075_0463076 Ga0501075_0463076_438_818 123
285 3300049592 Ga0501076_1811873 Ga0501076_1811873_80_463 123
286 3300049741 Ga0501079_0595766 Ga0501079_0595766_398_778 123
287 3300049743 Ga0501081_0229160 Ga0501081_0229160_590_973 123
288 3300049744 Ga0501083_0885527 Ga0501083_0885527_18_401 123
289 3300049824 Ga0501045_0921272 Ga0501045_0921272_105_488 123
290 3300050496 nmdc:mga07m45_621918_c1 nmdc:mga07m45_621918_c1_80_463 123
291 3300050507 nmdc:mga05p37_534460_c1 nmdc:mga05p37_534460_c1_135_518 123
292 3300050508 nmdc:mga09592_745271_c1 nmdc:mga09592_745271_c1_289_672 123
293 3300050508 nmdc:mga09592_85366_c1 nmdc:mga09592_85366_c1_2033_2416 123
294 3300050510 nmdc:mga06r32_1854711_c1 nmdc:mga06r32_1854711_c1_131_514 123
295 3300050510 nmdc:mga06r32_9698_c1 nmdc:mga06r32_9698_c1_754_1137 123
296 3300050512 nmdc:mga0n895_35352_c1 nmdc:mga0n895_35352_c1_3856_4239 123
297 3300050512 nmdc:mga0n895_431419_c1 nmdc:mga0n895_431419_c1_765_1148 123
298 3300050512 nmdc:mga0n895_44242_c1 nmdc:mga0n895_44242_c1_564_986 123
299 3300050512 nmdc:mga0n895_890373_c1 nmdc:mga0n895_890373_c1_145_528 123
300 3300050513 nmdc:mga0rr50_89376_c1 nmdc:mga0rr50_89376_c1_1574_1957 123
301 3300050514 nmdc:mga08x19_54576_c1 nmdc:mga08x19_54576_c1_143_526 123
302 3300050515 nmdc:mga0a205_377274_c1 nmdc:mga0a205_377274_c1_470_853 123
303 3300053083 Ga0495655_0198227 Ga0495655_0198227_162_545 123
304 3300054114 Ga0501084_1024144 Ga0501084_1024144_56_436 123
305 3300054114 Ga0501084_1053740 Ga0501084_1053740_35_418 123
306 3300004798 Ga0058859_11694013 Ga0058859_116940133 124
307 3300005328 Ga0070676_11313617 Ga0070676_113136171 124
308 3300005340 Ga0070689_100616796 Ga0070689_1006167962 124
309 3300005341 Ga0070691_10082304 Ga0070691_100823043 124
310 3300005343 Ga0070687_100493480 Ga0070687_1004934802 124
311 3300005345 Ga0070692_10812568 Ga0070692_108125681 124
312 3300005347 Ga0070668_100691367 Ga0070668_1006913672 124
313 3300005353 Ga0070669_100053560 Ga0070669_1000535602 124
314 3300005365 Ga0070688_101379182 Ga0070688_1013791821 124
315 3300005406 Ga0070703_10033221 Ga0070703_100332211 124
316 3300005438 Ga0070701_10505983 Ga0070701_105059832 124
317 3300005440 Ga0070705_100041163 Ga0070705_1000411632 124
318 3300005440 Ga0070705_101526616 Ga0070705_1015266161 124
319 3300005444 Ga0070694_100088712 Ga0070694_1000887123 124
320 3300005445 Ga0070708_100044427 Ga0070708_1000444274 124
321 3300005445 Ga0070708_100535546 Ga0070708_1005355462 124
322 3300005457 Ga0070662_100149516 Ga0070662_1001495162 124
323 3300005458 Ga0070681_10173825 Ga0070681_101738253 124
324 3300005459 Ga0068867_100261950 Ga0068867_1002619502 124
325 3300005459 Ga0068867_100845303 Ga0068867_1008453032 124
326 3300005467 Ga0070706_101523590 Ga0070706_1015235901 124
327 3300005468 Ga0070707_100022826 Ga0070707_1000228261 124
328 3300005468 Ga0070707_100357124 Ga0070707_1003571242 124
329 3300005518 Ga0070699_101658276 Ga0070699_1016582762 124
330 3300005536 Ga0070697_100006926 Ga0070697_1000069264 124
331 3300005536 Ga0070697_100081647 Ga0070697_1000816473 124
332 3300005543 Ga0070672_100017473 Ga0070672_10001747310 124
333 3300005543 Ga0070672_101126589 Ga0070672_1011265891 124
334 3300005549 Ga0070704_100050661 Ga0070704_1000506614 124
335 3300005578 Ga0068854_100460348 Ga0068854_1004603482 124
336 3300005617 Ga0068859_100380949 Ga0068859_1003809494 124
337 3300005719 Ga0068861_100569653 Ga0068861_1005696532 124
338 3300005841 Ga0068863_100247091 Ga0068863_1002470913 124
339 3300005843 Ga0068860_100118474 Ga0068860_1001184744 124
340 3300005843 Ga0068860_101098040 Ga0068860_1010980401 124
341 3300005844 Ga0068862_100088509 Ga0068862_1000885093 124
342 3300005844 Ga0068862_100484759 Ga0068862_1004847593 124
343 3300005844 Ga0068862_100567358 Ga0068862_1005673584 124
344 3300006038 Ga0075365_10303155 Ga0075365_103031552 124
345 3300006844 Ga0075428_100059180 Ga0075428_1000591805 124
346 3300006844 Ga0075428_100122430 Ga0075428_1001224304 124
347 3300006847 Ga0075431_100000559 Ga0075431_10000055918 124
348 3300006847 Ga0075431_100144024 Ga0075431_1001440243 124
349 3300006852 Ga0075433_10575211 Ga0075433_105752113 124
350 3300006880 Ga0075429_100031652 Ga0075429_1000316526 124
351 3300006880 Ga0075429_100541879 Ga0075429_1005418791 124
352 3300006931 Ga0097620_100380948 Ga0097620_1003809484 124
353 3300007076 Ga0075435_100049777 Ga0075435_1000497774 124
354 3300007265 Ga0099794_10046646 Ga0099794_100466463 124
355 3300009094 Ga0111539_10166330 Ga0111539_101663304 124
356 3300009094 Ga0111539_11859785 Ga0111539_118597853 124
357 3300009098 Ga0105245_13282318 Ga0105245_132823181 124
358 3300009147 Ga0114129_10048865 Ga0114129_100488652 124
359 3300009147 Ga0114129_10310164 Ga0114129_103101644 124
360 3300009147 Ga0114129_11690513 Ga0114129_116905133 124
361 3300009148 Ga0105243_10099548 Ga0105243_100995483 124
362 3300009174 Ga0105241_10326078 Ga0105241_103260783 124
363 3300009553 Ga0105249_10195019 Ga0105249_101950195 124
364 3300009553 Ga0105249_10567534 Ga0105249_105675344 124
365 3300013306 Ga0163162_11430973 Ga0163162_114309731 124
366 3300014326 Ga0157380_10086091 Ga0157380_100860916 124
367 3300014326 Ga0157380_11724950 Ga0157380_117249501 124
368 3300017792 Ga0163161_10034313 Ga0163161_100343134 124
369 3300025899 Ga0207642_10081741 Ga0207642_100817412 124
370 3300025899 Ga0207642_10379313 Ga0207642_103793132 124
371 3300025911 Ga0207654_10414559 Ga0207654_104145593 124
372 3300025912 Ga0207707_10126663 Ga0207707_101266633 124
373 3300025917 Ga0207660_10014904 Ga0207660_100149047 124
374 3300025918 Ga0207662_10458235 Ga0207662_104582352 124
375 3300025922 Ga0207646_10008198 Ga0207646_100081987 124
376 3300025923 Ga0207681_10006319 Ga0207681_100063197 124
377 3300025923 Ga0207681_10392587 Ga0207681_103925873 124
378 3300025933 Ga0207706_10032004 Ga0207706_100320048 124
379 3300025934 Ga0207686_10969072 Ga0207686_109690722 124
380 3300025935 Ga0207709_10257932 Ga0207709_102579324 124
381 3300025935 Ga0207709_10734464 Ga0207709_107344642 124
382 3300025938 Ga0207704_10437706 Ga0207704_104377062 124
383 3300025940 Ga0207691_10039365 Ga0207691_100393653 124
384 3300025972 Ga0207668_10245837 Ga0207668_102458372 124
385 3300026088 Ga0207641_10083509 Ga0207641_100835096 124
386 3300026089 Ga0207648_10096337 Ga0207648_100963373 124
387 3300026089 Ga0207648_10501498 Ga0207648_105014982 124
388 3300026118 Ga0207675_101123068 Ga0207675_1011230682 124
389 3300027671 Ga0209588_1054995 Ga0209588_10549952 124
390 3300028380 Ga0268265_10080941 Ga0268265_100809413 124
391 3300028380 Ga0268265_10357759 Ga0268265_103577594 124
392 3300028380 Ga0268265_10417546 Ga0268265_104175464 124
393 3300028380 Ga0268265_10439776 Ga0268265_104397763 124
394 3300028380 Ga0268265_10918485 Ga0268265_109184851 124
395 3300028381 Ga0268264_10107687 Ga0268264_101076873 124
396 3300031548 Ga0307408_100006038 Ga0307408_1000060385 124
397 3300031731 Ga0307405_10664932 Ga0307405_106649322 124
398 3300031731 Ga0307405_11098088 Ga0307405_110980881 124
399 3300031824 Ga0307413_10220858 Ga0307413_102208581 124
400 3300031901 Ga0307406_10492724 Ga0307406_104927243 124
401 3300031901 Ga0307406_11853673 Ga0307406_118536731 124
402 3300031903 Ga0307407_10521068 Ga0307407_105210681 124
403 3300032002 Ga0307416_100014518 Ga0307416_1000145184 124
404 3300032005 Ga0307411_10385887 Ga0307411_103858873 124
405 3300032126 Ga0307415_100800608 Ga0307415_1008006081 124
406 3300034816 Ga0373930_0042025 Ga0373930_0042025_156_572 124
407 3300035084 Ga0373928_0098420 Ga0373928_0098420_241_675 124
408 3300035085 Ga0373929_0056158 Ga0373929_0056158_472_888 124
409 3300035088 Ga0373940_0183431 Ga0373940_0183431_32_448 124
410 3300035091 Ga0373951_0027592 Ga0373951_0027592_285_701 124
411 3300035114 Ga0373939_0042449 Ga0373939_0042449_247_663 124
412 3300035115 Ga0373941_0116747 Ga0373941_0116747_59_475 124
413 3300035207 Ga0373942_0056674 Ga0373942_0056674_230_646 124
414 3300035241 Ga0373961_0141750 Ga0373961_0141750_261_677 124
415 3300035691 Ga0373931_0060834 Ga0373931_0060834_1347_1763 124
416 3300042461 Ga0439460_0179496 Ga0439460_0179496_105_524 124
417 3300044712 Ga0453684_0505584 Ga0453684_0505584_32_448 124
418 3300045051 Ga0451576_0934390 Ga0451576_0934390_159_572 124
419 3300046472 Ga0495580_0000020 Ga0495580_0000020_78413_78847 124
420 3300046525 Ga0495663_0364140 Ga0495663_0364140_30_446 124
421 3300046684 Ga0495669_0057655 Ga0495669_0057655_667_1089 124
422 3300048905 Ga0496102_0008904 Ga0496102_0008904_1376_1792 124
423 3300048909 Ga0496106_0088560 Ga0496106_0088560_1344_1760 124
424 3300048909 Ga0496106_0145917 Ga0496106_0145917_937_1356 124
425 3300048909 Ga0496106_0245610 Ga0496106_0245610_299_715 124
426 3300048910 Ga0496107_0212305 Ga0496107_0212305_432_848 124
427 3300048913 Ga0496110_0810117 Ga0496110_0810117_184_603 124
428 3300048917 Ga0496114_0434360 Ga0496114_0434360_461_877 124
429 3300049129 Ga0501309_082924 Ga0501309_082924_24_443 124
430 3300049521 Ga0501298_037609 Ga0501298_037609_22_441 124
431 3300049522 Ga0501299_076560 Ga0501299_076560_280_687 124
432 3300049570 Ga0501033_0103166 Ga0501033_0103166_431_856 124
433 3300049570 Ga0501033_0740766 Ga0501033_0740766_223_630 124
434 3300049572 Ga0501036_0338873 Ga0501036_0338873_383_805 124
435 3300049573 Ga0501037_0462587 Ga0501037_0462587_164_586 124
436 3300049575 Ga0501039_0323329 Ga0501039_0323329_700_1125 124
437 3300049576 Ga0501040_0028534 Ga0501040_0028534_2437_2844 124
438 3300049576 Ga0501040_0197689 Ga0501040_0197689_484_885 124
439 3300049577 Ga0501041_0239340 Ga0501041_0239340_656_1081 124
440 3300049577 Ga0501041_0473209 Ga0501041_0473209_267_689 124
441 3300049578 Ga0501042_0090743 Ga0501042_0090743_971_1372 124
442 3300049578 Ga0501042_0114196 Ga0501042_0114196_798_1223 124
443 3300049578 Ga0501042_0164575 Ga0501042_0164575_33_455 124
444 3300049578 Ga0501042_0613445 Ga0501042_0613445_151_555 124
445 3300049579 Ga0501043_0264946 Ga0501043_0264946_378_803 124
446 3300049580 Ga0501046_0031144 Ga0501046_0031144_680_1105 124
447 3300049580 Ga0501046_0272777 Ga0501046_0272777_539_940 124
448 3300049582 Ga0501048_0098552 Ga0501048_0098552_584_1009 124
449 3300049582 Ga0501048_0484125 Ga0501048_0484125_189_590 124
450 3300049587 Ga0501071_0469442 Ga0501071_0469442_67_492 124
451 3300049588 Ga0501072_0080353 Ga0501072_0080353_1934_2359 124
452 3300049590 Ga0501074_0057257 Ga0501074_0057257_808_1233 124
453 3300049591 Ga0501075_0237500 Ga0501075_0237500_510_932 124
454 3300049591 Ga0501075_0603598 Ga0501075_0603598_241_648 124
455 3300049591 Ga0501075_1354437 Ga0501075_1354437_100_513 124
456 3300049592 Ga0501076_0035569 Ga0501076_0035569_3232_3657 124
457 3300049592 Ga0501076_0154531 Ga0501076_0154531_382_804 124
458 3300049593 Ga0501077_0007584 Ga0501077_0007584_3575_4000 124
459 3300049593 Ga0501077_0083282 Ga0501077_0083282_1053_1475 124
460 3300049593 Ga0501077_0868892 Ga0501077_0868892_148_549 124
461 3300049653 Ga0501206_037163 Ga0501206_037163_26_433 124
462 3300049741 Ga0501079_0143613 Ga0501079_0143613_1195_1620 124
463 3300049741 Ga0501079_0521412 Ga0501079_0521412_394_816 124
464 3300049743 Ga0501081_0022514 Ga0501081_0022514_337_762 124
465 3300049743 Ga0501081_0504552 Ga0501081_0504552_391_792 124
466 3300049743 Ga0501081_0510666 Ga0501081_0510666_271_672 124
467 3300049744 Ga0501083_0495949 Ga0501083_0495949_295_720 124
468 3300049824 Ga0501045_0040738 Ga0501045_0040738_1089_1514 124
469 3300049824 Ga0501045_0100030 Ga0501045_0100030_467_868 124
470 3300049824 Ga0501045_0155559 Ga0501045_0155559_461_862 124
471 3300050491 nmdc:mga00v17_194114_c1 nmdc:mga00v17_194114_c1_800_1183 124
472 3300050492 nmdc:mga0yw44_504814_c1 nmdc:mga0yw44_504814_c1_214_597 124
473 3300050507 nmdc:mga05p37_36644_c1 nmdc:mga05p37_36644_c1_5398_5823 124
474 3300050507 nmdc:mga05p37_475287_c1 nmdc:mga05p37_475287_c1_337_756 124
475 3300050507 nmdc:mga05p37_525833_c1 nmdc:mga05p37_525833_c1_895_1308 124
476 3300050509 nmdc:mga0qj67_1189581_c1 nmdc:mga0qj67_1189581_c1_74_499 124
477 3300050510 nmdc:mga06r32_514567_c1 nmdc:mga06r32_514567_c1_128_553 124
478 3300050511 nmdc:mga08y16_284966_c1 nmdc:mga08y16_284966_c1_811_1236 124
479 3300050512 nmdc:mga0n895_378731_c1 nmdc:mga0n895_378731_c1_27_440 124
480 3300050513 nmdc:mga0rr50_1080197_c1 nmdc:mga0rr50_1080197_c1_45_473 124
481 3300050513 nmdc:mga0rr50_150046_c1 nmdc:mga0rr50_150046_c1_424_837 124
482 3300050514 nmdc:mga08x19_845467_c1 nmdc:mga08x19_845467_c1_23_436 124
483 3300059424 Ga0590075_010908 Ga0590075_010908_905_1321 124
484 3300060353 Ga0501082_0306978 Ga0501082_0306978_800_1219 124
485 3300060353 Ga0501082_0532868 Ga0501082_0532868_350_751 124
486 3300061734 Ga0530510_0011866 Ga0530510_0011866_3430_3855 124
487 3300061734 Ga0530510_0013167 Ga0530510_0013167_230_652 124
488 3300061734 Ga0530510_0071922 Ga0530510_0071922_1687_2115 124
489 3300061734 Ga0530510_1252907 Ga0530510_1252907_81_497 124

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00416

Ribosomal_S13

Ribosomal protein S13/S18

3

52

0.98

PF00416

Ribosomal_S13

Ribosomal protein S13/S18

49

95

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6zqf-assembly1.cif.gz_DS cryo-em structure of the 90s pre-ribosome from saccharomyces cerevisiae, state dis-b (poly-ala) 0.9451 3 61
6rxy-assembly1.cif.gz_Cl cryo-em structure of the 90s pre-ribosome (kre33-noc4) from chaetomium thermophilum, state a 0.9339 13 61
4cis-assembly1.cif.gz_B structure of mutm in complex with carbocyclic 8-oxo-g containing dna 0.9306 25 60
1kfv-assembly1.cif.gz_A crystal structure of lactococcus lactis formamido-pyrimidine dna glycosylase (alias fpg or mutm) non covalently bound to an ap site containing dna. 0.9268 24 60
3gq4-assembly1.cif.gz_A sequence-matched mutm lesion recognition complex 5 (lrc5) 0.9195 12 58
ID Description Score Start End Superfamily
1i94M01 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.9722 14 63 1.10.8.50
af_P54019_1_77_1.10.8.50 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.9607 3 61 1.10.8.50
af_Q2FW30_1_70_1.10.8.50 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.9457 1 70 1.10.8.50
af_A0A1D8PQQ5_1_82_1.10.8.50 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.9429 3 61 1.10.8.50
af_Q9CA19_32_100_1.10.8.50 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.9411 3 62 1.10.8.50

Feature Viewer

pLDDT pTM Quality
78.27 0.57 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map