F453750

General Info

Members Datasets Scaffolds Average Seq Length
489 245 978 511

Family's Representative Sequence

Representative Sequence 3300005981|Ga0081538_10063626|Ga0081538_100636262
Length 551
Sequence VGDVGREQRRVGSVTYREVGEEYFAQRKLRRHAGVWSLWALGVGAVISGDYYGWNFGLSTAGFGGLVIATIIIAIMYYGLCYSIAEMSPALPHTGGAYSFARSAMGPWGGFLTGLAENMEYVITPAVVVGAIGLLMQSLVVEMFNVTGDPWWNSEPFWWAIFYVVFVGINVIGIEATMRFTVVITVLALGVLAIFYVSALVSGDFDTSLWFNIPENWPATPETTDQLLAEGGGPFLPYGISGIFKALPFAIWFYLAIEEIPLAAEESMDPRRDVPKGTIWGMHTLVITGALILLLNSGVGGGAGAIGISGTPLFDGFIGVFGEGFAAELLALFGLIGLVASFFTIIYAYGRNTFSLSRAGYFPKFLSVTHGVRQTPHVALIAGAVVGYGVALLVWYLGRQEGDYAAQVVAALLYMAVFGAVISYALQCLSFIMLRVKLPNIERPYRSKWGIPGAAIAGIIALXXXITMFTNDDYRPGLYGVAAYYILGVIYFAIAGRHRLVLSPEEEFALTKGERGVPEVSYETSAAAQEAVLRGEPRGSTTPPPSGTSSG

Samples

Sample ID Description Type Environment
1 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
45 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
46 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
47 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
48 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
49 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
50 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
51 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
52 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
53 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
54 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
55 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
64 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
65 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
66 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
84 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
117 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
120 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
121 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
122 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
123 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
124 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
125 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
126 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
127 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
128 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
129 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
130 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
131 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
132 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
133 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
134 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
135 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
136 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
137 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
138 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
139 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
140 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
141 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
142 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
143 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
144 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
145 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
146 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
147 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
148 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
149 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
150 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
151 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
152 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
153 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
154 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
155 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
156 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
157 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
158 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
159 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
160 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
161 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
162 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
163 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
164 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
165 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
166 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
167 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
168 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
169 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
170 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
171 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
172 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
173 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
174 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
175 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
176 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
177 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
178 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
179 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
180 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
181 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
182 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
183 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
184 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
185 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
186 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
187 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
188 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
189 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
190 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
191 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
192 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
193 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
194 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
195 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
196 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
212 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
213 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
214 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
215 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
216 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
217 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
218 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
219 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
220 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
221 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
222 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
223 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
224 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
225 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
228 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
229 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
230 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
231 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
232 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
233 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
234 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
235 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
236 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
237 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
238 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
239 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
240 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
241 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
242 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
243 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
244 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
245 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.89
Nodule 0
Rhizoplane 6.13
Rhizosphere 89.98
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081538_10063626 3300005981 Bacteria 2093
2 JGI24743J22301_10001490 3300001991 Bacteria 3254
3 JGI24033J26618_1002077 3300002155 Bacteria 2015
4 JGI24751J29686_10000237 3300002459 Bacteria 22308
5 JGI24751J29686_10002288 3300002459 Bacteria 3878
6 JGI24751J29686_10005934 3300002459 Bacteria 2491
7 JGI25407J50210_10003784 3300003373 Bacteria 3653
8 JGI25407J50210_10012672 3300003373 Bacteria 2162
9 JGI25407J50210_10013281 3300003373 Bacteria 2117
10 Ga0070670_100040518 3300005331 Bacteria 4004
11 Ga0070670_100062719 3300005331 Bacteria 3190
12 Ga0070680_100029846 3300005336 Bacteria 4378
13 Ga0070682_100018871 3300005337 Bacteria 4038
14 Ga0070682_100076829 3300005337 Bacteria 2150
15 Ga0068868_100001894 3300005338 Bacteria 14364
16 Ga0070691_10001116 3300005341 Bacteria 11141
17 Ga0070668_100096666 3300005347 Bacteria 2335
18 Ga0070674_100094936 3300005356 Bacteria 2161
19 Ga0070667_100013374 3300005367 Bacteria 6784
20 Ga0070667_100014024 3300005367 Bacteria 6624
21 Ga0070703_10000131 3300005406 Bacteria 38472
22 Ga0070703_10003538 3300005406 Bacteria 4441
23 Ga0070709_10009494 3300005434 Bacteria 5369
24 Ga0070714_100094987 3300005435 Bacteria 2617
25 Ga0070713_100050711 3300005436 Bacteria 3429
26 Ga0070710_10002600 3300005437 Bacteria 8578
27 Ga0070711_100016121 3300005439 Bacteria 4740
28 Ga0070700_100028965 3300005441 Bacteria 3298
29 Ga0070694_100007476 3300005444 Bacteria 6664
30 Ga0070708_100000667 3300005445 Bacteria 26035
31 Ga0070708_100001052 3300005445 Bacteria 21011
32 Ga0070708_100001206 3300005445 Bacteria 19911
33 Ga0070708_100039237 3300005445 Bacteria 4142
34 Ga0070663_100064805 3300005455 Bacteria 2642
35 Ga0070678_100001418 3300005456 Bacteria 12751
36 Ga0070678_100037106 3300005456 Bacteria 3419
37 Ga0068867_100115066 3300005459 Bacteria 2071
38 Ga0070685_10056514 3300005466 Bacteria 2282
39 Ga0070706_100000414 3300005467 Bacteria 51492
40 Ga0070706_100001904 3300005467 Bacteria 21555
41 Ga0070706_100002795 3300005467 Bacteria 17458
42 Ga0070707_100001306 3300005468 Bacteria 24502
43 Ga0070707_100009563 3300005468 Bacteria 9008
44 Ga0070707_100019616 3300005468 Bacteria 6372
45 Ga0070707_100028423 3300005468 Bacteria 5322
46 Ga0070698_100004217 3300005471 Bacteria 15799
47 Ga0070698_100006621 3300005471 Bacteria 12563
48 Ga0070698_100138587 3300005471 Bacteria 2386
49 Ga0070698_100161217 3300005471 Bacteria 2186
50 Ga0070699_100013364 3300005518 Bacteria 7077
51 Ga0070699_100076313 3300005518 Bacteria 2917
52 Ga0070699_100099326 3300005518 Bacteria 2551
53 Ga0070697_100000886 3300005536 Bacteria 22503
54 Ga0070697_100006854 3300005536 Bacteria 8849
55 Ga0070697_100118075 3300005536 Bacteria 2216
56 Ga0070672_100000007 3300005543 Bacteria 104699
57 Ga0070696_100002838 3300005546 Bacteria 11518
58 Ga0070696_100027363 3300005546 Bacteria 3884
59 Ga0070696_100091421 3300005546 Bacteria 2167
60 Ga0070665_100000979 3300005548 Bacteria 36153
61 Ga0070665_100004847 3300005548 Bacteria 13979
62 Ga0070665_100202472 3300005548 Bacteria 1985
63 Ga0070704_100002548 3300005549 Bacteria 10263
64 Ga0070704_100126447 3300005549 Bacteria 1973
65 Ga0070664_100130815 3300005564 Bacteria 2204
66 Ga0068857_100091937 3300005577 Bacteria 2716
67 Ga0068857_100152811 3300005577 Bacteria 2092
68 Ga0070702_100057851 3300005615 Bacteria 2244
69 Ga0068864_100015971 3300005618 Bacteria 6247
70 Ga0068864_100063081 3300005618 Bacteria 3211
71 Ga0068866_10002315 3300005718 Bacteria 7894
72 Ga0068861_100010019 3300005719 Bacteria 6567
73 Ga0068861_100024161 3300005719 Bacteria 4392
74 Ga0068861_100045795 3300005719 Bacteria 3296
75 Ga0068861_100061765 3300005719 Bacteria 2876
76 Ga0068863_100121349 3300005841 Bacteria 2492
77 Ga0068862_100061166 3300005844 Bacteria 3237
78 Ga0081455_10002682 3300005937 Bacteria 21021
79 Ga0081455_10003881 3300005937 Bacteria 17022
80 Ga0081455_10003894 3300005937 Bacteria 16994
81 Ga0081455_10031388 3300005937 Bacteria 4808
82 Ga0081455_10054049 3300005937 Bacteria 3426
83 Ga0081455_10108341 3300005937 Bacteria 2213
84 Ga0081538_10000563 3300005981 Bacteria 41069
85 Ga0081538_10005034 3300005981 Bacteria 12031
86 Ga0081538_10007815 3300005981 Bacteria 9179
87 Ga0081540_1027059 3300005983 Bacteria 3258
88 Ga0081539_10001751 3300005985 Bacteria 34620
89 Ga0081539_10008782 3300005985 Bacteria 8661
90 Ga0081539_10034810 3300005985 Bacteria 3037
91 Ga0070717_10014926 3300006028 Bacteria 5982
92 Ga0075363_100000822 3300006048 Bacteria 10759
93 Ga0075363_100039365 3300006048 Bacteria 2487
94 Ga0075363_100081670 3300006048 Bacteria 1768
95 Ga0075364_10005195 3300006051 Bacteria 7552
96 Ga0075432_10001111 3300006058 Bacteria 8613
97 Ga0070715_10000775 3300006163 Bacteria 8648
98 Ga0070715_10001248 3300006163 Bacteria 7297
99 Ga0070716_100010039 3300006173 Bacteria 4736
100 Ga0070712_100078658 3300006175 Bacteria 2381
101 Ga0075369_10000241 3300006186 Bacteria 16255
102 Ga0075369_10006893 3300006186 Bacteria 4314
103 Ga0075369_10009805 3300006186 Bacteria 3732
104 Ga0075369_10020820 3300006186 Bacteria 2688
105 Ga0075369_10024049 3300006186 Bacteria 2522
106 Ga0075369_10038966 3300006186 Bacteria 2028
107 Ga0075370_10012485 3300006353 Bacteria 4490
108 Ga0075428_100003910 3300006844 Bacteria 16373
109 Ga0075428_100072393 3300006844 Bacteria 3765
110 Ga0075428_100124608 3300006844 Bacteria 2804
111 Ga0075430_100000242 3300006846 Bacteria 37737
112 Ga0075430_100008664 3300006846 Bacteria 8581
113 Ga0075430_100011643 3300006846 Bacteria 7483
114 Ga0075430_100012467 3300006846 Bacteria 7233
115 Ga0075431_100033779 3300006847 Bacteria 5270
116 Ga0075431_100035085 3300006847 Bacteria 5166
117 Ga0075431_100071105 3300006847 Bacteria 3589
118 Ga0075431_100144176 3300006847 Bacteria 2454
119 Ga0075431_100276288 3300006847 Bacteria 1701
120 Ga0075433_10005367 3300006852 Bacteria 10065
121 Ga0075434_100005212 3300006871 Bacteria 11806
122 Ga0075434_100010353 3300006871 Bacteria 8740
123 Ga0075434_100064340 3300006871 Bacteria 3651
124 Ga0075429_100007865 3300006880 Bacteria 9260
125 Ga0075429_100155345 3300006880 Bacteria 2003
126 Ga0068865_100000662 3300006881 Bacteria 19431
127 Ga0068865_100064716 3300006881 Bacteria 2574
128 Ga0068865_100083103 3300006881 Bacteria 2304
129 Ga0075436_100014142 3300006914 Bacteria 5464
130 Ga0075436_100130029 3300006914 Bacteria 1765
131 Ga0075435_100005381 3300007076 Bacteria 8927
132 Ga0099794_10023842 3300007265 Bacteria 2803
133 Ga0105251_10028069 3300009011 Bacteria 2847
134 Ga0111539_10006222 3300009094 Bacteria 15407
135 Ga0105245_10093297 3300009098 Bacteria 2773
136 Ga0105247_10000279 3300009101 Bacteria 46962
137 Ga0114129_10000831 3300009147 Bacteria 39916
138 Ga0114129_10004332 3300009147 Bacteria 20067
139 Ga0114129_10028015 3300009147 Bacteria 7979
140 Ga0114129_10143444 3300009147 Bacteria 3272
141 Ga0114129_10148452 3300009147 Bacteria 3210
142 Ga0114129_10304726 3300009147 Bacteria 2122
143 Ga0105243_10005457 3300009148 Bacteria 9922
144 Ga0105242_10001745 3300009176 Bacteria 17184
145 Ga0105242_10005811 3300009176 Bacteria 9503
146 Ga0105237_10135647 3300009545 Bacteria 2455
147 Ga0105238_10110446 3300009551 Bacteria 2730
148 Ga0105249_10039469 3300009553 Bacteria 4287
149 Ga0105249_10121713 3300009553 Bacteria 2480
150 Ga0105246_10036353 3300011119 Bacteria 3298
151 Ga0157378_10009814 3300013297 Bacteria 8346
152 Ga0163162_10054618 3300013306 Bacteria 4019
153 Ga0163162_10058362 3300013306 Bacteria 3888
154 Ga0157372_10078398 3300013307 Bacteria 3733
155 Ga0157375_10154464 3300013308 Bacteria 2433
156 Ga0163163_10136998 3300014325 Bacteria 2489
157 Ga0163163_10177513 3300014325 Bacteria 2177
158 Ga0157380_10059957 3300014326 Bacteria 3039
159 Ga0157380_10142475 3300014326 Bacteria 2061
160 Ga0157377_10035766 3300014745 Bacteria 2727
161 Ga0207653_10000057 3300025885 Bacteria 86497
162 Ga0207692_10001458 3300025898 Bacteria 8856
163 Ga0207647_10016279 3300025904 Bacteria 5077
164 Ga0207685_10000699 3300025905 Bacteria 6045
165 Ga0207699_10002418 3300025906 Bacteria 8817
166 Ga0207645_10020331 3300025907 Bacteria 4347
167 Ga0207643_10000076 3300025908 Bacteria 64527
168 Ga0207684_10000001 3300025910 Bacteria 1115726
169 Ga0207684_10000039 3300025910 Bacteria 274342
170 Ga0207684_10000195 3300025910 Bacteria 95612
171 Ga0207693_10007743 3300025915 Bacteria 8817
172 Ga0207663_10001047 3300025916 Bacteria 12702
173 Ga0207646_10000839 3300025922 Bacteria 39976
174 Ga0207646_10003267 3300025922 Bacteria 18464
175 Ga0207646_10121334 3300025922 Bacteria 2348
176 Ga0207650_10000679 3300025925 Bacteria 26730
177 Ga0207687_10011502 3300025927 Bacteria 5784
178 Ga0207687_10037077 3300025927 Bacteria 3324
179 Ga0207700_10003566 3300025928 Bacteria 9065
180 Ga0207664_10005372 3300025929 Bacteria 8755
181 Ga0207706_10002365 3300025933 Bacteria 18429
182 Ga0207706_10004738 3300025933 Bacteria 12737
183 Ga0207686_10003512 3300025934 Bacteria 8418
184 Ga0207686_10006416 3300025934 Bacteria 6332
185 Ga0207709_10008417 3300025935 Bacteria 5705
186 Ga0207704_10022817 3300025938 Bacteria 3361
187 Ga0207665_10001938 3300025939 Bacteria 13918
188 Ga0207665_10002351 3300025939 Bacteria 12764
189 Ga0207691_10000525 3300025940 Bacteria 38219
190 Ga0207689_10013444 3300025942 Bacteria 6989
191 Ga0207679_10013557 3300025945 Bacteria 5342
192 Ga0207679_10096737 3300025945 Bacteria 2298
193 Ga0207712_10005334 3300025961 Bacteria 8119
194 Ga0207712_10025364 3300025961 Bacteria 3938
195 Ga0207668_10073833 3300025972 Bacteria 2446
196 Ga0207678_10005859 3300026067 Bacteria 10955
197 Ga0207678_10078537 3300026067 Bacteria 2827
198 Ga0207708_10016308 3300026075 Bacteria 5584
199 Ga0207708_10018773 3300026075 Bacteria 5209
200 Ga0207641_10054938 3300026088 Bacteria 3381
201 Ga0207648_10001057 3300026089 Bacteria 30827
202 Ga0207676_10000747 3300026095 Bacteria 25485
203 Ga0207676_10039991 3300026095 Bacteria 3591
204 Ga0207674_10088860 3300026116 Bacteria 3082
205 Ga0207674_10189172 3300026116 Bacteria 2008
206 Ga0207683_10020588 3300026121 Bacteria 5645
207 Ga0207683_10134749 3300026121 Bacteria 2223
208 Ga0207428_10000812 3300027907 Bacteria 35326
209 Ga0207428_10007125 3300027907 Bacteria 10227
210 Ga0207428_10023574 3300027907 Bacteria 5173
211 Ga0268266_10002989 3300028379 Bacteria 17433
212 Ga0268266_10022711 3300028379 Bacteria 5341
213 Ga0268264_10054542 3300028381 Bacteria 3338
214 Ga0265332_10032308 3300031238 Bacteria 2281
215 Ga0265329_10015095 3300031242 Bacteria 2707
216 Ga0265314_10000142 3300031711 Bacteria 108299
217 Ga0307405_10005717 3300031731 Bacteria 6036
218 Ga0307410_10002062 3300031852 Bacteria 9504
219 Ga0307410_10021613 3300031852 Bacteria 3960
220 Ga0307406_10055354 3300031901 Bacteria 2535
221 Ga0307409_100005880 3300031995 Bacteria 7125
222 Ga0307409_100015779 3300031995 Bacteria 4971
223 Ga0307416_100017939 3300032002 Bacteria 4970
224 Ga0307416_100116433 3300032002 Bacteria 2369
225 Ga0307414_10020613 3300032004 Bacteria 4113
226 Ga0307415_100002945 3300032126 Bacteria 8548
227 Ga0307415_100100211 3300032126 Bacteria 2122
228 Ga0373932_0004262 3300035112 Bacteria 3395
229 Ga0373939_0006432 3300035114 Bacteria 2830
230 Ga0373960_0005988 3300035121 Bacteria 2835
231 Ga0373962_0000785 3300035242 Bacteria 7243
232 Ga0373962_0006646 3300035242 Bacteria 2804
233 Ga0373924_0042012 3300035410 Bacteria 1875
234 Ga0373931_0033363 3300035691 Bacteria 2668
235 Ga0373935_0023475 3300035692 Bacteria 3790
236 Ga0373947_0004124 3300035725 Bacteria 8542
237 Ga0373947_0007728 3300035725 Bacteria 6213
238 Ga0373947_0017619 3300035725 Bacteria 4109
239 Ga0373925_0020804 3300037068 Bacteria 4781
240 Ga0395899_0008393 3300037312 Bacteria 7955
241 Ga0395900_0000653 3300037418 Bacteria 46381
242 Ga0395900_0004924 3300037418 Bacteria 14061
243 Ga0395898_0001039 3300037466 Bacteria 43298
244 Ga0395905_0001855 3300037471 Bacteria 24345
245 Ga0395905_0057292 3300037471 Bacteria 3645
246 Ga0395905_0061943 3300037471 Bacteria 3500
247 Ga0395905_0237828 3300037471 Bacteria 1702
248 Ga0395901_0000625 3300038443 Bacteria 41072
249 Ga0395901_0001550 3300038443 Bacteria 23811
250 Ga0395901_0157223 3300038443 Bacteria 2387
251 Ga0439448_0001136 3300042005 Bacteria 6724
252 Ga0439454_000616 3300042011 Bacteria 2956
253 Ga0439455_0008750 3300042012 Bacteria 2177
254 Ga0439463_000041 3300042016 Bacteria 27286
255 Ga0439463_005282 3300042016 Bacteria 3209
256 Ga0450910_002401 3300042147 Bacteria 2457
257 Ga0439460_0005270 3300042461 Bacteria 3169
258 Ga0439460_0010404 3300042461 Bacteria 2379
259 Ga0450893_0001282 3300042532 Bacteria 3803
260 Ga0466972_0027311 3300044658 Bacteria 2824
261 Ga0495629_0008821 3300046459 Bacteria 7416
262 Ga0495629_0022461 3300046459 Bacteria 4498
263 Ga0495629_0078531 3300046459 Bacteria 2304
264 Ga0495641_0013380 3300046461 Bacteria 4513
265 Ga0495653_0058499 3300046463 Bacteria 2929
266 Ga0495580_0029724 3300046472 Bacteria 3964
267 Ga0495582_0000300 3300046473 Bacteria 27352
268 Ga0495582_0042553 3300046473 Bacteria 2501
269 Ga0495582_0089001 3300046473 Bacteria 1720
270 Ga0495662_0013083 3300046476 Bacteria 4041
271 Ga0495618_0025452 3300046514 Bacteria 3672
272 Ga0495631_0018557 3300046518 Bacteria 3273
273 Ga0495648_0015417 3300046524 Bacteria 5551
274 Ga0495642_0028499 3300046528 Bacteria 2225
275 Ga0495652_0040270 3300046529 Bacteria 4038
276 Ga0495665_0005738 3300046531 Bacteria 6700
277 Ga0495640_0057896 3300046533 Bacteria 2644
278 Ga0495598_0005219 3300046537 Bacteria 2865
279 Ga0495668_0036178 3300046616 Bacteria 2766
280 Ga0495634_0014983 3300046642 Bacteria 5575
281 Ga0495635_0025419 3300046663 Bacteria 4124
282 Ga0495658_0000299 3300046683 Bacteria 28208
283 Ga0495658_0015466 3300046683 Bacteria 3915
284 Ga0495613_0002451 3300046689 Bacteria 13994
285 Ga0495613_0038419 3300046689 Bacteria 3548
286 Ga0495624_0017689 3300046690 Bacteria 4780
287 Ga0495600_0043327 3300046809 Bacteria 2935
288 Ga0495581_0007753 3300047315 Bacteria 6213
289 Ga0495674_0009828 3300047319 Bacteria 9080
290 Ga0495672_0006558 3300047320 Bacteria 8972
291 Ga0495676_0044521 3300047321 Bacteria 3622
292 Ga0495680_0037430 3300047322 Bacteria 3886
293 Ga0495673_0000708 3300047469 Bacteria 32330
294 Ga0495684_0025571 3300047471 Bacteria 4535
295 Ga0495593_0003655 3300047673 Bacteria 9186
296 Ga0495593_0055094 3300047673 Bacteria 2094
297 Ga0496100_0040549 3300048903 Bacteria 2963
298 Ga0496101_0010239 3300048904 Bacteria 6189
299 Ga0496102_0008439 3300048905 Bacteria 8833
300 Ga0496102_0012319 3300048905 Bacteria 7397
301 Ga0496102_0131028 3300048905 Bacteria 2347
302 Ga0496102_0185225 3300048905 Bacteria 1962
303 Ga0496103_0008370 3300048906 Bacteria 6145
304 Ga0496103_0088018 3300048906 Bacteria 1958
305 Ga0496104_0031855 3300048907 Bacteria 4905
306 Ga0496104_0056014 3300048907 Bacteria 3728
307 Ga0496105_0006811 3300048908 Bacteria 8790
308 Ga0496106_0005557 3300048909 Bacteria 9333
309 Ga0496106_0049786 3300048909 Bacteria 3157
310 Ga0496106_0126338 3300048909 Bacteria 2003
311 Ga0496107_0052167 3300048910 Bacteria 2950
312 Ga0496108_0000188 3300048911 Bacteria 57492
313 Ga0496108_0030941 3300048911 Bacteria 4437
314 Ga0496108_0057530 3300048911 Bacteria 3267
315 Ga0496108_0063318 3300048911 Bacteria 3114
316 Ga0496109_0008008 3300048912 Bacteria 8960
317 Ga0496109_0032500 3300048912 Bacteria 4691
318 Ga0496109_0055768 3300048912 Bacteria 3605
319 Ga0496110_0013905 3300048913 Bacteria 6668
320 Ga0496111_0033426 3300048914 Bacteria 3668
321 Ga0496112_0003102 3300048915 Bacteria 13629
322 Ga0496112_0025972 3300048915 Bacteria 5629
323 Ga0496112_0055421 3300048915 Bacteria 3898
324 Ga0496113_0017125 3300048916 Bacteria 5024
325 Ga0496114_0235667 3300048917 Bacteria 1608
326 Ga0496115_0007260 3300048918 Bacteria 8146
327 Ga0501031_0002879 3300049568 Bacteria 11001
328 Ga0501031_0047599 3300049568 Bacteria 2795
329 Ga0501032_0019060 3300049569 Bacteria 4800
330 Ga0501032_0034951 3300049569 Bacteria 3437
331 Ga0501033_0015139 3300049570 Bacteria 5852
332 Ga0501033_0016184 3300049570 Bacteria 5647
333 Ga0501033_0060307 3300049570 Bacteria 2799
334 Ga0501034_0006326 3300049571 Bacteria 12749
335 Ga0501034_0114892 3300049571 Bacteria 2680
336 Ga0501036_0004348 3300049572 Bacteria 11433
337 Ga0501036_0038248 3300049572 Bacteria 4060
338 Ga0501036_0127656 3300049572 Bacteria 2147
339 Ga0501037_0002406 3300049573 Bacteria 13524
340 Ga0501037_0003261 3300049573 Bacteria 11777
341 Ga0501037_0010276 3300049573 Bacteria 6869
342 Ga0501037_0037260 3300049573 Bacteria 3584
343 Ga0501038_0016032 3300049574 Bacteria 6806
344 Ga0501038_0019589 3300049574 Bacteria 6096
345 Ga0501038_0061168 3300049574 Bacteria 3221
346 Ga0501038_0076466 3300049574 Bacteria 2828
347 Ga0501039_0027454 3300049575 Bacteria 4377
348 Ga0501039_0105851 3300049575 Bacteria 2196
349 Ga0501039_0110626 3300049575 Bacteria 2147
350 Ga0501039_0154016 3300049575 Bacteria 1806
351 Ga0501040_0000109 3300049576 Bacteria 42436
352 Ga0501040_0000563 3300049576 Bacteria 22467
353 Ga0501040_0015139 3300049576 Bacteria 5095
354 Ga0501041_0000035 3300049577 Bacteria 44444
355 Ga0501041_0003063 3300049577 Bacteria 9592
356 Ga0501041_0013583 3300049577 Bacteria 4830
357 Ga0501041_0019729 3300049577 Bacteria 4027
358 Ga0501041_0070344 3300049577 Bacteria 2147
359 Ga0501042_0001646 3300049578 Bacteria 13305
360 Ga0501042_0004644 3300049578 Bacteria 8766
361 Ga0501042_0025178 3300049578 Bacteria 4178
362 Ga0501042_0066718 3300049578 Bacteria 2572
363 Ga0501042_0094467 3300049578 Bacteria 2147
364 Ga0501043_0012878 3300049579 Bacteria 6538
365 Ga0501043_0013377 3300049579 Bacteria 6416
366 Ga0501043_0014947 3300049579 Bacteria 6080
367 Ga0501043_0039640 3300049579 Bacteria 3702
368 Ga0501043_0050711 3300049579 Bacteria 3261
369 Ga0501046_0000257 3300049580 Bacteria 54137
370 Ga0501046_0001094 3300049580 Bacteria 26528
371 Ga0501046_0001437 3300049580 Bacteria 22916
372 Ga0501046_0016333 3300049580 Bacteria 6219
373 Ga0501047_0041347 3300049581 Bacteria 4455
374 Ga0501047_0161203 3300049581 Bacteria 2114
375 Ga0501048_0009232 3300049582 Bacteria 7410
376 Ga0501048_0069966 3300049582 Bacteria 2479
377 Ga0501068_0001264 3300049584 Bacteria 13424
378 Ga0501068_0002336 3300049584 Bacteria 10104
379 Ga0501068_0069495 3300049584 Bacteria 2147
380 Ga0501069_0004108 3300049585 Bacteria 7515
381 Ga0501069_0020782 3300049585 Bacteria 3559
382 Ga0501070_0032599 3300049586 Bacteria 4360
383 Ga0501070_0034843 3300049586 Bacteria 4207
384 Ga0501071_0001524 3300049587 Bacteria 13495
385 Ga0501071_0003146 3300049587 Bacteria 10261
386 Ga0501071_0021364 3300049587 Bacteria 4505
387 Ga0501071_0092508 3300049587 Bacteria 2223
388 Ga0501072_0002198 3300049588 Bacteria 14583
389 Ga0501072_0006073 3300049588 Bacteria 9221
390 Ga0501072_0027232 3300049588 Bacteria 4459
391 Ga0501072_0117927 3300049588 Bacteria 2114
392 Ga0501073_0021827 3300049589 Bacteria 4612
393 Ga0501073_0034916 3300049589 Bacteria 3576
394 Ga0501074_0000083 3300049590 Bacteria 46097
395 Ga0501074_0001374 3300049590 Bacteria 16135
396 Ga0501074_0011802 3300049590 Bacteria 6350
397 Ga0501074_0016779 3300049590 Bacteria 5313
398 Ga0501075_0000060 3300049591 Bacteria 46743
399 Ga0501075_0002074 3300049591 Bacteria 13228
400 Ga0501075_0006106 3300049591 Bacteria 8273
401 Ga0501075_0013752 3300049591 Bacteria 5784
402 Ga0501075_0030038 3300049591 Bacteria 4022
403 Ga0501075_0104963 3300049591 Bacteria 2147
404 Ga0501076_0000628 3300049592 Bacteria 22519
405 Ga0501076_0001447 3300049592 Bacteria 15959
406 Ga0501076_0004431 3300049592 Bacteria 9984
407 Ga0501076_0007958 3300049592 Bacteria 7735
408 Ga0501077_0002662 3300049593 Bacteria 10706
409 Ga0501077_0005722 3300049593 Bacteria 7568
410 Ga0501077_0016444 3300049593 Bacteria 4661
411 Ga0501077_0027935 3300049593 Bacteria 3584
412 Ga0501079_0000050 3300049741 Bacteria 51670
413 Ga0501079_0000784 3300049741 Bacteria 21701
414 Ga0501079_0001786 3300049741 Bacteria 15350
415 Ga0501079_0040503 3300049741 Bacteria 3593
416 Ga0501080_0000918 3300049742 Bacteria 24125
417 Ga0501080_0090330 3300049742 Bacteria 2845
418 Ga0501080_0094185 3300049742 Bacteria 2781
419 Ga0501080_0129242 3300049742 Bacteria 2338
420 Ga0501081_0000890 3300049743 Bacteria 17673
421 Ga0501081_0002255 3300049743 Bacteria 12128
422 Ga0501081_0010077 3300049743 Bacteria 6164
423 Ga0501081_0014199 3300049743 Bacteria 5251
424 Ga0501081_0020740 3300049743 Bacteria 4383
425 Ga0501083_0006750 3300049744 Bacteria 8145
426 Ga0501083_0021285 3300049744 Bacteria 4505
427 Ga0501035_0015540 3300049822 Bacteria 7022
428 Ga0501035_0050372 3300049822 Bacteria 3732
429 Ga0501035_0136944 3300049822 Bacteria 2131
430 Ga0501044_0023010 3300049823 Bacteria 6632
431 Ga0501044_0192652 3300049823 Bacteria 2000
432 Ga0501045_0000051 3300049824 Bacteria 51695
433 Ga0501045_0004093 3300049824 Bacteria 10065
434 Ga0501045_0021130 3300049824 Bacteria 4654
435 Ga0501045_0099912 3300049824 Bacteria 2147
436 nmdc:mga07m45_84549_c1 3300050496 Bacteria 1814
437 nmdc:mga05p37_146461_c1 3300050507 Bacteria 2892
438 nmdc:mga05p37_1951_c1 3300050507 Bacteria 24049
439 nmdc:mga05p37_26372_c1 3300050507 Bacteria 7068
440 nmdc:mga05p37_4568_c1 3300050507 Bacteria 16181
441 nmdc:mga05p37_55616_c1 3300050507 Bacteria 4870
442 nmdc:mga05p37_6861_c1 3300050507 Bacteria 13423
443 nmdc:mga05p37_9170_c1 3300050507 Bacteria 11696
444 nmdc:mga05p37_93637_c1 3300050507 Bacteria 3702
445 nmdc:mga09592_52231_c1 3300050508 Bacteria 3450
446 nmdc:mga09592_81716_c1 3300050508 Bacteria 2754
447 nmdc:mga09592_99416_c1 3300050508 Bacteria 2491
448 nmdc:mga0qj67_1203_c1 3300050509 Bacteria 17982
449 nmdc:mga0qj67_18829_c1 3300050509 Bacteria 5266
450 nmdc:mga0qj67_40304_c1 3300050509 Bacteria 3671
451 nmdc:mga0qj67_47378_c1 3300050509 Bacteria 3396
452 nmdc:mga06r32_106440_c1 3300050510 Bacteria 2756
453 nmdc:mga06r32_141907_c1 3300050510 Bacteria 2379
454 nmdc:mga06r32_155932_c1 3300050510 Bacteria 2265
455 nmdc:mga08y16_154426_c1 3300050511 Bacteria 2385
456 nmdc:mga08y16_42494_c1 3300050511 Bacteria 4760
457 nmdc:mga0n895_13943_c1 3300050512 Bacteria 7279
458 nmdc:mga0n895_18404_c1 3300050512 Bacteria 6464
459 nmdc:mga0n895_21864_c1 3300050512 Bacteria 5990
460 nmdc:mga0n895_238_c1 3300050512 Bacteria 34862
461 nmdc:mga0rr50_21235_c1 3300050513 Bacteria 4428
462 nmdc:mga0rr50_2528_c1 3300050513 Bacteria 10358
463 nmdc:mga08x19_35108_c1 3300050514 Bacteria 3172
464 nmdc:mga08x19_60728_c1 3300050514 Bacteria 2449
465 nmdc:mga0a205_114171_c1 3300050515 Bacteria 2599
466 nmdc:mga0a205_229_c1 3300050515 Bacteria 39732
467 nmdc:mga0a205_25788_c1 3300050515 Bacteria 5601
468 nmdc:mga0a205_3327_c1 3300050515 Bacteria 14313
469 nmdc:mga0sz30_11768_c1 3300050516 Bacteria 3388
470 nmdc:mga0sz30_37549_c1 3300050516 Bacteria 2027
471 nmdc:mga0sz30_41228_c1 3300050516 Bacteria 1941
472 nmdc:mga0sz30_4831_c1 3300050516 Bacteria 4902
473 nmdc:mga0sz30_636_c1 3300050516 Bacteria 12980
474 Ga0495619_0154444 3300053085 Bacteria 1583
475 Ga0500652_000760 3300053131 Bacteria 10892
476 Ga0500616_0010840 3300053153 Bacteria 5434
477 Ga0501084_0000556 3300054114 Bacteria 28488
478 Ga0501084_0006037 3300054114 Bacteria 9962
479 Ga0501084_0015849 3300054114 Bacteria 6252
480 Ga0501084_0018156 3300054114 Bacteria 5857
481 Ga0590075_003396 3300059424 Bacteria 3791
482 Ga0501082_0011143 3300060353 Bacteria 7729
483 Ga0501082_0012418 3300060353 Bacteria 7319
484 Ga0501082_0138205 3300060353 Bacteria 2114
485 Ga0501082_0277742 3300060353 Bacteria 1458
486 Ga0530510_0000162 3300061734 Bacteria 40315
487 Ga0530510_0003821 3300061734 Bacteria 10384
488 Ga0530510_0049766 3300061734 Bacteria 3027
489 Ga0530510_0051664 3300061734 Bacteria 2970
490 Ga0081538_10063626
491 JGI24743J22301_10001490
492 JGI24033J26618_1002077
493 JGI24751J29686_10000237
494 JGI24751J29686_10002288
495 JGI24751J29686_10005934
496 JGI25407J50210_10003784
497 JGI25407J50210_10012672
498 JGI25407J50210_10013281
499 Ga0070670_100040518
500 Ga0070670_100062719
501 Ga0070680_100029846
502 Ga0070682_100018871
503 Ga0070682_100076829
504 Ga0068868_100001894
505 Ga0070691_10001116
506 Ga0070668_100096666
507 Ga0070674_100094936
508 Ga0070667_100013374
509 Ga0070667_100014024
510 Ga0070703_10000131
511 Ga0070703_10003538
512 Ga0070709_10009494
513 Ga0070714_100094987
514 Ga0070713_100050711
515 Ga0070710_10002600
516 Ga0070711_100016121
517 Ga0070700_100028965
518 Ga0070694_100007476
519 Ga0070708_100000667
520 Ga0070708_100001052
521 Ga0070708_100001206
522 Ga0070708_100039237
523 Ga0070663_100064805
524 Ga0070678_100001418
525 Ga0070678_100037106
526 Ga0068867_100115066
527 Ga0070685_10056514
528 Ga0070706_100000414
529 Ga0070706_100001904
530 Ga0070706_100002795
531 Ga0070707_100001306
532 Ga0070707_100009563
533 Ga0070707_100019616
534 Ga0070707_100028423
535 Ga0070698_100004217
536 Ga0070698_100006621
537 Ga0070698_100138587
538 Ga0070698_100161217
539 Ga0070699_100013364
540 Ga0070699_100076313
541 Ga0070699_100099326
542 Ga0070697_100000886
543 Ga0070697_100006854
544 Ga0070697_100118075
545 Ga0070672_100000007
546 Ga0070696_100002838
547 Ga0070696_100027363
548 Ga0070696_100091421
549 Ga0070665_100000979
550 Ga0070665_100004847
551 Ga0070665_100202472
552 Ga0070704_100002548
553 Ga0070704_100126447
554 Ga0070664_100130815
555 Ga0068857_100091937
556 Ga0068857_100152811
557 Ga0070702_100057851
558 Ga0068864_100015971
559 Ga0068864_100063081
560 Ga0068866_10002315
561 Ga0068861_100010019
562 Ga0068861_100024161
563 Ga0068861_100045795
564 Ga0068861_100061765
565 Ga0068863_100121349
566 Ga0068862_100061166
567 Ga0081455_10002682
568 Ga0081455_10003881
569 Ga0081455_10003894
570 Ga0081455_10031388
571 Ga0081455_10054049
572 Ga0081455_10108341
573 Ga0081538_10000563
574 Ga0081538_10005034
575 Ga0081538_10007815
576 Ga0081540_1027059
577 Ga0081539_10001751
578 Ga0081539_10008782
579 Ga0081539_10034810
580 Ga0070717_10014926
581 Ga0075363_100000822
582 Ga0075363_100039365
583 Ga0075363_100081670
584 Ga0075364_10005195
585 Ga0075432_10001111
586 Ga0070715_10000775
587 Ga0070715_10001248
588 Ga0070716_100010039
589 Ga0070712_100078658
590 Ga0075369_10000241
591 Ga0075369_10006893
592 Ga0075369_10009805
593 Ga0075369_10020820
594 Ga0075369_10024049
595 Ga0075369_10038966
596 Ga0075370_10012485
597 Ga0075428_100003910
598 Ga0075428_100072393
599 Ga0075428_100124608
600 Ga0075430_100000242
601 Ga0075430_100008664
602 Ga0075430_100011643
603 Ga0075430_100012467
604 Ga0075431_100033779
605 Ga0075431_100035085
606 Ga0075431_100071105
607 Ga0075431_100144176
608 Ga0075431_100276288
609 Ga0075433_10005367
610 Ga0075434_100005212
611 Ga0075434_100010353
612 Ga0075434_100064340
613 Ga0075429_100007865
614 Ga0075429_100155345
615 Ga0068865_100000662
616 Ga0068865_100064716
617 Ga0068865_100083103
618 Ga0075436_100014142
619 Ga0075436_100130029
620 Ga0075435_100005381
621 Ga0099794_10023842
622 Ga0105251_10028069
623 Ga0111539_10006222
624 Ga0105245_10093297
625 Ga0105247_10000279
626 Ga0114129_10000831
627 Ga0114129_10004332
628 Ga0114129_10028015
629 Ga0114129_10143444
630 Ga0114129_10148452
631 Ga0114129_10304726
632 Ga0105243_10005457
633 Ga0105242_10001745
634 Ga0105242_10005811
635 Ga0105237_10135647
636 Ga0105238_10110446
637 Ga0105249_10039469
638 Ga0105249_10121713
639 Ga0105246_10036353
640 Ga0157378_10009814
641 Ga0163162_10054618
642 Ga0163162_10058362
643 Ga0157372_10078398
644 Ga0157375_10154464
645 Ga0163163_10136998
646 Ga0163163_10177513
647 Ga0157380_10059957
648 Ga0157380_10142475
649 Ga0157377_10035766
650 Ga0207653_10000057
651 Ga0207692_10001458
652 Ga0207647_10016279
653 Ga0207685_10000699
654 Ga0207699_10002418
655 Ga0207645_10020331
656 Ga0207643_10000076
657 Ga0207684_10000001
658 Ga0207684_10000039
659 Ga0207684_10000195
660 Ga0207693_10007743
661 Ga0207663_10001047
662 Ga0207646_10000839
663 Ga0207646_10003267
664 Ga0207646_10121334
665 Ga0207650_10000679
666 Ga0207687_10011502
667 Ga0207687_10037077
668 Ga0207700_10003566
669 Ga0207664_10005372
670 Ga0207706_10002365
671 Ga0207706_10004738
672 Ga0207686_10003512
673 Ga0207686_10006416
674 Ga0207709_10008417
675 Ga0207704_10022817
676 Ga0207665_10001938
677 Ga0207665_10002351
678 Ga0207691_10000525
679 Ga0207689_10013444
680 Ga0207679_10013557
681 Ga0207679_10096737
682 Ga0207712_10005334
683 Ga0207712_10025364
684 Ga0207668_10073833
685 Ga0207678_10005859
686 Ga0207678_10078537
687 Ga0207708_10016308
688 Ga0207708_10018773
689 Ga0207641_10054938
690 Ga0207648_10001057
691 Ga0207676_10000747
692 Ga0207676_10039991
693 Ga0207674_10088860
694 Ga0207674_10189172
695 Ga0207683_10020588
696 Ga0207683_10134749
697 Ga0207428_10000812
698 Ga0207428_10007125
699 Ga0207428_10023574
700 Ga0268266_10002989
701 Ga0268266_10022711
702 Ga0268264_10054542
703 Ga0265332_10032308
704 Ga0265329_10015095
705 Ga0265314_10000142
706 Ga0307405_10005717
707 Ga0307410_10002062
708 Ga0307410_10021613
709 Ga0307406_10055354
710 Ga0307409_100005880
711 Ga0307409_100015779
712 Ga0307416_100017939
713 Ga0307416_100116433
714 Ga0307414_10020613
715 Ga0307415_100002945
716 Ga0307415_100100211
717 Ga0373932_0004262
718 Ga0373939_0006432
719 Ga0373960_0005988
720 Ga0373962_0000785
721 Ga0373962_0006646
722 Ga0373924_0042012
723 Ga0373931_0033363
724 Ga0373935_0023475
725 Ga0373947_0004124
726 Ga0373947_0007728
727 Ga0373947_0017619
728 Ga0373925_0020804
729 Ga0395899_0008393
730 Ga0395900_0000653
731 Ga0395900_0004924
732 Ga0395898_0001039
733 Ga0395905_0001855
734 Ga0395905_0057292
735 Ga0395905_0061943
736 Ga0395905_0237828
737 Ga0395901_0000625
738 Ga0395901_0001550
739 Ga0395901_0157223
740 Ga0439448_0001136
741 Ga0439454_000616
742 Ga0439455_0008750
743 Ga0439463_000041
744 Ga0439463_005282
745 Ga0450910_002401
746 Ga0439460_0005270
747 Ga0439460_0010404
748 Ga0450893_0001282
749 Ga0466972_0027311
750 Ga0495629_0008821
751 Ga0495629_0022461
752 Ga0495629_0078531
753 Ga0495641_0013380
754 Ga0495653_0058499
755 Ga0495580_0029724
756 Ga0495582_0000300
757 Ga0495582_0042553
758 Ga0495582_0089001
759 Ga0495662_0013083
760 Ga0495618_0025452
761 Ga0495631_0018557
762 Ga0495648_0015417
763 Ga0495642_0028499
764 Ga0495652_0040270
765 Ga0495665_0005738
766 Ga0495640_0057896
767 Ga0495598_0005219
768 Ga0495668_0036178
769 Ga0495634_0014983
770 Ga0495635_0025419
771 Ga0495658_0000299
772 Ga0495658_0015466
773 Ga0495613_0002451
774 Ga0495613_0038419
775 Ga0495624_0017689
776 Ga0495600_0043327
777 Ga0495581_0007753
778 Ga0495674_0009828
779 Ga0495672_0006558
780 Ga0495676_0044521
781 Ga0495680_0037430
782 Ga0495673_0000708
783 Ga0495684_0025571
784 Ga0495593_0003655
785 Ga0495593_0055094
786 Ga0496100_0040549
787 Ga0496101_0010239
788 Ga0496102_0008439
789 Ga0496102_0012319
790 Ga0496102_0131028
791 Ga0496102_0185225
792 Ga0496103_0008370
793 Ga0496103_0088018
794 Ga0496104_0031855
795 Ga0496104_0056014
796 Ga0496105_0006811
797 Ga0496106_0005557
798 Ga0496106_0049786
799 Ga0496106_0126338
800 Ga0496107_0052167
801 Ga0496108_0000188
802 Ga0496108_0030941
803 Ga0496108_0057530
804 Ga0496108_0063318
805 Ga0496109_0008008
806 Ga0496109_0032500
807 Ga0496109_0055768
808 Ga0496110_0013905
809 Ga0496111_0033426
810 Ga0496112_0003102
811 Ga0496112_0025972
812 Ga0496112_0055421
813 Ga0496113_0017125
814 Ga0496114_0235667
815 Ga0496115_0007260
816 Ga0501031_0002879
817 Ga0501031_0047599
818 Ga0501032_0019060
819 Ga0501032_0034951
820 Ga0501033_0015139
821 Ga0501033_0016184
822 Ga0501033_0060307
823 Ga0501034_0006326
824 Ga0501034_0114892
825 Ga0501036_0004348
826 Ga0501036_0038248
827 Ga0501036_0127656
828 Ga0501037_0002406
829 Ga0501037_0003261
830 Ga0501037_0010276
831 Ga0501037_0037260
832 Ga0501038_0016032
833 Ga0501038_0019589
834 Ga0501038_0061168
835 Ga0501038_0076466
836 Ga0501039_0027454
837 Ga0501039_0105851
838 Ga0501039_0110626
839 Ga0501039_0154016
840 Ga0501040_0000109
841 Ga0501040_0000563
842 Ga0501040_0015139
843 Ga0501041_0000035
844 Ga0501041_0003063
845 Ga0501041_0013583
846 Ga0501041_0019729
847 Ga0501041_0070344
848 Ga0501042_0001646
849 Ga0501042_0004644
850 Ga0501042_0025178
851 Ga0501042_0066718
852 Ga0501042_0094467
853 Ga0501043_0012878
854 Ga0501043_0013377
855 Ga0501043_0014947
856 Ga0501043_0039640
857 Ga0501043_0050711
858 Ga0501046_0000257
859 Ga0501046_0001094
860 Ga0501046_0001437
861 Ga0501046_0016333
862 Ga0501047_0041347
863 Ga0501047_0161203
864 Ga0501048_0009232
865 Ga0501048_0069966
866 Ga0501068_0001264
867 Ga0501068_0002336
868 Ga0501068_0069495
869 Ga0501069_0004108
870 Ga0501069_0020782
871 Ga0501070_0032599
872 Ga0501070_0034843
873 Ga0501071_0001524
874 Ga0501071_0003146
875 Ga0501071_0021364
876 Ga0501071_0092508
877 Ga0501072_0002198
878 Ga0501072_0006073
879 Ga0501072_0027232
880 Ga0501072_0117927
881 Ga0501073_0021827
882 Ga0501073_0034916
883 Ga0501074_0000083
884 Ga0501074_0001374
885 Ga0501074_0011802
886 Ga0501074_0016779
887 Ga0501075_0000060
888 Ga0501075_0002074
889 Ga0501075_0006106
890 Ga0501075_0013752
891 Ga0501075_0030038
892 Ga0501075_0104963
893 Ga0501076_0000628
894 Ga0501076_0001447
895 Ga0501076_0004431
896 Ga0501076_0007958
897 Ga0501077_0002662
898 Ga0501077_0005722
899 Ga0501077_0016444
900 Ga0501077_0027935
901 Ga0501079_0000050
902 Ga0501079_0000784
903 Ga0501079_0001786
904 Ga0501079_0040503
905 Ga0501080_0000918
906 Ga0501080_0090330
907 Ga0501080_0094185
908 Ga0501080_0129242
909 Ga0501081_0000890
910 Ga0501081_0002255
911 Ga0501081_0010077
912 Ga0501081_0014199
913 Ga0501081_0020740
914 Ga0501083_0006750
915 Ga0501083_0021285
916 Ga0501035_0015540
917 Ga0501035_0050372
918 Ga0501035_0136944
919 Ga0501044_0023010
920 Ga0501044_0192652
921 Ga0501045_0000051
922 Ga0501045_0004093
923 Ga0501045_0021130
924 Ga0501045_0099912
925 nmdc:mga07m45_84549_c1
926 nmdc:mga05p37_146461_c1
927 nmdc:mga05p37_1951_c1
928 nmdc:mga05p37_26372_c1
929 nmdc:mga05p37_4568_c1
930 nmdc:mga05p37_55616_c1
931 nmdc:mga05p37_6861_c1
932 nmdc:mga05p37_9170_c1
933 nmdc:mga05p37_93637_c1
934 nmdc:mga09592_52231_c1
935 nmdc:mga09592_81716_c1
936 nmdc:mga09592_99416_c1
937 nmdc:mga0qj67_1203_c1
938 nmdc:mga0qj67_18829_c1
939 nmdc:mga0qj67_40304_c1
940 nmdc:mga0qj67_47378_c1
941 nmdc:mga06r32_106440_c1
942 nmdc:mga06r32_141907_c1
943 nmdc:mga06r32_155932_c1
944 nmdc:mga08y16_154426_c1
945 nmdc:mga08y16_42494_c1
946 nmdc:mga0n895_13943_c1
947 nmdc:mga0n895_18404_c1
948 nmdc:mga0n895_21864_c1
949 nmdc:mga0n895_238_c1
950 nmdc:mga0rr50_21235_c1
951 nmdc:mga0rr50_2528_c1
952 nmdc:mga08x19_35108_c1
953 nmdc:mga08x19_60728_c1
954 nmdc:mga0a205_114171_c1
955 nmdc:mga0a205_229_c1
956 nmdc:mga0a205_25788_c1
957 nmdc:mga0a205_3327_c1
958 nmdc:mga0sz30_11768_c1
959 nmdc:mga0sz30_37549_c1
960 nmdc:mga0sz30_41228_c1
961 nmdc:mga0sz30_4831_c1
962 nmdc:mga0sz30_636_c1
963 Ga0495619_0154444
964 Ga0500652_000760
965 Ga0500616_0010840
966 Ga0501084_0000556
967 Ga0501084_0006037
968 Ga0501084_0015849
969 Ga0501084_0018156
970 Ga0590075_003396
971 Ga0501082_0011143
972 Ga0501082_0012418
973 Ga0501082_0138205
974 Ga0501082_0277742
975 Ga0530510_0000162
976 Ga0530510_0003821
977 Ga0530510_0049766
978 Ga0530510_0051664

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13520

AA_permease_2

Amino acid permease

34

492

0.8

PF00324

AA_permease

Amino acid permease

38

500

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
5j4i-assembly1.cif.gz_A crystal structure of the l-arginine/agmatine antiporter from e. coli at 2.2 angstroem resolution 0.8105 28 471
3ob6-assembly1.cif.gz_B structure of adic(n101a) in the open-to-out arg+ bound conformation 0.8098 28 469
6f2g-assembly1.cif.gz_A bacterial asc transporter crystal structure in open to in conformation 0.8077 35 473
3ob6-assembly1.cif.gz_A structure of adic(n101a) in the open-to-out arg+ bound conformation 0.8014 28 469
6f2g-assembly1.cif.gz_A bacterial asc transporter crystal structure in open to in conformation 0.7975 35 473
ID Description Score Start End Superfamily
af_P71892_30_474_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.8584 25 474 1.20.1740.10
af_P04817_83_548_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.8583 25 466 1.20.1740.10
af_P9WQM3_13_431_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.8573 25 471 1.20.1740.10
af_Q9C0V0_13_494_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.8483 25 474 1.20.1740.10
af_P25737_13_472_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.8474 26 464 1.20.1740.10
ID Description Score Start End GO Terms
AF-A0A258DYL7-F1-model_v4 Amino acid ABC transporter permease 0.9281 73 488 GO:0016020
GO:0022857
AF-A0A3G1L1N3-F1-model_v4 Ethanolamine permease 0.9121 25 474 GO:0005886
GO:0022857
AF-A0A2U0ZFL3-F1-model_v4 deleted 0.9074 25 472
AF-A0A661DLY2-F1-model_v4 Amino acid permease 0.9071 28 354 GO:0005886
GO:0022857
AF-A0A2G5L970-F1-model_v4 Ethanolamine permease 0.9024 35 466 GO:0016020
GO:0055085

Map