metagRoot

F453773

General Info

Members	Datasets	Scaffolds	Average Seq Length
489	306	463	132

Family's Representative Sequence

Representative Sequence	3300009177\|Ga0105248_12027787\|Ga0105248_120277871
Length	131
Sequence	MTKHMDINLPDVLAEVTAAFERYETALVGNDVAVLDELFWDSPHTLRYGVTENLYGYEEIRSFRAGRSSLGLQRALLRRVITTYGRDFATANVEFQRTGNGKTGRQSQTWMRTPEGWRVVCAHVSLLSPPS

Samples

	Sample ID	Description	Type	Environment
1	2513237101	Bradyrhizobium murdochi WSM1741	Isolate	Nodule
2	2513237141	Bradyrhizobium sp. TV2a.2	Isolate	Nodule
3	2524023210	Bradyrhizobium sp. Ai1a-2	Isolate	Nodule
4	2667528175	Rhizobium tropici NFR14	Isolate	Rhizoplane
5	2791355197	Bradyrhizobium sp. C9	Isolate	Nodule
6	2829745981	Methylorubrum rhodinum DSM 2163	Isolate	Rhizosphere
7	2847930680	Bradyrhizobium zhanjiangense CCBAU 51778	Isolate	Unclassified
8	2874620515	Bradyrhizobium nanningense CCBAU 53390	Isolate	Unclassified
9	2879083081	Bradyrhizobium zhanjiangense CCBAU 51787	Isolate	Unclassified
10	2885383462	Bradyrhizobium sp. Leo170	Isolate	Unclassified
11	2903748898	Bradyrhizobium uaiense UFLA 03-164	Isolate	Nodule
12	2903768456	Bradyrhizobium sp. Leo121	Isolate	Unclassified
13	2904666416	Bradyrhizobium nanningense CCBAU 51757	Isolate	Unclassified
14	2904690495	Bradyrhizobium ivorense CI-1B	Isolate	Nodule
15	2908756301	Bradyrhizobium ivorense CI-41S	Isolate	Nodule
16	2935630451	Bradyrhizobium sp. I1.14.4	Isolate	Nodule
17	2935959822	Bradyrhizobium sp. F1.4.3	Isolate	Nodule
18	2941507105	Bradyrhizobium sp. i1.12.3	Isolate	Nodule
19	2941515067	Bradyrhizobium sp. i1.14.1	Isolate	Nodule
20	2941523033	Bradyrhizobium sp. i1.8.4	Isolate	Nodule
21	3005474847	Bradyrhizobium sp. CCBAU 53421	Isolate	Nodule
22	3300003214	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL	Metagenome	Endosphere
23	3300003659	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
24	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
25	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
26	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
27	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
28	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
29	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
30	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
31	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
32	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
33	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
34	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
35	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
36	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
37	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
38	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
39	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
40	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
41	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
42	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
43	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
44	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
45	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
46	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
47	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
48	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
49	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
50	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
51	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
52	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
53	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
54	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
55	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
56	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
57	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
58	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
59	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
60	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
61	3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
62	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
63	3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Metagenome	Rhizosphere
64	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
65	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
66	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
67	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
68	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
69	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
70	3300006941	Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW	Metagenome	Nodule
71	3300006942	Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW	Metagenome	Nodule
72	3300006944	Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW	Metagenome	Nodule
73	3300007265	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1	Metagenome	Rhizosphere
74	3300007788	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2	Metagenome	Rhizosphere
75	3300009011	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG	Metagenome	Rhizosphere
76	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
77	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
78	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
79	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
80	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
81	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
82	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
83	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
84	3300010159	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3	Metagenome	Rhizosphere
85	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
86	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
87	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
88	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
89	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
90	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
91	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
92	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
93	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
94	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
95	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
96	3300015262	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG	Metagenome	Rhizosphere
97	3300021361	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2	Metagenome	Rhizosphere
98	3300021377	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7	Metagenome	Unclassified
99	3300021388	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8	Metagenome	Unclassified
100	3300021441	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1	Metagenome	Rhizosphere
101	3300025253	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
102	3300025261	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2)	Metagenome	Endosphere
103	3300025272	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
104	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
105	3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
106	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
107	3300025905	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
108	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
109	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
110	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
111	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
112	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
113	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
135	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
136	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
137	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
138	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
139	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
140	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
141	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
142	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
143	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
144	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
145	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
146	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
147	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
148	3300027296	Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2)	Metagenome	Nodule
149	3300027361	Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2)	Metagenome	Nodule
150	3300027363	Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2)	Metagenome	Nodule
151	3300027512	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2)	Metagenome	Rhizosphere
152	3300027671	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2)	Metagenome	Rhizosphere
153	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
154	3300031239	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG	Metagenome	Rhizosphere
155	3300031247	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG	Metagenome	Rhizosphere
156	3300031250	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG	Metagenome	Rhizosphere
157	3300031507	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM	Metagenome	Unclassified
158	3300031616	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM	Metagenome	Unclassified
159	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
160	3300031712	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG	Metagenome	Rhizosphere
161	3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Metagenome	Unclassified
162	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
163	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
164	3300035083	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17	Metagenome	Rhizosphere
165	3300035086	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4	Metagenome	Rhizosphere
166	3300035111	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11	Metagenome	Rhizosphere
167	3300035113	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12	Metagenome	Rhizosphere
168	3300035116	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3	Metagenome	Rhizosphere
169	3300035117	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1	Metagenome	Rhizosphere
170	3300035118	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2	Metagenome	Rhizosphere
171	3300035119	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4	Metagenome	Rhizosphere
172	3300035120	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5	Metagenome	Rhizosphere
173	3300035170	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1	Metagenome	Rhizosphere
174	3300035171	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4	Metagenome	Rhizosphere
175	3300035172	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3	Metagenome	Rhizosphere
176	3300035207	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16	Metagenome	Rhizosphere
177	3300035410	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12	Metagenome	Rhizosphere
178	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
179	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
180	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
181	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
182	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
183	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
184	3300036459	Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome)	Metatranscriptome	Unclassified
185	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
186	3300037853	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2	Metagenome	Unclassified
187	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
188	3300039438	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2	Metagenome	Rhizosphere
189	3300039447	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2	Metagenome	Rhizosphere
190	3300039450	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2	Metagenome	Unclassified
191	3300039453	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2	Metagenome	Rhizosphere
192	3300041456	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG	Metagenome	Rhizoplane
193	3300041496	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG	Metagenome	Unclassified
194	3300041512	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG	Metagenome	Unclassified
195	3300042000	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539	Metagenome	Rhizosphere
196	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
197	3300044735	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R	Metagenome	Rhizosphere
198	3300044765	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R	Metagenome	Rhizosphere
199	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
200	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
201	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
202	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
203	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
204	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
205	3300046461	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere	Metagenome	Rhizosphere
206	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
207	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
208	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
209	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
210	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
211	3300046476	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere	Metagenome	Rhizosphere
212	3300046477	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere	Metagenome	Rhizosphere
213	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
214	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
215	3300046514	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere	Metagenome	Rhizosphere
216	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
217	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
218	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
219	3300046530	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere	Metagenome	Rhizosphere
220	3300046531	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere	Metagenome	Rhizosphere
221	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
222	3300046535	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere	Metagenome	Rhizosphere
223	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
224	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
225	3300046557	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere	Metagenome	Rhizosphere
226	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
227	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
228	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
229	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
230	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
231	3300046678	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere	Metagenome	Rhizosphere
232	3300046679	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere	Metagenome	Rhizosphere
233	3300046680	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere	Metagenome	Rhizosphere
234	3300046681	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere	Metagenome	Rhizosphere
235	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
236	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
237	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
238	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
239	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
240	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
241	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
242	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
243	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
244	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
245	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
246	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
247	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
248	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
249	3300048089	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere	Metagenome	Rhizosphere
250	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
251	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
252	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
253	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
254	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
255	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
256	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
257	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
258	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
259	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
260	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
261	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
262	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
263	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
264	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
265	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
266	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
267	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
268	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
269	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
270	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
271	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
272	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
273	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
274	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
275	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
276	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
277	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
278	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
279	3300053078	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere	Metagenome	Rhizosphere
280	3300053079	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere	Metagenome	Endosphere
281	3300053084	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere	Metagenome	Rhizosphere
282	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
283	3300053109	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere	Metagenome	Endosphere
284	3300053111	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere	Metagenome	Endosphere
285	3300053119	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere	Metagenome	Endosphere
286	3300053121	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere	Metagenome	Endosphere
287	3300053123	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere	Metagenome	Endosphere
288	3300053136	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere	Metagenome	Endosphere
289	3300053138	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere	Metagenome	Endosphere
290	3300053139	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere	Metagenome	Endosphere
291	3300053148	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere	Metagenome	Endosphere
292	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
293	3300053154	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere	Metagenome	Endosphere
294	3300053155	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere	Metagenome	Endosphere
295	3300053157	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere	Metagenome	Endosphere
296	3300053162	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere	Metagenome	Endosphere
297	3300053163	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere	Metagenome	Endosphere
298	3300053177	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere	Metagenome	Endosphere
299	3300053729	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere	Metagenome	Endosphere
300	3300053730	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere	Metagenome	Endosphere
301	3300053731	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere	Metagenome	Endosphere
302	3300053735	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere	Metagenome	Endosphere
303	8006933436	Bradyrhizobium septentrionale 7(2017)	Isolate	Unclassified
304	8006973647	Bradyrhizobium septentrionale 162S2	Isolate	Nodule
305	8019555841	Bradyrhizobium sp. JR6.1	Isolate	Nodule
306	8019565922	Bradyrhizobium sp. JR3.5	Isolate	Nodule

Type Distribution

Type	Percentage (%)
Metagenomes	94.67
Metatranscriptomes	0.2
Isolates	5.12

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	5.93
Nodule	4.5
Rhizoplane	5.52
Rhizosphere	73.62
Stem	0
Stem Tuber	0
Unclassified	10.43

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI25165J46597_1009920	3300003214	Bacteria	1407
2	JGI25404J52841_10089598	3300003659	Bacteria	643
3	Ga0070658_10087090	3300005327	Bacteria	2570
4	Ga0070676_10273287	3300005328	Bacteria	1136
5	Ga0070683_100149322	3300005329	Bacteria	2215
6	Ga0068868_100152878	3300005338	Bacteria	1901
7	Ga0070660_100022483	3300005339	Bacteria	4663
8	Ga0070691_10268441	3300005341	Bacteria	921
9	Ga0070661_100015019	3300005344	Bacteria	5464
10	Ga0070668_100293092	3300005347	Bacteria	1362
11	Ga0070668_101486167	3300005347	Bacteria	619
12	Ga0070675_100148174	3300005354	Bacteria	2011
13	Ga0070675_101007065	3300005354	Bacteria	765
14	Ga0070671_100271995	3300005355	Bacteria	1440
15	Ga0070674_100044306	3300005356	Bacteria	3032
16	Ga0070673_100146004	3300005364	Bacteria	1999
17	Ga0070659_100151934	3300005366	Bacteria	1889
18	Ga0070659_100250270	3300005366	Bacteria	1468
19	Ga0070709_10001435	3300005434	Bacteria	12865
20	Ga0070709_10484042	3300005434	Bacteria	937
21	Ga0070709_10613433	3300005434	Bacteria	839
22	Ga0070709_11529817	3300005434	Bacteria	542
23	Ga0070714_100013189	3300005435	Bacteria	6615
24	Ga0070714_100448963	3300005435	Bacteria	1225
25	Ga0070714_100579648	3300005435	Bacteria	1076
26	Ga0070713_100051353	3300005436	Bacteria	3409
27	Ga0070713_100077791	3300005436	Bacteria	2822
28	Ga0070713_100139161	3300005436	Bacteria	2148
29	Ga0070713_100336514	3300005436	Bacteria	1397
30	Ga0070713_100516567	3300005436	Bacteria	1128
31	Ga0070710_10006535	3300005437	Bacteria	5605
32	Ga0070711_100066959	3300005439	Bacteria	2518
33	Ga0070711_100428904	3300005439	Bacteria	1079
34	Ga0070711_100845248	3300005439	Bacteria	778
35	Ga0070663_100283391	3300005455	Bacteria	1321
36	Ga0070678_101216926	3300005456	Bacteria	699
37	Ga0070662_100116279	3300005457	Bacteria	2044
38	Ga0070662_100679215	3300005457	Bacteria	870
39	Ga0070662_101441063	3300005457	Bacteria	594
40	Ga0070706_100620069	3300005467	Bacteria	1005
41	Ga0070706_101194286	3300005467	Bacteria	699
42	Ga0070707_100947043	3300005468	Bacteria	826
43	Ga0070698_100164481	3300005471	Bacteria	2162
44	Ga0070698_100599600	3300005471	Bacteria	1042
45	Ga0070698_101488127	3300005471	Bacteria	628
46	Ga0070698_101736984	3300005471	Bacteria	576
47	Ga0070679_100001939	3300005530	Bacteria	18580
48	Ga0070679_100563446	3300005530	Bacteria	1083
49	Ga0070697_100383817	3300005536	Bacteria	1217
50	Ga0070672_100434082	3300005543	Bacteria	1129
51	Ga0070665_100739454	3300005548	Bacteria	997
52	Ga0068855_100339210	3300005563	Bacteria	1657
53	Ga0068855_100455126	3300005563	Bacteria	1396
54	Ga0070664_100146157	3300005564	Bacteria	2085
55	Ga0070664_100153835	3300005564	Bacteria	2031
56	Ga0068854_100036816	3300005578	Bacteria	3431
57	Ga0068856_100672415	3300005614	Bacteria	1056
58	Ga0068856_100978615	3300005614	Bacteria	864
59	Ga0068859_100934859	3300005617	Bacteria	951
60	Ga0068859_101442794	3300005617	Bacteria	759
61	Ga0068864_100065276	3300005618	Bacteria	3158
62	Ga0068864_100522175	3300005618	Bacteria	1145
63	Ga0068851_10363229	3300005834	Bacteria	845
64	Ga0068863_100234969	3300005841	Bacteria	1769
65	Ga0068858_100088528	3300005842	Bacteria	2880
66	Ga0068858_100330389	3300005842	Bacteria	1458
67	Ga0081540_1143933	3300005983	Bacteria	952
68	Ga0081540_1319332	3300005983	Bacteria	533
69	Ga0070717_10019819	3300006028	Bacteria	5280
70	Ga0070717_10042539	3300006028	Bacteria	3705
71	Ga0070717_10077195	3300006028	Bacteria	2788
72	Ga0070717_10660880	3300006028	Bacteria	949
73	Ga0070715_10015520	3300006163	Bacteria	2843
74	Ga0070716_100001410	3300006173	Bacteria	10662
75	Ga0070716_100030779	3300006173	Bacteria	2916
76	Ga0070716_100294608	3300006173	Bacteria	1126
77	Ga0070712_100007612	3300006175	Bacteria	6771
78	Ga0070712_100095004	3300006175	Bacteria	2192
79	Ga0070712_100790051	3300006175	Bacteria	814
80	Ga0097621_100797694	3300006237	Bacteria	875
81	Ga0097621_101734645	3300006237	Bacteria	595
82	Ga0075370_10738059	3300006353	Bacteria	599
83	Ga0068865_100762005	3300006881	Bacteria	832
84	Ga0097620_100556928	3300006931	Bacteria	1241
85	Ga0097620_100934993	3300006931	Bacteria	951
86	Ga0097620_101442599	3300006931	Bacteria	759
87	Ga0099825_1026268	3300006941	Bacteria	3123
88	Ga0099824_1046661	3300006942	Bacteria	885
89	Ga0099823_1022824	3300006944	Bacteria	5771
90	Ga0099794_10008383	3300007265	Bacteria	4291
91	Ga0099794_10065841	3300007265	Bacteria	1767
92	Ga0099795_10088823	3300007788	Bacteria	1195
93	Ga0099795_10121080	3300007788	Bacteria	1046
94	Ga0099795_10220298	3300007788	Bacteria	807
95	Ga0105251_10193015	3300009011	Bacteria	917
96	Ga0105240_10003161	3300009093	Bacteria	25902
97	Ga0105240_10413686	3300009093	Bacteria	1516
98	Ga0105245_10724081	3300009098	Bacteria	1029
99	Ga0105247_10180626	3300009101	Bacteria	1408
100	Ga0105241_10035840	3300009174	Bacteria	3732
101	Ga0105241_10428326	3300009174	Bacteria	1166
102	Ga0105248_12027787	3300009177	Bacteria	654
103	Ga0105237_10051619	3300009545	Bacteria	4130
104	Ga0105237_10211826	3300009545	Bacteria	1938
105	Ga0105237_10644010	3300009545	Bacteria	1067
106	Ga0105238_10032301	3300009551	Bacteria	5326
107	Ga0105238_10078151	3300009551	Bacteria	3300
108	Ga0105238_11127497	3300009551	Bacteria	808
109	Ga0105238_11915690	3300009551	Bacteria	626
110	Ga0105249_10436621	3300009553	Bacteria	1346
111	Ga0105249_13056331	3300009553	Bacteria	537
112	Ga0099796_10211298	3300010159	Bacteria	791
113	Ga0105239_10068017	3300010375	Bacteria	3914
114	Ga0105239_10514686	3300010375	Bacteria	1361
115	Ga0105239_10700060	3300010375	Bacteria	1158
116	Ga0105246_10317827	3300011119	Bacteria	1264
117	Ga0105246_10686278	3300011119	Bacteria	896
118	Ga0157373_11304146	3300013100	Bacteria	550
119	Ga0157374_10301431	3300013296	Bacteria	1585
120	Ga0157378_10022522	3300013297	Bacteria	5543
121	Ga0157378_10157175	3300013297	Bacteria	2123
122	Ga0163162_10145423	3300013306	Bacteria	2486
123	Ga0157372_10043623	3300013307	Bacteria	4966
124	Ga0157375_10342951	3300013308	Bacteria	1659
125	Ga0163163_10609836	3300014325	Bacteria	1155
126	Ga0163163_11463826	3300014325	Bacteria	744
127	Ga0157379_10401809	3300014968	Bacteria	1260
128	Ga0157379_12004793	3300014968	Bacteria	572
129	Ga0157376_10144611	3300014969	Bacteria	2137
130	Ga0157376_11627529	3300014969	Bacteria	680
131	Ga0182007_10028829	3300015262	Bacteria	1904
132	Ga0213872_10044103	3300021361	Bacteria	2031
133	Ga0213874_10136980	3300021377	Bacteria	845
134	Ga0213875_10393813	3300021388	Bacteria	660
135	Ga0213871_10003226	3300021441	Bacteria	3117
136	Ga0209677_100635	3300025253	Bacteria	18690
137	Ga0209233_1004670	3300025261	Bacteria	4625
138	Ga0209455_1005444	3300025272	Bacteria	3931
139	Ga0209758_1066033	3300025297	Bacteria	1164
140	Ga0207692_10011486	3300025898	Bacteria	3771
141	Ga0207692_10024941	3300025898	Bacteria	2787
142	Ga0207710_10066547	3300025900	Bacteria	1644
143	Ga0207685_10008958	3300025905	Bacteria	2884
144	Ga0207699_10000386	3300025906	Bacteria	23177
145	Ga0207699_10001899	3300025906	Bacteria	9840
146	Ga0207699_10304898	3300025906	Bacteria	1113
147	Ga0207699_11381919	3300025906	Bacteria	521
148	Ga0207645_10138457	3300025907	Bacteria	1586
149	Ga0207705_10111086	3300025909	Bacteria	2025
150	Ga0207705_10174806	3300025909	Bacteria	1618
151	Ga0207684_10379701	3300025910	Bacteria	1215
152	Ga0207684_10831996	3300025910	Bacteria	779
153	Ga0207654_10250753	3300025911	Bacteria	1186
154	Ga0207695_10587729	3300025913	Bacteria	995
155	Ga0207693_10000774	3300025915	Bacteria	28742
156	Ga0207693_10003263	3300025915	Bacteria	13891
157	Ga0207663_10001349	3300025916	Bacteria	11352
158	Ga0207663_10217847	3300025916	Bacteria	1387
159	Ga0207663_10801125	3300025916	Bacteria	750
160	Ga0207663_10872262	3300025916	Bacteria	719
161	Ga0207657_10005108	3300025919	Bacteria	13749
162	Ga0207657_10022273	3300025919	Bacteria	5935
163	Ga0207657_10226695	3300025919	Bacteria	1495
164	Ga0207649_10447387	3300025920	Bacteria	974
165	Ga0207659_10063733	3300025926	Bacteria	2666
166	Ga0207687_10373739	3300025927	Bacteria	1166
167	Ga0207700_10066276	3300025928	Bacteria	2759
168	Ga0207700_10951131	3300025928	Bacteria	769
169	Ga0207664_10121406	3300025929	Bacteria	2187
170	Ga0207664_10307164	3300025929	Bacteria	1397
171	Ga0207664_10726701	3300025929	Bacteria	893
172	Ga0207690_10134236	3300025932	Bacteria	1815
173	Ga0207706_10133411	3300025933	Bacteria	2184
174	Ga0207706_10225644	3300025933	Bacteria	1640
175	Ga0207709_10461466	3300025935	Bacteria	984
176	Ga0207670_10348902	3300025936	Bacteria	1171
177	Ga0207669_10074348	3300025937	Bacteria	2148
178	Ga0207704_10435006	3300025938	Bacteria	1043
179	Ga0207665_10000289	3300025939	Bacteria	34924
180	Ga0207665_10063183	3300025939	Bacteria	2514
181	Ga0207665_10195827	3300025939	Bacteria	1470
182	Ga0207691_10436405	3300025940	Bacteria	1115
183	Ga0207689_10176506	3300025942	Bacteria	1762
184	Ga0207689_11339243	3300025942	Bacteria	601
185	Ga0207679_10103141	3300025945	Bacteria	2235
186	Ga0207667_10118322	3300025949	Bacteria	2730
187	Ga0207651_10156546	3300025960	Bacteria	1781
188	Ga0207712_10307091	3300025961	Bacteria	1304
189	Ga0207668_10186171	3300025972	Bacteria	1642
190	Ga0207668_10435636	3300025972	Bacteria	1115
191	Ga0207658_11287758	3300025986	Bacteria	668
192	Ga0207677_10213122	3300026023	Bacteria	1544
193	Ga0207703_10731366	3300026035	Bacteria	942
194	Ga0207703_10816858	3300026035	Bacteria	891
195	Ga0207639_10954981	3300026041	Bacteria	802
196	Ga0207678_10110892	3300026067	Bacteria	2340
197	Ga0207678_10221367	3300026067	Bacteria	1620
198	Ga0207702_10823262	3300026078	Bacteria	918
199	Ga0207702_10943763	3300026078	Bacteria	855
200	Ga0207641_10117702	3300026088	Bacteria	2366
201	Ga0207641_11737513	3300026088	Bacteria	626
202	Ga0207648_10024638	3300026089	Bacteria	5367
203	Ga0207676_10690289	3300026095	Bacteria	988
204	Ga0207674_10122563	3300026116	Bacteria	2566
205	Ga0207675_100030164	3300026118	Bacteria	5050
206	Ga0207683_10239173	3300026121	Bacteria	1656
207	Ga0209389_1000076	3300027296	Bacteria	92447
208	Ga0209489_100416	3300027361	Bacteria	77981
209	Ga0209700_100014	3300027363	Bacteria	299349
210	Ga0209179_1006830	3300027512	Bacteria	1859
211	Ga0209179_1089541	3300027512	Bacteria	682
212	Ga0209588_1009765	3300027671	Bacteria	2873
213	Ga0209588_1083793	3300027671	Bacteria	1029
214	Ga0209588_1165815	3300027671	Bacteria	696
215	Ga0268264_10000049	3300028381	Bacteria	329992
216	Ga0268264_10207345	3300028381	Bacteria	1797
217	Ga0268264_10813352	3300028381	Bacteria	934
218	Ga0265328_10145913	3300031239	Bacteria	889
219	Ga0265340_10004397	3300031247	Bacteria	7886
220	Ga0265331_10014568	3300031250	Bacteria	4180
221	Ga0265331_10493393	3300031250	Bacteria	551
222	Ga0307509_10029257	3300031507	Bacteria	6116
223	Ga0307509_10255985	3300031507	Bacteria	1530
224	Ga0307508_10000046	3300031616	Bacteria	139709
225	Ga0307508_10083047	3300031616	Bacteria	2786
226	Ga0265314_10182387	3300031711	Bacteria	1257
227	Ga0265342_10184256	3300031712	Bacteria	1142
228	Ga0307516_10015246	3300031730	Bacteria	8096
229	Ga0307412_10134886	3300031911	Bacteria	1799
230	Ga0307411_10503750	3300032005	Bacteria	1024
231	Ga0373926_0203695	3300035083	Bacteria	762
232	Ga0373934_0028282	3300035086	Bacteria	2183
233	Ga0373923_0000022	3300035111	Bacteria	23262
234	Ga0373923_0103321	3300035111	Bacteria	1259
235	Ga0373936_0012468	3300035113	Bacteria	3234
236	Ga0373945_0001640	3300035116	Bacteria	6865
237	Ga0373953_0001610	3300035117	Bacteria	6605
238	Ga0373953_0015235	3300035117	Bacteria	2781
239	Ga0373954_0000519	3300035118	Bacteria	14460
240	Ga0373954_0020336	3300035118	Bacteria	3002
241	Ga0373954_0060634	3300035118	Bacteria	1785
242	Ga0373956_0006376	3300035119	Bacteria	4725
243	Ga0373956_0021603	3300035119	Bacteria	2746
244	Ga0373956_0635286	3300035119	Bacteria	510
245	Ga0373957_0002302	3300035120	Bacteria	5424
246	Ga0373957_0008463	3300035120	Bacteria	3333
247	Ga0373957_0111248	3300035120	Bacteria	1103
248	Ga0373943_0001832	3300035170	Bacteria	9614
249	Ga0373943_0276971	3300035170	Bacteria	948
250	Ga0373946_0021484	3300035171	Bacteria	2503
251	Ga0373955_0001695	3300035172	Bacteria	9427
252	Ga0373955_0774664	3300035172	Bacteria	589
253	Ga0373942_0104976	3300035207	Bacteria	867
254	Ga0373924_0021403	3300035410	Bacteria	2521
255	Ga0373924_0132398	3300035410	Bacteria	1085
256	Ga0373924_0166118	3300035410	Bacteria	969
257	Ga0373931_0091596	3300035691	Bacteria	1695
258	Ga0373935_0000244	3300035692	Bacteria	26819
259	Ga0373935_0035558	3300035692	Bacteria	3110
260	Ga0373935_0147966	3300035692	Bacteria	1592
261	Ga0373927_0003221	3300035695	Bacteria	11752
262	Ga0373927_0734038	3300035695	Bacteria	652
263	Ga0373933_0000374	3300035724	Bacteria	28691
264	Ga0373933_0005137	3300035724	Bacteria	7139
265	Ga0373933_0062505	3300035724	Bacteria	2249
266	Ga0373933_0105482	3300035724	Bacteria	1753
267	Ga0373933_0324832	3300035724	Bacteria	998
268	Ga0373947_0002144	3300035725	Bacteria	11991
269	Ga0373937_0003416	3300036401	Bacteria	13330
270	Ga0373937_0279161	3300036401	Bacteria	1577
271	Ga0373937_0334530	3300036401	Bacteria	1433
272	Ga0373937_0712868	3300036401	Bacteria	950
273	Ga0372808_022225	3300036459	Bacteria	912
274	Ga0373925_0001674	3300037068	Bacteria	18651
275	Ga0373925_0088015	3300037068	Bacteria	2371
276	Ga0436364_0257607	3300037853	Bacteria	563
277	Ga0436364_0416901	3300037853	Bacteria	1311
278	Ga0436365_0424272	3300039437	Bacteria	771
279	Ga0436365_1309919	3300039437	Bacteria	1824
280	Ga0436360_0176008	3300039438	Bacteria	706
281	Ga0436361_0446256	3300039447	Bacteria	902
282	Ga0436363_1084120	3300039450	Bacteria	1286
283	Ga0436362_0816704	3300039453	Bacteria	2104
284	Ga0451795_1351160	3300041456	Bacteria	549
285	Ga0451839_1001464	3300041496	Bacteria	525
286	Ga0451853_0393728	3300041512	Bacteria	1524
287	Ga0439437_011475	3300042000	Bacteria	1015
288	Ga0466966_0172968	3300044684	Bacteria	1312
289	Ga0466968_0014741	3300044735	Bacteria	3093
290	Ga0466968_0311473	3300044735	Bacteria	759
291	Ga0466970_0067268	3300044765	Bacteria	1924
292	Ga0466957_0055530	3300044842	Bacteria	2421
293	Ga0466959_0198864	3300045049	Bacteria	1396
294	Ga0466967_0937023	3300045976	Bacteria	862
295	Ga0495592_0006994	3300046454	Bacteria	8432
296	Ga0495592_0025947	3300046454	Bacteria	4445
297	Ga0495592_0684661	3300046454	Bacteria	618
298	Ga0495603_0000370	3300046455	Bacteria	24383
299	Ga0495629_0000081	3300046459	Bacteria	85305
300	Ga0495629_0000380	3300046459	Bacteria	37205
301	Ga0495629_0659327	3300046459	Bacteria	697
302	Ga0495641_0015940	3300046461	Bacteria	3981
303	Ga0495651_0009321	3300046462	Bacteria	7534
304	Ga0495651_0477385	3300046462	Bacteria	801
305	Ga0495651_0517028	3300046462	Bacteria	762
306	Ga0495653_0030013	3300046463	Bacteria	4334
307	Ga0495580_0000435	3300046472	Bacteria	34468
308	Ga0495582_0000051	3300046473	Bacteria	59010
309	Ga0495639_0000010	3300046475	Bacteria	93685
310	Ga0495662_0015859	3300046476	Bacteria	3656
311	Ga0495664_0006633	3300046477	Bacteria	6400
312	Ga0495594_0001553	3300046499	Bacteria	11928
313	Ga0495608_0006818	3300046511	Bacteria	8098
314	Ga0495618_0009515	3300046514	Bacteria	5870
315	Ga0495618_0219009	3300046514	Bacteria	1201
316	Ga0495628_0032259	3300046516	Bacteria	4230
317	Ga0495628_0073171	3300046516	Bacteria	2670
318	Ga0495628_0794794	3300046516	Bacteria	662
319	Ga0495630_0395834	3300046517	Bacteria	1058
320	Ga0495652_0007397	3300046529	Bacteria	10125
321	Ga0495652_0136421	3300046529	Bacteria	1935
322	Ga0495654_0000834	3300046530	Bacteria	23400
323	Ga0495665_0000005	3300046531	Bacteria	86491
324	Ga0495640_0000301	3300046533	Bacteria	33996
325	Ga0495640_0009451	3300046533	Bacteria	7596
326	Ga0495640_0238689	3300046533	Bacteria	1141
327	Ga0495586_0168185	3300046535	Bacteria	1238
328	Ga0495587_0002764	3300046536	Bacteria	11712
329	Ga0495587_0707749	3300046536	Bacteria	552
330	Ga0495645_0366751	3300046543	Bacteria	924
331	Ga0495622_0003164	3300046557	Bacteria	7794
332	Ga0495667_0017080	3300046559	Bacteria	4900
333	Ga0495667_0030543	3300046559	Bacteria	3620
334	Ga0495634_0000764	3300046642	Bacteria	31101
335	Ga0495634_0008147	3300046642	Bacteria	7807
336	Ga0495634_0508306	3300046642	Bacteria	706
337	Ga0495635_0000213	3300046663	Bacteria	36809
338	Ga0495635_0000259	3300046663	Bacteria	33960
339	Ga0495588_0006723	3300046674	Bacteria	5196
340	Ga0495657_0016391	3300046675	Bacteria	5399
341	Ga0495657_0110770	3300046675	Bacteria	1739
342	Ga0495599_0001319	3300046678	Bacteria	14145
343	Ga0495599_0032677	3300046678	Bacteria	3267
344	Ga0495599_0448933	3300046678	Bacteria	764
345	Ga0495623_0005373	3300046679	Bacteria	8381
346	Ga0495623_0014745	3300046679	Bacteria	5052
347	Ga0495623_0519860	3300046679	Bacteria	626
348	Ga0495646_0017294	3300046680	Bacteria	4574
349	Ga0495646_0044122	3300046680	Bacteria	2727
350	Ga0495647_0000671	3300046681	Bacteria	10182
351	Ga0495613_0001985	3300046689	Bacteria	15542
352	Ga0495613_0420384	3300046689	Bacteria	909
353	Ga0495613_0583525	3300046689	Bacteria	745
354	Ga0495624_0000094	3300046690	Bacteria	59911
355	Ga0495624_0706541	3300046690	Bacteria	598
356	Ga0495600_0016256	3300046809	Bacteria	4719
357	Ga0495581_0000810	3300047315	Bacteria	16618
358	Ga0495581_0229523	3300047315	Bacteria	1086
359	Ga0495604_0057292	3300047317	Bacteria	2996
360	Ga0495604_0357298	3300047317	Bacteria	969
361	Ga0495674_0000955	3300047319	Bacteria	27621
362	Ga0495674_0574073	3300047319	Bacteria	896
363	Ga0495672_0035185	3300047320	Bacteria	3086
364	Ga0495676_0022280	3300047321	Bacteria	5514
365	Ga0495680_0002637	3300047322	Bacteria	18206
366	Ga0495675_0000756	3300047444	Bacteria	20233
367	Ga0495675_0051427	3300047444	Bacteria	2616
368	Ga0495684_0000052	3300047471	Bacteria	85125
369	Ga0495684_0156945	3300047471	Bacteria	1699
370	Ga0495686_0101291	3300047472	Bacteria	1737
371	Ga0495593_0000084	3300047673	Bacteria	41155
372	Ga0495593_0000126	3300047673	Bacteria	37465
373	Ga0495602_0121217	3300048088	Bacteria	2103
374	Ga0495602_0351131	3300048088	Bacteria	1064
375	Ga0495614_0569323	3300048089	Bacteria	543
376	Ga0496101_0522752	3300048904	Bacteria	938
377	Ga0496101_0678218	3300048904	Bacteria	814
378	Ga0496102_0700807	3300048905	Bacteria	936
379	Ga0496104_0020882	3300048907	Bacteria	6006
380	Ga0496104_1432833	3300048907	Bacteria	594
381	Ga0496105_0073921	3300048908	Bacteria	2816
382	Ga0496106_0001452	3300048909	Bacteria	17800
383	Ga0496106_0021757	3300048909	Bacteria	4762
384	Ga0496106_0186980	3300048909	Bacteria	1646
385	Ga0496106_0447266	3300048909	Bacteria	1038
386	Ga0496106_0841982	3300048909	Bacteria	726
387	Ga0496107_0534307	3300048910	Bacteria	869
388	Ga0496107_0550074	3300048910	Bacteria	855
389	Ga0496108_0438976	3300048911	Bacteria	1140
390	Ga0496109_0944130	3300048912	Bacteria	800
391	Ga0496110_0003476	3300048913	Bacteria	12083
392	Ga0496111_0056182	3300048914	Bacteria	2848
393	Ga0496112_0007159	3300048915	Bacteria	9877
394	Ga0496112_0027946	3300048915	Bacteria	5442
395	Ga0496113_0321840	3300048916	Bacteria	1239
396	Ga0496114_0309249	3300048917	Bacteria	1396
397	Ga0496115_0090264	3300048918	Bacteria	2503
398	Ga0496115_0114564	3300048918	Bacteria	2216
399	Ga0496115_0190951	3300048918	Bacteria	1692
400	Ga0496115_0749472	3300048918	Bacteria	764
401	Ga0496116_0071988	3300048919	Bacteria	2187
402	Ga0496117_0037758	3300048920	Bacteria	3593
403	Ga0496117_0210834	3300048920	Bacteria	1089
404	Ga0496118_0008852	3300048921	Bacteria	10300
405	Ga0496118_0052109	3300048921	Bacteria	3125
406	Ga0496118_0168090	3300048921	Bacteria	1344
407	Ga0496119_0081904	3300048922	Bacteria	1857
408	Ga0496119_0412093	3300048922	Bacteria	643
409	Ga0496120_0168673	3300048923	Bacteria	1085
410	Ga0496120_0297047	3300048923	Bacteria	741
411	Ga0496121_0000261	3300048924	Bacteria	110085
412	Ga0496121_0002340	3300048924	Bacteria	29257
413	Ga0496121_0031129	3300048924	Bacteria	4883
414	Ga0496121_0232809	3300048924	Bacteria	1289
415	Ga0496121_0286149	3300048924	Bacteria	1125
416	Ga0496122_0090838	3300048925	Bacteria	2082
417	Ga0496123_0146942	3300048926	Bacteria	1278
418	Ga0496124_0002998	3300048927	Bacteria	21122
419	Ga0496124_0390677	3300048927	Bacteria	969
420	Ga0496125_0048665	3300048928	Bacteria	3533
421	Ga0496125_0056711	3300048928	Bacteria	3179
422	Ga0496126_0001531	3300048929	Bacteria	35598
423	Ga0496126_0011299	3300048929	Bacteria	9262
424	Ga0496126_0035854	3300048929	Bacteria	4643
425	Ga0496126_0086520	3300048929	Bacteria	2762
426	Ga0496126_0242448	3300048929	Bacteria	1505
427	Ga0496126_0249763	3300048929	Bacteria	1479
428	Ga0496126_0308712	3300048929	Bacteria	1303
429	Ga0501080_0398760	3300049742	Bacteria	1238
430	nmdc:mga0n895_15401_c1	3300050512	Bacteria	6970
431	nmdc:mga08x19_888902_c1	3300050514	Bacteria	633
432	Ga0495601_0027411	3300053077	Bacteria	3522
433	Ga0495601_0211548	3300053077	Bacteria	1267
434	Ga0495601_0215342	3300053077	Bacteria	1254
435	Ga0495612_0086227	3300053078	Bacteria	1324
436	Ga0500610_0110922	3300053079	Bacteria	1411
437	Ga0495595_0022161	3300053084	Bacteria	2785
438	Ga0495619_0000913	3300053085	Bacteria	19380
439	Ga0495619_0117915	3300053085	Bacteria	1818
440	Ga0495619_0347854	3300053085	Bacteria	1025
441	Ga0495619_0530219	3300053085	Bacteria	809
442	Ga0500569_000723	3300053109	Bacteria	5739
443	Ga0500572_045565	3300053111	Bacteria	1289
444	Ga0500595_001771	3300053119	Bacteria	11236
445	Ga0500607_026105	3300053121	Bacteria	3249
446	Ga0500614_048047	3300053123	Bacteria	1110
447	Ga0500559_0320315	3300053136	Bacteria	727
448	Ga0500564_183906	3300053138	Bacteria	869
449	Ga0500568_0009134	3300053139	Bacteria	4727
450	Ga0500590_157413	3300053148	Bacteria	1016
451	Ga0500616_0073564	3300053153	Bacteria	1734
452	Ga0500616_0326507	3300053153	Bacteria	630
453	Ga0500619_031425	3300053154	Bacteria	1620
454	Ga0500620_029748	3300053155	Bacteria	1718
455	Ga0500624_006249	3300053157	Bacteria	1607
456	Ga0500638_212038	3300053162	Bacteria	810
457	Ga0500639_293781	3300053163	Bacteria	616
458	Ga0500636_0000291	3300053177	Bacteria	27724
459	Ga0500636_0334339	3300053177	Bacteria	730
460	Ga0500625_167909	3300053729	Bacteria	793
461	Ga0500645_159033	3300053730	Bacteria	620
462	Ga0500609_001936	3300053731	Bacteria	2988
463	Ga0500596_004648	3300053735	Bacteria	2499

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300005327	Ga0070658_10087090	Ga0070658_100870901	124
2	3300005339	Ga0070660_100022483	Ga0070660_1000224835	124
3	3300005341	Ga0070691_10268441	Ga0070691_102684412	124
4	3300005435	Ga0070714_100579648	Ga0070714_1005796482	124
5	3300005530	Ga0070679_100001939	Ga0070679_10000193917	124
6	3300009093	Ga0105240_10003161	Ga0105240_1000316113	124
7	3300009551	Ga0105238_10078151	Ga0105238_100781512	124
8	3300009553	Ga0105249_13056331	Ga0105249_130563312	124
9	3300014325	Ga0163163_11463826	Ga0163163_114638262	124
10	3300015262	Ga0182007_10028829	Ga0182007_100288291	124
11	3300025909	Ga0207705_10174806	Ga0207705_101748062	124
12	3300025913	Ga0207695_10587729	Ga0207695_105877292	124
13	3300025919	Ga0207657_10022273	Ga0207657_100222735	124
14	3300025929	Ga0207664_10307164	Ga0207664_103071642	124
15	3300025949	Ga0207667_10118322	Ga0207667_101183222	124
16	3300041512	Ga0451853_0393728	Ga0451853_0393728_640_1014	124
17	3300046530	Ga0495654_0000834	Ga0495654_0000834_766_1155	124
18	3300053730	Ga0500645_159033	Ga0500645_159033_34_414	124
19	iso_pu_bacteria	2847930680	2847931500	125
20	iso_pu_bacteria	2874620515	2874624390	125
21	iso_pu_bacteria	2879083081	2879087462	125
22	iso_pu_bacteria	2904666416	2904672271	125
23	iso_pu_bacteria	2904690495	2904692124	125
24	iso_pu_bacteria	2908756301	2908757406	125
25	iso_pu_bacteria	2935959822	2935964176	125
26	3300005563	Ga0068855_100455126	Ga0068855_1004551262	126
27	3300005617	Ga0068859_100934859	Ga0068859_1009348592	126
28	3300006931	Ga0097620_100934993	Ga0097620_1009349932	126
29	3300014969	Ga0157376_10144611	Ga0157376_101446112	126
30	3300049742	Ga0501080_0398760	Ga0501080_0398760_801_1181	126
31	iso_pu_bacteria	2513237101	2513694887	126
32	iso_pu_bacteria	2513237141	2513890435	126
33	iso_pu_bacteria	2524023210	2524466485	126
34	iso_pu_bacteria	2791355197	2793073660	126
35	iso_pu_bacteria	2885383462	2885385383	126
36	iso_pu_bacteria	2903748898	2903755868	126
37	iso_pu_bacteria	2903768456	2903772289	126
38	iso_pu_bacteria	2906610324	2906613044	126
39	iso_pu_bacteria	2935630451	2935635056	126
40	iso_pu_bacteria	2941507105	2941511665	126
41	iso_pu_bacteria	2941515067	2941519352	126
42	iso_pu_bacteria	2941523033	2941527524	126
43	iso_pu_bacteria	3005474847	3005483196	126
44	iso_pu_bacteria	8006933436	8006935566	126
45	iso_pu_bacteria	8006973647	8006975492	126
46	iso_pu_bacteria	8019555841	8019563242	126
47	iso_pu_bacteria	8019565922	8019573322	126
48	3300005530	Ga0070679_100563446	Ga0070679_1005634463	127
49	3300009174	Ga0105241_10428326	Ga0105241_104283262	127
50	3300009177	Ga0105248_12027787	Ga0105248_120277871	127
51	3300025911	Ga0207654_10250753	Ga0207654_102507532	127
52	iso_pu_bacteria	2667528175	2671121237	127
53	iso_pu_bacteria	2829745981	2829746942	127
54	3300005328	Ga0070676_10273287	Ga0070676_102732872	128
55	3300005329	Ga0070683_100149322	Ga0070683_1001493223	128
56	3300005338	Ga0068868_100152878	Ga0068868_1001528782	128
57	3300005344	Ga0070661_100015019	Ga0070661_1000150194	128
58	3300005347	Ga0070668_101486167	Ga0070668_1014861671	128
59	3300005354	Ga0070675_100148174	Ga0070675_1001481743	128
60	3300005354	Ga0070675_101007065	Ga0070675_1010070651	128
61	3300005355	Ga0070671_100271995	Ga0070671_1002719952	128
62	3300005356	Ga0070674_100044306	Ga0070674_1000443063	128
63	3300005364	Ga0070673_100146004	Ga0070673_1001460042	128
64	3300005366	Ga0070659_100151934	Ga0070659_1001519341	128
65	3300005366	Ga0070659_100250270	Ga0070659_1002502702	128
66	3300005455	Ga0070663_100283391	Ga0070663_1002833912	128
67	3300005456	Ga0070678_101216926	Ga0070678_1012169261	128
68	3300005457	Ga0070662_100116279	Ga0070662_1001162792	128
69	3300005457	Ga0070662_100679215	Ga0070662_1006792152	128
70	3300005543	Ga0070672_100434082	Ga0070672_1004340822	128
71	3300005548	Ga0070665_100739454	Ga0070665_1007394542	128
72	3300005563	Ga0068855_100339210	Ga0068855_1003392103	128
73	3300005564	Ga0070664_100153835	Ga0070664_1001538352	128
74	3300005578	Ga0068854_100036816	Ga0068854_1000368163	128
75	3300005614	Ga0068856_100978615	Ga0068856_1009786152	128
76	3300005834	Ga0068851_10363229	Ga0068851_103632292	128
77	3300006237	Ga0097621_101734645	Ga0097621_1017346451	128
78	3300006353	Ga0075370_10738059	Ga0075370_107380592	128
79	3300009174	Ga0105241_10035840	Ga0105241_100358403	128
80	3300009551	Ga0105238_10032301	Ga0105238_100323013	128
81	3300010375	Ga0105239_10068017	Ga0105239_100680173	128
82	3300010375	Ga0105239_10700060	Ga0105239_107000602	128
83	3300011119	Ga0105246_10317827	Ga0105246_103178272	128
84	3300013297	Ga0157378_10157175	Ga0157378_101571753	128
85	3300013307	Ga0157372_10043623	Ga0157372_100436232	128
86	3300025907	Ga0207645_10138457	Ga0207645_101384573	128
87	3300025909	Ga0207705_10111086	Ga0207705_101110863	128
88	3300025919	Ga0207657_10005108	Ga0207657_1000510811	128
89	3300025920	Ga0207649_10447387	Ga0207649_104473872	128
90	3300025926	Ga0207659_10063733	Ga0207659_100637333	128
91	3300025932	Ga0207690_10134236	Ga0207690_101342363	128
92	3300025933	Ga0207706_10133411	Ga0207706_101334113	128
93	3300025933	Ga0207706_10225644	Ga0207706_102256442	128
94	3300025937	Ga0207669_10074348	Ga0207669_100743483	128
95	3300025938	Ga0207704_10435006	Ga0207704_104350062	128
96	3300025940	Ga0207691_10436405	Ga0207691_104364052	128
97	3300025942	Ga0207689_11339243	Ga0207689_113392432	128
98	3300025960	Ga0207651_10156546	Ga0207651_101565463	128
99	3300025972	Ga0207668_10186171	Ga0207668_101861712	128
100	3300026023	Ga0207677_10213122	Ga0207677_102131222	128
101	3300026041	Ga0207639_10954981	Ga0207639_109549812	128
102	3300026067	Ga0207678_10110892	Ga0207678_101108923	128
103	3300026078	Ga0207702_10823262	Ga0207702_108232621	128
104	3300026089	Ga0207648_10024638	Ga0207648_100246384	128
105	3300026116	Ga0207674_10122563	Ga0207674_101225632	128
106	3300026121	Ga0207683_10239173	Ga0207683_102391733	128
107	3300031911	Ga0307412_10134886	Ga0307412_101348862	128
108	3300032005	Ga0307411_10503750	Ga0307411_105037502	128
109	3300035207	Ga0373942_0104976	Ga0373942_0104976_444_830	128
110	3300039437	Ga0436365_0424272	Ga0436365_0424272_52_438	128
111	3300042000	Ga0439437_011475	Ga0439437_011475_193_585	128
112	3300044842	Ga0466957_0055530	Ga0466957_0055530_109_495	128
113	3300048929	Ga0496126_0308712	Ga0496126_0308712_430_816	128
114	3300005435	Ga0070714_100448963	Ga0070714_1004489631	129
115	3300005436	Ga0070713_100139161	Ga0070713_1001391612	129
116	3300005436	Ga0070713_100336514	Ga0070713_1003365142	129
117	3300005439	Ga0070711_100066959	Ga0070711_1000669593	129
118	3300005467	Ga0070706_100620069	Ga0070706_1006200692	129
119	3300005467	Ga0070706_101194286	Ga0070706_1011942861	129
120	3300005471	Ga0070698_100599600	Ga0070698_1005996002	129
121	3300006941	Ga0099825_1026268	Ga0099825_10262684	129
122	3300006942	Ga0099824_1046661	Ga0099824_10466612	129
123	3300006944	Ga0099823_1022824	Ga0099823_10228243	129
124	3300007788	Ga0099795_10121080	Ga0099795_101210802	129
125	3300009093	Ga0105240_10413686	Ga0105240_104136862	129
126	3300009551	Ga0105238_11127497	Ga0105238_111274972	129
127	3300009551	Ga0105238_11915690	Ga0105238_119156902	129
128	3300013100	Ga0157373_11304146	Ga0157373_113041462	129
129	3300025910	Ga0207684_10379701	Ga0207684_103797012	129
130	3300025916	Ga0207663_10217847	Ga0207663_102178472	129
131	3300025928	Ga0207700_10066276	Ga0207700_100662762	129
132	3300025929	Ga0207664_10726701	Ga0207664_107267012	129
133	3300025986	Ga0207658_11287758	Ga0207658_112877582	129
134	3300027296	Ga0209389_1000076	Ga0209389_100007657	129
135	3300027361	Ga0209489_100416	Ga0209489_10041657	129
136	3300027363	Ga0209700_100014	Ga0209700_10001470	129
137	3300031711	Ga0265314_10182387	Ga0265314_101823872	129
138	3300035118	Ga0373954_0060634	Ga0373954_0060634_1182_1571	129
139	3300035120	Ga0373957_0111248	Ga0373957_0111248_291_680	129
140	3300035724	Ga0373933_0105482	Ga0373933_0105482_40_429	129
141	3300036401	Ga0373937_0279161	Ga0373937_0279161_130_519	129
142	3300039447	Ga0436361_0446256	Ga0436361_0446256_35_424	129
143	3300041496	Ga0451839_1001464	Ga0451839_1001464_29_418	129
144	3300044735	Ga0466968_0014741	Ga0466968_0014741_1374_1763	129
145	3300045976	Ga0466967_0937023	Ga0466967_0937023_10_399	129
146	3300046536	Ga0495587_0707749	Ga0495587_0707749_112_501	129
147	3300046690	Ga0495624_0706541	Ga0495624_0706541_119_508	129
148	3300047320	Ga0495672_0035185	Ga0495672_0035185_1393_1782	129
149	3300047472	Ga0495686_0101291	Ga0495686_0101291_657_1046	129
150	3300048909	Ga0496106_0447266	Ga0496106_0447266_579_968	129
151	3300048918	Ga0496115_0114564	Ga0496115_0114564_57_452	129
152	3300048921	Ga0496118_0052109	Ga0496118_0052109_1872_2267	129
153	3300048922	Ga0496119_0081904	Ga0496119_0081904_592_981	129
154	3300048923	Ga0496120_0297047	Ga0496120_0297047_291_680	129
155	3300048924	Ga0496121_0002340	Ga0496121_0002340_21266_21655	129
156	3300048929	Ga0496126_0035854	Ga0496126_0035854_96_485	129
157	3300048929	Ga0496126_0242448	Ga0496126_0242448_251_697	129
158	3300050512	nmdc:mga0n895_15401_c1	nmdc:mga0n895_15401_c1_275_664	129
159	3300050514	nmdc:mga08x19_888902_c1	nmdc:mga08x19_888902_c1_57_446	129
160	3300053079	Ga0500610_0110922	Ga0500610_0110922_607_999	129
161	3300053109	Ga0500569_000723	Ga0500569_000723_3766_4158	129
162	3300053111	Ga0500572_045565	Ga0500572_045565_251_643	129
163	3300053119	Ga0500595_001771	Ga0500595_001771_1279_1668	129
164	3300053121	Ga0500607_026105	Ga0500607_026105_579_971	129
165	3300053123	Ga0500614_048047	Ga0500614_048047_270_662	129
166	3300053136	Ga0500559_0320315	Ga0500559_0320315_323_712	129
167	3300053138	Ga0500564_183906	Ga0500564_183906_177_569	129
168	3300053139	Ga0500568_0009134	Ga0500568_0009134_2983_3372	129
169	3300053148	Ga0500590_157413	Ga0500590_157413_275_667	129
170	3300053153	Ga0500616_0073564	Ga0500616_0073564_793_1182	129
171	3300053153	Ga0500616_0326507	Ga0500616_0326507_76_465	129
172	3300053154	Ga0500619_031425	Ga0500619_031425_341_733	129
173	3300053155	Ga0500620_029748	Ga0500620_029748_821_1213	129
174	3300053157	Ga0500624_006249	Ga0500624_006249_942_1334	129
175	3300053162	Ga0500638_212038	Ga0500638_212038_275_667	129
176	3300053163	Ga0500639_293781	Ga0500639_293781_150_542	129
177	3300053177	Ga0500636_0000291	Ga0500636_0000291_8874_9266	129
178	3300053729	Ga0500625_167909	Ga0500625_167909_18_410	129
179	3300053731	Ga0500609_001936	Ga0500609_001936_393_785	129
180	3300003214	JGI25165J46597_1009920	JGI25165J46597_10099202	130
181	3300003659	JGI25404J52841_10089598	JGI25404J52841_100895981	130
182	3300005347	Ga0070668_100293092	Ga0070668_1002930922	130
183	3300005434	Ga0070709_10001435	Ga0070709_100014359	130
184	3300005434	Ga0070709_10484042	Ga0070709_104840422	130
185	3300005434	Ga0070709_10613433	Ga0070709_106134331	130
186	3300005434	Ga0070709_11529817	Ga0070709_115298171	130
187	3300005435	Ga0070714_100013189	Ga0070714_1000131896	130
188	3300005436	Ga0070713_100051353	Ga0070713_1000513534	130
189	3300005436	Ga0070713_100077791	Ga0070713_1000777911	130
190	3300005436	Ga0070713_100516567	Ga0070713_1005165672	130
191	3300005437	Ga0070710_10006535	Ga0070710_100065354	130
192	3300005439	Ga0070711_100428904	Ga0070711_1004289042	130
193	3300005439	Ga0070711_100845248	Ga0070711_1008452482	130
194	3300005457	Ga0070662_101441063	Ga0070662_1014410632	130
195	3300005468	Ga0070707_100947043	Ga0070707_1009470432	130
196	3300005471	Ga0070698_100164481	Ga0070698_1001644811	130
197	3300005471	Ga0070698_101488127	Ga0070698_1014881271	130
198	3300005471	Ga0070698_101736984	Ga0070698_1017369841	130
199	3300005536	Ga0070697_100383817	Ga0070697_1003838172	130
200	3300005564	Ga0070664_100146157	Ga0070664_1001461573	130
201	3300005614	Ga0068856_100672415	Ga0068856_1006724152	130
202	3300005617	Ga0068859_101442794	Ga0068859_1014427941	130
203	3300005618	Ga0068864_100065276	Ga0068864_1000652763	130
204	3300005618	Ga0068864_100522175	Ga0068864_1005221752	130
205	3300005841	Ga0068863_100234969	Ga0068863_1002349693	130
206	3300005842	Ga0068858_100088528	Ga0068858_1000885282	130
207	3300005842	Ga0068858_100330389	Ga0068858_1003303892	130
208	3300005983	Ga0081540_1143933	Ga0081540_11439332	130
209	3300005983	Ga0081540_1319332	Ga0081540_13193321	130
210	3300006028	Ga0070717_10019819	Ga0070717_100198194	130
211	3300006028	Ga0070717_10042539	Ga0070717_100425393	130
212	3300006028	Ga0070717_10077195	Ga0070717_100771952	130
213	3300006028	Ga0070717_10660880	Ga0070717_106608802	130
214	3300006163	Ga0070715_10015520	Ga0070715_100155202	130
215	3300006173	Ga0070716_100001410	Ga0070716_1000014104	130
216	3300006173	Ga0070716_100030779	Ga0070716_1000307793	130
217	3300006173	Ga0070716_100294608	Ga0070716_1002946082	130
218	3300006175	Ga0070712_100007612	Ga0070712_1000076122	130
219	3300006175	Ga0070712_100095004	Ga0070712_1000950043	130
220	3300006175	Ga0070712_100790051	Ga0070712_1007900512	130
221	3300006237	Ga0097621_100797694	Ga0097621_1007976942	130
222	3300006881	Ga0068865_100762005	Ga0068865_1007620052	130
223	3300006931	Ga0097620_100556928	Ga0097620_1005569282	130
224	3300006931	Ga0097620_101442599	Ga0097620_1014425991	130
225	3300007265	Ga0099794_10008383	Ga0099794_100083834	130
226	3300007265	Ga0099794_10065841	Ga0099794_100658412	130
227	3300007788	Ga0099795_10088823	Ga0099795_100888232	130
228	3300007788	Ga0099795_10220298	Ga0099795_102202982	130
229	3300009011	Ga0105251_10193015	Ga0105251_101930151	130
230	3300009098	Ga0105245_10724081	Ga0105245_107240812	130
231	3300009101	Ga0105247_10180626	Ga0105247_101806262	130
232	3300009545	Ga0105237_10051619	Ga0105237_100516193	130
233	3300009545	Ga0105237_10211826	Ga0105237_102118262	130
234	3300009545	Ga0105237_10644010	Ga0105237_106440102	130
235	3300009553	Ga0105249_10436621	Ga0105249_104366212	130
236	3300010159	Ga0099796_10211298	Ga0099796_102112982	130
237	3300010375	Ga0105239_10514686	Ga0105239_105146862	130
238	3300011119	Ga0105246_10686278	Ga0105246_106862781	130
239	3300013296	Ga0157374_10301431	Ga0157374_103014312	130
240	3300013297	Ga0157378_10022522	Ga0157378_100225224	130
241	3300013306	Ga0163162_10145423	Ga0163162_101454232	130
242	3300013308	Ga0157375_10342951	Ga0157375_103429512	130
243	3300014325	Ga0163163_10609836	Ga0163163_106098362	130
244	3300014968	Ga0157379_10401809	Ga0157379_104018092	130
245	3300014968	Ga0157379_12004793	Ga0157379_120047931	130
246	3300014969	Ga0157376_11627529	Ga0157376_116275292	130
247	3300021361	Ga0213872_10044103	Ga0213872_100441033	130
248	3300021377	Ga0213874_10136980	Ga0213874_101369802	130
249	3300021388	Ga0213875_10393813	Ga0213875_103938132	130
250	3300021441	Ga0213871_10003226	Ga0213871_100032263	130
251	3300025253	Ga0209677_100635	Ga0209677_10063518	130
252	3300025261	Ga0209233_1004670	Ga0209233_10046704	130
253	3300025272	Ga0209455_1005444	Ga0209455_10054442	130
254	3300025297	Ga0209758_1066033	Ga0209758_10660332	130
255	3300025898	Ga0207692_10011486	Ga0207692_100114864	130
256	3300025898	Ga0207692_10024941	Ga0207692_100249412	130
257	3300025900	Ga0207710_10066547	Ga0207710_100665472	130
258	3300025905	Ga0207685_10008958	Ga0207685_100089582	130
259	3300025906	Ga0207699_10000386	Ga0207699_1000038614	130
260	3300025906	Ga0207699_10001899	Ga0207699_100018999	130
261	3300025906	Ga0207699_10304898	Ga0207699_103048982	130
262	3300025906	Ga0207699_11381919	Ga0207699_113819192	130
263	3300025910	Ga0207684_10831996	Ga0207684_108319961	130
264	3300025915	Ga0207693_10000774	Ga0207693_100007742	130
265	3300025915	Ga0207693_10003263	Ga0207693_100032638	130
266	3300025916	Ga0207663_10001349	Ga0207663_100013495	130
267	3300025916	Ga0207663_10801125	Ga0207663_108011251	130
268	3300025916	Ga0207663_10872262	Ga0207663_108722622	130
269	3300025919	Ga0207657_10226695	Ga0207657_102266952	130
270	3300025927	Ga0207687_10373739	Ga0207687_103737392	130
271	3300025928	Ga0207700_10951131	Ga0207700_109511312	130
272	3300025929	Ga0207664_10121406	Ga0207664_101214062	130
273	3300025935	Ga0207709_10461466	Ga0207709_104614662	130
274	3300025936	Ga0207670_10348902	Ga0207670_103489023	130
275	3300025939	Ga0207665_10000289	Ga0207665_1000028934	130
276	3300025939	Ga0207665_10063183	Ga0207665_100631832	130
277	3300025939	Ga0207665_10195827	Ga0207665_101958271	130
278	3300025942	Ga0207689_10176506	Ga0207689_101765062	130
279	3300025945	Ga0207679_10103141	Ga0207679_101031413	130
280	3300025961	Ga0207712_10307091	Ga0207712_103070912	130
281	3300025972	Ga0207668_10435636	Ga0207668_104356362	130
282	3300026035	Ga0207703_10731366	Ga0207703_107313662	130
283	3300026035	Ga0207703_10816858	Ga0207703_108168582	130
284	3300026067	Ga0207678_10221367	Ga0207678_102213673	130
285	3300026078	Ga0207702_10943763	Ga0207702_109437632	130
286	3300026088	Ga0207641_10117702	Ga0207641_101177022	130
287	3300026088	Ga0207641_11737513	Ga0207641_117375131	130
288	3300026095	Ga0207676_10690289	Ga0207676_106902892	130
289	3300026118	Ga0207675_100030164	Ga0207675_1000301642	130
290	3300027512	Ga0209179_1006830	Ga0209179_10068302	130
291	3300027512	Ga0209179_1089541	Ga0209179_10895411	130
292	3300027671	Ga0209588_1009765	Ga0209588_10097651	130
293	3300027671	Ga0209588_1083793	Ga0209588_10837932	130
294	3300027671	Ga0209588_1165815	Ga0209588_11658152	130
295	3300028381	Ga0268264_10000049	Ga0268264_10000049186	130
296	3300028381	Ga0268264_10207345	Ga0268264_102073452	130
297	3300028381	Ga0268264_10813352	Ga0268264_108133521	130
298	3300031239	Ga0265328_10145913	Ga0265328_101459132	130
299	3300031247	Ga0265340_10004397	Ga0265340_100043977	130
300	3300031250	Ga0265331_10014568	Ga0265331_100145684	130
301	3300031250	Ga0265331_10493393	Ga0265331_104933932	130
302	3300031507	Ga0307509_10029257	Ga0307509_100292574	130
303	3300031507	Ga0307509_10255985	Ga0307509_102559852	130
304	3300031616	Ga0307508_10000046	Ga0307508_10000046110	130
305	3300031616	Ga0307508_10083047	Ga0307508_100830471	130
306	3300031712	Ga0265342_10184256	Ga0265342_101842562	130
307	3300031730	Ga0307516_10015246	Ga0307516_100152462	130
308	3300035083	Ga0373926_0203695	Ga0373926_0203695_283_696	130
309	3300035086	Ga0373934_0028282	Ga0373934_0028282_760_1158	130
310	3300035111	Ga0373923_0000022	Ga0373923_0000022_15531_15929	130
311	3300035111	Ga0373923_0103321	Ga0373923_0103321_603_1013	130
312	3300035113	Ga0373936_0012468	Ga0373936_0012468_333_746	130
313	3300035116	Ga0373945_0001640	Ga0373945_0001640_3795_4208	130
314	3300035117	Ga0373953_0001610	Ga0373953_0001610_4074_4484	130
315	3300035117	Ga0373953_0015235	Ga0373953_0015235_906_1304	130
316	3300035118	Ga0373954_0000519	Ga0373954_0000519_12808_13206	130
317	3300035118	Ga0373954_0020336	Ga0373954_0020336_1076_1489	130
318	3300035119	Ga0373956_0006376	Ga0373956_0006376_1204_1602	130
319	3300035119	Ga0373956_0021603	Ga0373956_0021603_311_721	130
320	3300035119	Ga0373956_0635286	Ga0373956_0635286_48_446	130
321	3300035120	Ga0373957_0002302	Ga0373957_0002302_3405_3803	130
322	3300035120	Ga0373957_0008463	Ga0373957_0008463_2247_2657	130
323	3300035170	Ga0373943_0001832	Ga0373943_0001832_6100_6513	130
324	3300035170	Ga0373943_0276971	Ga0373943_0276971_41_439	130
325	3300035171	Ga0373946_0021484	Ga0373946_0021484_676_1089	130
326	3300035172	Ga0373955_0001695	Ga0373955_0001695_429_827	130
327	3300035172	Ga0373955_0774664	Ga0373955_0774664_137_553	130
328	3300035410	Ga0373924_0021403	Ga0373924_0021403_442_840	130
329	3300035410	Ga0373924_0132398	Ga0373924_0132398_210_623	130
330	3300035410	Ga0373924_0166118	Ga0373924_0166118_514_924	130
331	3300035691	Ga0373931_0091596	Ga0373931_0091596_379_777	130
332	3300035692	Ga0373935_0000244	Ga0373935_0000244_11646_12059	130
333	3300035692	Ga0373935_0035558	Ga0373935_0035558_55_465	130
334	3300035692	Ga0373935_0147966	Ga0373935_0147966_190_588	130
335	3300035695	Ga0373927_0003221	Ga0373927_0003221_7661_8074	130
336	3300035695	Ga0373927_0734038	Ga0373927_0734038_88_486	130
337	3300035724	Ga0373933_0000374	Ga0373933_0000374_23924_24322	130
338	3300035724	Ga0373933_0005137	Ga0373933_0005137_1322_1759	130
339	3300035724	Ga0373933_0062505	Ga0373933_0062505_1476_1883	130
340	3300035724	Ga0373933_0324832	Ga0373933_0324832_481_879	130
341	3300035725	Ga0373947_0002144	Ga0373947_0002144_1376_1789	130
342	3300036401	Ga0373937_0003416	Ga0373937_0003416_12274_12672	130
343	3300036401	Ga0373937_0334530	Ga0373937_0334530_656_1066	130
344	3300036401	Ga0373937_0712868	Ga0373937_0712868_88_486	130
345	3300036459	Ga0372808_022225	Ga0372808_022225_362_760	130
346	3300037068	Ga0373925_0001674	Ga0373925_0001674_489_902	130
347	3300037068	Ga0373925_0088015	Ga0373925_0088015_1839_2237	130
348	3300037853	Ga0436364_0257607	Ga0436364_0257607_126_524	130
349	3300037853	Ga0436364_0416901	Ga0436364_0416901_233_631	130
350	3300039437	Ga0436365_1309919	Ga0436365_1309919_770_1168	130
351	3300039438	Ga0436360_0176008	Ga0436360_0176008_261_659	130
352	3300039450	Ga0436363_1084120	Ga0436363_1084120_581_994	130
353	3300039453	Ga0436362_0816704	Ga0436362_0816704_1464_1862	130
354	3300041456	Ga0451795_1351160	Ga0451795_1351160_64_462	130
355	3300044684	Ga0466966_0172968	Ga0466966_0172968_534_932	130
356	3300044735	Ga0466968_0311473	Ga0466968_0311473_319_717	130
357	3300044765	Ga0466970_0067268	Ga0466970_0067268_793_1191	130
358	3300045049	Ga0466959_0198864	Ga0466959_0198864_587_985	130
359	3300046454	Ga0495592_0006994	Ga0495592_0006994_3806_4219	130
360	3300046454	Ga0495592_0025947	Ga0495592_0025947_1532_1930	130
361	3300046454	Ga0495592_0684661	Ga0495592_0684661_67_477	130
362	3300046455	Ga0495603_0000370	Ga0495603_0000370_6722_7135	130
363	3300046459	Ga0495629_0000081	Ga0495629_0000081_3035_3448	130
364	3300046459	Ga0495629_0000380	Ga0495629_0000380_31623_32021	130
365	3300046459	Ga0495629_0659327	Ga0495629_0659327_117_527	130
366	3300046461	Ga0495641_0015940	Ga0495641_0015940_3063_3476	130
367	3300046462	Ga0495651_0009321	Ga0495651_0009321_4476_4874	130
368	3300046462	Ga0495651_0477385	Ga0495651_0477385_234_644	130
369	3300046462	Ga0495651_0517028	Ga0495651_0517028_126_524	130
370	3300046463	Ga0495653_0030013	Ga0495653_0030013_3831_4247	130
371	3300046472	Ga0495580_0000435	Ga0495580_0000435_32703_33116	130
372	3300046473	Ga0495582_0000051	Ga0495582_0000051_26484_26897	130
373	3300046475	Ga0495639_0000010	Ga0495639_0000010_73540_73953	130
374	3300046476	Ga0495662_0015859	Ga0495662_0015859_504_917	130
375	3300046477	Ga0495664_0006633	Ga0495664_0006633_1868_2281	130
376	3300046499	Ga0495594_0001553	Ga0495594_0001553_8368_8781	130
377	3300046511	Ga0495608_0006818	Ga0495608_0006818_2644_3042	130
378	3300046514	Ga0495618_0009515	Ga0495618_0009515_1097_1495	130
379	3300046514	Ga0495618_0219009	Ga0495618_0219009_156_569	130
380	3300046516	Ga0495628_0032259	Ga0495628_0032259_3591_4004	130
381	3300046516	Ga0495628_0073171	Ga0495628_0073171_1290_1688	130
382	3300046516	Ga0495628_0794794	Ga0495628_0794794_45_443	130
383	3300046517	Ga0495630_0395834	Ga0495630_0395834_21_428	130
384	3300046529	Ga0495652_0007397	Ga0495652_0007397_9069_9467	130
385	3300046529	Ga0495652_0136421	Ga0495652_0136421_1140_1550	130
386	3300046531	Ga0495665_0000005	Ga0495665_0000005_60667_61080	130
387	3300046533	Ga0495640_0000301	Ga0495640_0000301_21261_21674	130
388	3300046533	Ga0495640_0009451	Ga0495640_0009451_6478_6876	130
389	3300046533	Ga0495640_0238689	Ga0495640_0238689_494_904	130
390	3300046535	Ga0495586_0168185	Ga0495586_0168185_92_505	130
391	3300046536	Ga0495587_0002764	Ga0495587_0002764_1450_1848	130
392	3300046543	Ga0495645_0366751	Ga0495645_0366751_262_660	130
393	3300046557	Ga0495622_0003164	Ga0495622_0003164_2770_3183	130
394	3300046559	Ga0495667_0017080	Ga0495667_0017080_1002_1400	130
395	3300046559	Ga0495667_0030543	Ga0495667_0030543_1496_1909	130
396	3300046642	Ga0495634_0000764	Ga0495634_0000764_3253_3666	130
397	3300046642	Ga0495634_0008147	Ga0495634_0008147_6757_7155	130
398	3300046642	Ga0495634_0508306	Ga0495634_0508306_206_604	130
399	3300046663	Ga0495635_0000213	Ga0495635_0000213_17926_18324	130
400	3300046663	Ga0495635_0000259	Ga0495635_0000259_7140_7553	130
401	3300046674	Ga0495588_0006723	Ga0495588_0006723_3939_4352	130
402	3300046675	Ga0495657_0016391	Ga0495657_0016391_4476_4874	130
403	3300046675	Ga0495657_0110770	Ga0495657_0110770_603_1013	130
404	3300046678	Ga0495599_0001319	Ga0495599_0001319_1002_1400	130
405	3300046678	Ga0495599_0032677	Ga0495599_0032677_2680_3090	130
406	3300046678	Ga0495599_0448933	Ga0495599_0448933_42_437	130
407	3300046679	Ga0495623_0005373	Ga0495623_0005373_526_924	130
408	3300046679	Ga0495623_0014745	Ga0495623_0014745_1468_1878	130
409	3300046679	Ga0495623_0519860	Ga0495623_0519860_187_585	130
410	3300046680	Ga0495646_0017294	Ga0495646_0017294_3640_4038	130
411	3300046680	Ga0495646_0044122	Ga0495646_0044122_798_1211	130
412	3300046681	Ga0495647_0000671	Ga0495647_0000671_3990_4403	130
413	3300046689	Ga0495613_0001985	Ga0495613_0001985_7367_7780	130
414	3300046689	Ga0495613_0420384	Ga0495613_0420384_373_771	130
415	3300046689	Ga0495613_0583525	Ga0495613_0583525_234_644	130
416	3300046690	Ga0495624_0000094	Ga0495624_0000094_38297_38710	130
417	3300046809	Ga0495600_0016256	Ga0495600_0016256_4162_4572	130
418	3300047315	Ga0495581_0000810	Ga0495581_0000810_13308_13721	130
419	3300047315	Ga0495581_0229523	Ga0495581_0229523_569_967	130
420	3300047317	Ga0495604_0057292	Ga0495604_0057292_1456_1851	130
421	3300047317	Ga0495604_0357298	Ga0495604_0357298_443_841	130
422	3300047319	Ga0495674_0000955	Ga0495674_0000955_21476_21889	130
423	3300047319	Ga0495674_0574073	Ga0495674_0574073_358_756	130
424	3300047321	Ga0495676_0022280	Ga0495676_0022280_2614_3027	130
425	3300047322	Ga0495680_0002637	Ga0495680_0002637_13192_13590	130
426	3300047444	Ga0495675_0000756	Ga0495675_0000756_1460_1858	130
427	3300047444	Ga0495675_0051427	Ga0495675_0051427_1799_2209	130
428	3300047471	Ga0495684_0000052	Ga0495684_0000052_45499_45897	130
429	3300047471	Ga0495684_0156945	Ga0495684_0156945_929_1342	130
430	3300047673	Ga0495593_0000084	Ga0495593_0000084_3163_3576	130
431	3300047673	Ga0495593_0000126	Ga0495593_0000126_35817_36215	130
432	3300048088	Ga0495602_0121217	Ga0495602_0121217_1392_1790	130
433	3300048088	Ga0495602_0351131	Ga0495602_0351131_103_501	130
434	3300048089	Ga0495614_0569323	Ga0495614_0569323_37_435	130
435	3300048904	Ga0496101_0522752	Ga0496101_0522752_311_709	130
436	3300048904	Ga0496101_0678218	Ga0496101_0678218_120_518	130
437	3300048905	Ga0496102_0700807	Ga0496102_0700807_55_453	130
438	3300048907	Ga0496104_0020882	Ga0496104_0020882_706_1104	130
439	3300048907	Ga0496104_1432833	Ga0496104_1432833_160_558	130
440	3300048908	Ga0496105_0073921	Ga0496105_0073921_351_749	130
441	3300048909	Ga0496106_0001452	Ga0496106_0001452_14931_15329	130
442	3300048909	Ga0496106_0021757	Ga0496106_0021757_3946_4344	130
443	3300048909	Ga0496106_0186980	Ga0496106_0186980_1153_1551	130
444	3300048909	Ga0496106_0841982	Ga0496106_0841982_80_478	130
445	3300048910	Ga0496107_0534307	Ga0496107_0534307_368_766	130
446	3300048910	Ga0496107_0550074	Ga0496107_0550074_385_783	130
447	3300048911	Ga0496108_0438976	Ga0496108_0438976_55_453	130
448	3300048912	Ga0496109_0944130	Ga0496109_0944130_294_692	130
449	3300048913	Ga0496110_0003476	Ga0496110_0003476_5573_5971	130
450	3300048914	Ga0496111_0056182	Ga0496111_0056182_577_975	130
451	3300048915	Ga0496112_0007159	Ga0496112_0007159_7127_7525	130
452	3300048915	Ga0496112_0027946	Ga0496112_0027946_4017_4415	130
453	3300048916	Ga0496113_0321840	Ga0496113_0321840_499_897	130
454	3300048917	Ga0496114_0309249	Ga0496114_0309249_771_1169	130
455	3300048918	Ga0496115_0090264	Ga0496115_0090264_749_1147	130
456	3300048918	Ga0496115_0190951	Ga0496115_0190951_1122_1520	130
457	3300048918	Ga0496115_0749472	Ga0496115_0749472_147_545	130
458	3300048919	Ga0496116_0071988	Ga0496116_0071988_50_448	130
459	3300048920	Ga0496117_0037758	Ga0496117_0037758_588_986	130
460	3300048920	Ga0496117_0210834	Ga0496117_0210834_556_954	130
461	3300048921	Ga0496118_0008852	Ga0496118_0008852_2514_2912	130
462	3300048921	Ga0496118_0168090	Ga0496118_0168090_89_487	130
463	3300048922	Ga0496119_0412093	Ga0496119_0412093_187_585	130
464	3300048923	Ga0496120_0168673	Ga0496120_0168673_355_753	130
465	3300048924	Ga0496121_0000261	Ga0496121_0000261_2532_2930	130
466	3300048924	Ga0496121_0031129	Ga0496121_0031129_2386_2784	130
467	3300048924	Ga0496121_0232809	Ga0496121_0232809_278_676	130
468	3300048924	Ga0496121_0286149	Ga0496121_0286149_415_807	130
469	3300048925	Ga0496122_0090838	Ga0496122_0090838_597_995	130
470	3300048926	Ga0496123_0146942	Ga0496123_0146942_508_906	130
471	3300048927	Ga0496124_0002998	Ga0496124_0002998_14927_15325	130
472	3300048927	Ga0496124_0390677	Ga0496124_0390677_538_936	130
473	3300048928	Ga0496125_0048665	Ga0496125_0048665_969_1367	130
474	3300048928	Ga0496125_0056711	Ga0496125_0056711_87_485	130
475	3300048929	Ga0496126_0001531	Ga0496126_0001531_26621_27019	130
476	3300048929	Ga0496126_0011299	Ga0496126_0011299_6368_6766	130
477	3300048929	Ga0496126_0086520	Ga0496126_0086520_1095_1493	130
478	3300048929	Ga0496126_0249763	Ga0496126_0249763_311_709	130
479	3300053077	Ga0495601_0027411	Ga0495601_0027411_2588_2986	130
480	3300053077	Ga0495601_0211548	Ga0495601_0211548_642_1055	130
481	3300053077	Ga0495601_0215342	Ga0495601_0215342_722_1132	130
482	3300053078	Ga0495612_0086227	Ga0495612_0086227_669_1067	130
483	3300053084	Ga0495595_0022161	Ga0495595_0022161_1729_2127	130
484	3300053085	Ga0495619_0000913	Ga0495619_0000913_7898_8296	130
485	3300053085	Ga0495619_0117915	Ga0495619_0117915_345_758	130
486	3300053085	Ga0495619_0347854	Ga0495619_0347854_248_658	130
487	3300053085	Ga0495619_0530219	Ga0495619_0530219_226_624	130
488	3300053177	Ga0500636_0334339	Ga0500636_0334339_47_445	130
489	3300053735	Ga0500596_004648	Ga0500596_004648_821_1219	130

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11533

AtzH-like

5

130

0.98 PF13474

SnoaL_3

SnoaL-like domain

16

129

0.86 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
6bjt-assembly1.cif.gz_B	the structure of atzh: a little known member of the atrazine breakdown pathway	0.9937	3	127
6bju-assembly1.cif.gz_B	the structure of atzh: a little known member of the atrazine breakdown pathway	0.9932	3	124
6bju-assembly1.cif.gz_A	the structure of atzh: a little known member of the atrazine breakdown pathway	0.9926	3	126
6bju-assembly2.cif.gz_D	the structure of atzh: a little known member of the atrazine breakdown pathway	0.9923	3	126
6d63-assembly1.cif.gz_A	the structure of atzh: a little known member of the atrazine breakdown pathway	0.9907	1	126

ID	Description	Score	Start	End	Superfamily
6bjtB00	Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,;	0.9937	3	127	3.10.450.50
6d63G00	Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,;	0.972	1	126	3.10.450.50
6d63G00	Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,;	0.9638	1	126	3.10.450.50
2owpB00	Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,;	0.9488	1	126	3.10.450.50
2owpB00	Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,;	0.9414	1	126	3.10.450.50

ID	Description	Score	Start	End	GO Terms
AF-A0A509EFP3-F1-model_v4	DUF4440 domain-containing protein	0.9977	1	127
AF-A0A0Q6K7F9-F1-model_v4	Oxalurate catabolism protein HpxZ	0.9974	1	126
AF-A0A2W5KBU4-F1-model_v4	Oxalurate catabolism protein HpxZ	0.9972	1	130
AF-A0A109CVZ3-F1-model_v4	deleted	0.9956	2	124
AF-A0A2C9D9G2-F1-model_v4	Allophanate hydrolase (EC 3.5.1.54)	0.9934	1	126	GO:0004039

Feature Viewer

pLDDT	pTM	Quality
94.98	0.88	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F453773

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF11533

AtzH-like

AtzH-like

5

130

0.98

PF13474

SnoaL_3

SnoaL-like domain

16

129

0.86

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map