F453605

General Info

Members Datasets Scaffolds Average Seq Length
488 309 976 185

Family's Representative Sequence

Representative Sequence 3300013297|Ga0157378_10300043|Ga0157378_103000431
Length 185
Sequence MPPRRRRGLSEEDRALWESVAKQVKPLRKRHRVVKPAIGSPEAESSVALRPASPKPLAPPRIIPASRPEPPPLAPIGRRERSQLSRGRKEIDARVDLHGMTQVRAHRVLLTFLQRAHGDGLTFVLVITGKGKVGGADSERGVLRRQVPQWRALPEFRSLGVGFEEAHIGHGGEGALYVRVRRVRS

Samples

Sample ID Description Type Environment
1 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
61 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
62 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
63 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
64 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
65 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
66 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
67 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
68 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
69 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
70 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
75 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
80 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
81 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
82 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
87 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
89 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
93 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
96 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
97 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
98 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
99 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
100 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
101 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
102 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
103 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
104 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
105 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
106 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
107 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
108 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
157 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
160 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
161 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
162 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
163 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
164 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
165 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
166 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
167 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
168 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
169 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
170 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
171 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
172 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
173 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
174 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
175 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
176 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
177 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
178 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
179 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
180 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
181 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
182 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
183 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
184 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
185 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
186 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
187 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
188 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
189 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
190 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
191 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
192 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
193 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
194 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
195 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
196 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
197 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
198 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
199 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
200 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
201 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
202 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
203 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
204 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
205 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
206 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
207 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
208 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
209 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
210 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
211 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
212 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
213 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
214 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
215 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
216 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
217 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
218 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
219 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
220 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
221 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
222 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
223 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
224 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
225 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
226 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
227 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
228 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
229 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
230 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
231 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
232 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
233 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
234 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
235 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
236 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
237 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
238 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
239 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
240 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
241 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
242 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
243 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
244 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
245 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
246 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
247 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
248 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
250 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
252 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
254 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
255 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
256 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
257 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
258 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
259 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
261 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
262 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
263 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
264 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
265 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
266 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
267 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
268 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
269 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
270 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
271 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
272 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
273 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
274 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
275 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
276 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
277 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
278 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
279 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
280 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
281 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
282 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
283 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
284 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
285 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
286 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
287 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
288 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
289 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
290 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
291 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
292 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
293 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
294 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
295 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
296 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
297 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
298 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
299 2791355199
300 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
301 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
302 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
303 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
304 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
305 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
306 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
307 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
308 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
309 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.33
Metatranscriptomes 0
Isolates 2.67

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.09
Nodule 2.05
Rhizoplane 5.53
Rhizosphere 76.02
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157378_10300043 3300013297 Bacteria 1555
2 JGI24740J21852_10011431 3300001979 Bacteria 3380
3 JGI24737J22298_10004677 3300001990 Bacteria 4762
4 JGI25153J46596_10002154 3300003215 Bacteria 11522
5 rootL2_10276346 3300003322 Bacteria 1350
6 JGI25405J52794_10017838 3300003911 Bacteria 1414
7 Ga0070658_10103088 3300005327 Bacteria 2360
8 Ga0070676_10048724 3300005328 Bacteria 2477
9 Ga0070683_100033682 3300005329 Bacteria 4672
10 Ga0070690_100072006 3300005330 Bacteria 2246
11 Ga0070690_100076091 3300005330 Bacteria 2189
12 Ga0070690_100558767 3300005330 Bacteria 864
13 Ga0070670_100275077 3300005331 Bacteria 1470
14 Ga0070670_100346957 3300005331 Bacteria 1303
15 Ga0068869_100146032 3300005334 Bacteria 1831
16 Ga0070666_10194547 3300005335 Bacteria 1426
17 Ga0070680_100233288 3300005336 Bacteria 1554
18 Ga0070682_100152780 3300005337 Bacteria 1586
19 Ga0068868_100073327 3300005338 Bacteria 2733
20 Ga0068868_100087203 3300005338 Bacteria 2510
21 Ga0068868_100210208 3300005338 Bacteria 1626
22 Ga0070660_100196631 3300005339 Bacteria 1635
23 Ga0070660_100393644 3300005339 Bacteria 1145
24 Ga0070689_100188208 3300005340 Bacteria 1680
25 Ga0070691_10217059 3300005341 Bacteria 1012
26 Ga0070687_100185719 3300005343 Bacteria 1249
27 Ga0070668_100012183 3300005347 Bacteria 6404
28 Ga0070668_100065341 3300005347 Bacteria 2822
29 Ga0070668_100398625 3300005347 Bacteria 1174
30 Ga0070669_100297810 3300005353 Bacteria 1297
31 Ga0070675_100240544 3300005354 Bacteria 1582
32 Ga0070675_100647018 3300005354 Bacteria 961
33 Ga0070674_100102606 3300005356 Bacteria 2086
34 Ga0070673_100245685 3300005364 Bacteria 1558
35 Ga0070659_100431903 3300005366 Bacteria 1115
36 Ga0070659_100906084 3300005366 Bacteria 771
37 Ga0070667_100071178 3300005367 Bacteria 2961
38 Ga0070667_100239191 3300005367 Bacteria 1621
39 Ga0070713_100151163 3300005436 Bacteria 2066
40 Ga0070710_10022058 3300005437 Bacteria 3327
41 Ga0070711_100063995 3300005439 Bacteria 2569
42 Ga0070663_100016778 3300005455 Bacteria 4765
43 Ga0070663_100318213 3300005455 Bacteria 1250
44 Ga0070678_100093668 3300005456 Bacteria 2310
45 Ga0070678_100204261 3300005456 Bacteria 1633
46 Ga0070678_100764768 3300005456 Bacteria 875
47 Ga0070662_100042885 3300005457 Bacteria 3233
48 Ga0070662_100136091 3300005457 Bacteria 1900
49 Ga0070662_100934945 3300005457 Bacteria 741
50 Ga0070681_10849517 3300005458 Bacteria 831
51 Ga0068867_100109824 3300005459 Bacteria 2118
52 Ga0070685_10051354 3300005466 Bacteria 2384
53 Ga0070707_100082155 3300005468 Bacteria 3111
54 Ga0070679_100044780 3300005530 Bacteria 4408
55 Ga0070684_100012430 3300005535 Bacteria 6823
56 Ga0070684_100306996 3300005535 Bacteria 1457
57 Ga0068853_100104000 3300005539 Bacteria 2514
58 Ga0068853_100129246 3300005539 Bacteria 2260
59 Ga0068853_100159652 3300005539 Bacteria 2033
60 Ga0068853_100434545 3300005539 Bacteria 1233
61 Ga0070672_100348617 3300005543 Bacteria 1262
62 Ga0070672_100366873 3300005543 Bacteria 1230
63 Ga0070686_100233782 3300005544 Bacteria 1335
64 Ga0070665_100022177 3300005548 Bacteria 6388
65 Ga0070665_100035947 3300005548 Bacteria 4983
66 Ga0070665_100094751 3300005548 Bacteria 2990
67 Ga0070665_100115196 3300005548 Bacteria 2690
68 Ga0070665_100347277 3300005548 Bacteria 1489
69 Ga0070665_100632906 3300005548 Bacteria 1083
70 Ga0070704_100429781 3300005549 Bacteria 1133
71 Ga0068855_100026374 3300005563 Bacteria 6950
72 Ga0068855_100055289 3300005563 Bacteria 4663
73 Ga0068855_100062940 3300005563 Bacteria 4330
74 Ga0068855_100074325 3300005563 Bacteria 3948
75 Ga0068855_100348936 3300005563 Bacteria 1630
76 Ga0068857_100059164 3300005577 Bacteria 3403
77 Ga0068857_100343928 3300005577 Bacteria 1380
78 Ga0068854_100003752 3300005578 Bacteria 9498
79 Ga0068854_100057756 3300005578 Bacteria 2799
80 Ga0068856_100055177 3300005614 Bacteria 3921
81 Ga0068856_100481908 3300005614 Bacteria 1261
82 Ga0070702_100012771 3300005615 Bacteria 4224
83 Ga0070702_100055804 3300005615 Bacteria 2279
84 Ga0068852_100055421 3300005616 Bacteria 3422
85 Ga0068852_100184633 3300005616 Bacteria 1963
86 Ga0068852_100932985 3300005616 Bacteria 886
87 Ga0068859_100205095 3300005617 Bacteria 2056
88 Ga0068864_100173508 3300005618 Bacteria 1967
89 Ga0068864_100222665 3300005618 Bacteria 1741
90 Ga0068866_10244039 3300005718 Bacteria 1095
91 Ga0068861_100033316 3300005719 Bacteria 3799
92 Ga0068861_100738305 3300005719 Bacteria 918
93 Ga0068851_10000408 3300005834 Bacteria 19412
94 Ga0068851_10053909 3300005834 Bacteria 2048
95 Ga0068870_10144331 3300005840 Bacteria 1396
96 Ga0068858_100076272 3300005842 Bacteria 3113
97 Ga0068858_100320732 3300005842 Bacteria 1481
98 Ga0068860_100075850 3300005843 Bacteria 3197
99 Ga0068862_100095534 3300005844 Bacteria 2593
100 Ga0068862_100617554 3300005844 Bacteria 1043
101 Ga0081455_10004129 3300005937 Bacteria 16422
102 Ga0081455_10007101 3300005937 Bacteria 11861
103 Ga0081455_10011042 3300005937 Bacteria 9097
104 Ga0081540_1005183 3300005983 Bacteria 9759
105 Ga0081540_1006399 3300005983 Bacteria 8584
106 Ga0081540_1009930 3300005983 Bacteria 6492
107 Ga0081540_1011637 3300005983 Bacteria 5867
108 Ga0081540_1014446 3300005983 Bacteria 5057
109 Ga0081540_1015921 3300005983 Bacteria 4739
110 Ga0081540_1093813 3300005983 Bacteria 1313
111 Ga0081539_10024516 3300005985 Bacteria 3910
112 Ga0081539_10099611 3300005985 Bacteria 1484
113 Ga0070717_10009120 3300006028 Bacteria 7451
114 Ga0075365_10086169 3300006038 Bacteria 2135
115 Ga0075363_100001418 3300006048 Bacteria 9077
116 Ga0075363_100024204 3300006048 Bacteria 3084
117 Ga0075363_100035377 3300006048 Bacteria 2613
118 Ga0075363_100188424 3300006048 Bacteria 1176
119 Ga0075363_100277586 3300006048 Bacteria 969
120 Ga0075364_10022004 3300006051 Bacteria 4022
121 Ga0075364_10109068 3300006051 Bacteria 1846
122 Ga0075362_10013703 3300006177 Bacteria 3252
123 Ga0075367_10037766 3300006178 Bacteria 2808
124 Ga0075367_10077526 3300006178 Bacteria 2006
125 Ga0075367_10170766 3300006178 Bacteria 1354
126 Ga0075369_10047057 3300006186 Bacteria 1859
127 Ga0075366_10067365 3300006195 Bacteria 2130
128 Ga0075366_10254910 3300006195 Bacteria 1070
129 Ga0097621_100294561 3300006237 Bacteria 1431
130 Ga0075370_10030969 3300006353 Bacteria 2985
131 Ga0075370_10038515 3300006353 Bacteria 2690
132 Ga0068871_100175062 3300006358 Bacteria 1841
133 Ga0068871_100500742 3300006358 Bacteria 1095
134 Ga0075428_100022218 3300006844 Bacteria 7024
135 Ga0075434_100251934 3300006871 Bacteria 1785
136 Ga0068865_100377886 3300006881 Bacteria 1155
137 Ga0068865_100423018 3300006881 Bacteria 1096
138 Ga0075436_100177277 3300006914 Bacteria 1506
139 Ga0097620_100205095 3300006931 Bacteria 2056
140 Ga0075435_100284264 3300007076 Bacteria 1412
141 Ga0099795_10040767 3300007788 Bacteria 1651
142 Ga0099795_10252748 3300007788 Bacteria 761
143 Ga0105244_10211006 3300009036 Bacteria 913
144 Ga0105250_10036541 3300009092 Bacteria 1971
145 Ga0105240_10019831 3300009093 Bacteria 8981
146 Ga0105240_10070563 3300009093 Bacteria 4321
147 Ga0111539_10054020 3300009094 Bacteria 4781
148 Ga0111539_10591297 3300009094 Bacteria 1292
149 Ga0105245_10208395 3300009098 Bacteria 1880
150 Ga0105245_10735091 3300009098 Bacteria 1022
151 Ga0105247_10078572 3300009101 Bacteria 2076
152 Ga0105247_10339011 3300009101 Bacteria 1054
153 Ga0105247_10505058 3300009101 Bacteria 881
154 Ga0114129_10298268 3300009147 Bacteria 2149
155 Ga0105243_10061651 3300009148 Bacteria 3000
156 Ga0105243_10553007 3300009148 Bacteria 1100
157 Ga0105243_10557773 3300009148 Bacteria 1096
158 Ga0105241_10056204 3300009174 Bacteria 3017
159 Ga0105242_10188769 3300009176 Bacteria 1823
160 Ga0105242_10331416 3300009176 Bacteria 1399
161 Ga0105248_10074328 3300009177 Bacteria 3820
162 Ga0105248_10730383 3300009177 Bacteria 1117
163 Ga0105248_10788845 3300009177 Bacteria 1072
164 Ga0105237_10456579 3300009545 Bacteria 1283
165 Ga0105237_10576029 3300009545 Bacteria 1133
166 Ga0105237_10625293 3300009545 Bacteria 1084
167 Ga0105237_11071365 3300009545 Bacteria 813
168 Ga0105238_10005518 3300009551 Bacteria 12492
169 Ga0105238_10035767 3300009551 Bacteria 5049
170 Ga0105238_10416457 3300009551 Bacteria 1338
171 Ga0105238_11390016 3300009551 Bacteria 729
172 Ga0105239_10343931 3300010375 Bacteria 1684
173 Ga0105246_10178855 3300011119 Bacteria 1631
174 Ga0105246_10732238 3300011119 Bacteria 870
175 Ga0157373_10663523 3300013100 Bacteria 762
176 Ga0157370_10123520 3300013104 Bacteria 2417
177 Ga0157374_10108347 3300013296 Bacteria 2670
178 Ga0157374_10212674 3300013296 Bacteria 1896
179 Ga0157374_10218167 3300013296 Bacteria 1871
180 Ga0157378_10184467 3300013297 Bacteria 1964
181 Ga0157378_11032859 3300013297 Bacteria 857
182 Ga0157372_11070507 3300013307 Bacteria 933
183 Ga0157375_10246663 3300013308 Bacteria 1946
184 Ga0157375_11233080 3300013308 Bacteria 878
185 Ga0163163_10196731 3300014325 Bacteria 2064
186 Ga0157380_10154863 3300014326 Bacteria 1985
187 Ga0157380_10323553 3300014326 Bacteria 1431
188 Ga0157377_10287795 3300014745 Bacteria 1080
189 Ga0157379_10149234 3300014968 Bacteria 2109
190 Ga0157379_10267749 3300014968 Bacteria 1553
191 Ga0157379_10566607 3300014968 Bacteria 1058
192 Ga0157376_10152544 3300014969 Bacteria 2085
193 Ga0163161_10162422 3300017792 Bacteria 1704
194 Ga0163161_10291639 3300017792 Bacteria 1282
195 Ga0209758_1003838 3300025297 Bacteria 13189
196 Ga0209758_1007917 3300025297 Bacteria 7053
197 Ga0207697_10101856 3300025315 Bacteria 1224
198 Ga0207656_10005406 3300025321 Bacteria 4512
199 Ga0207642_10112696 3300025899 Bacteria 1388
200 Ga0207710_10101197 3300025900 Bacteria 1359
201 Ga0207688_10110029 3300025901 Bacteria 1598
202 Ga0207680_10204990 3300025903 Bacteria 1346
203 Ga0207647_10001150 3300025904 Bacteria 20374
204 Ga0207647_10362534 3300025904 Bacteria 820
205 Ga0207645_10022525 3300025907 Bacteria 4097
206 Ga0207645_10263631 3300025907 Bacteria 1142
207 Ga0207643_10079148 3300025908 Bacteria 1902
208 Ga0207654_10000058 3300025911 Bacteria 75628
209 Ga0207695_10000453 3300025913 Bacteria 89314
210 Ga0207695_10066247 3300025913 Bacteria 3710
211 Ga0207695_10131408 3300025913 Bacteria 2461
212 Ga0207671_10124157 3300025914 Bacteria 1976
213 Ga0207660_10093789 3300025917 Bacteria 2231
214 Ga0207657_10722564 3300025919 Bacteria 773
215 Ga0207652_10122654 3300025921 Bacteria 2313
216 Ga0207694_10001512 3300025924 Bacteria 19799
217 Ga0207650_10312948 3300025925 Bacteria 1285
218 Ga0207687_10116362 3300025927 Bacteria 1993
219 Ga0207687_11117439 3300025927 Bacteria 677
220 Ga0207664_10374193 3300025929 Bacteria 1264
221 Ga0207644_10198077 3300025931 Bacteria 1583
222 Ga0207690_10343839 3300025932 Bacteria 1178
223 Ga0207706_10115646 3300025933 Bacteria 2359
224 Ga0207706_10848324 3300025933 Bacteria 774
225 Ga0207709_10206402 3300025935 Bacteria 1407
226 Ga0207709_10649889 3300025935 Bacteria 839
227 Ga0207670_10009317 3300025936 Bacteria 5598
228 Ga0207669_10566818 3300025937 Bacteria 918
229 Ga0207704_10008040 3300025938 Bacteria 5018
230 Ga0207691_10097203 3300025940 Bacteria 2632
231 Ga0207711_10359394 3300025941 Bacteria 1349
232 Ga0207711_10662516 3300025941 Bacteria 974
233 Ga0207689_10056391 3300025942 Bacteria 3233
234 Ga0207689_10167637 3300025942 Bacteria 1809
235 Ga0207667_10007600 3300025949 Bacteria 12999
236 Ga0207667_10058734 3300025949 Bacteria 4032
237 Ga0207667_10466636 3300025949 Bacteria 1282
238 Ga0207667_10853950 3300025949 Bacteria 904
239 Ga0207651_10242049 3300025960 Bacteria 1471
240 Ga0207651_10622041 3300025960 Bacteria 946
241 Ga0207712_10370545 3300025961 Bacteria 1196
242 Ga0207668_10031635 3300025972 Bacteria 3487
243 Ga0207668_10335360 3300025972 Bacteria 1259
244 Ga0207640_10013128 3300025981 Bacteria 4738
245 Ga0207640_10038241 3300025981 Bacteria 3026
246 Ga0207640_10078319 3300025981 Bacteria 2249
247 Ga0207658_10635316 3300025986 Bacteria 961
248 Ga0207677_10278054 3300026023 Bacteria 1373
249 Ga0207703_10029876 3300026035 Bacteria 4303
250 Ga0207703_10197973 3300026035 Bacteria 1784
251 Ga0207703_10257829 3300026035 Bacteria 1575
252 Ga0207639_10041951 3300026041 Bacteria 3427
253 Ga0207639_10073450 3300026041 Bacteria 2681
254 Ga0207639_10090193 3300026041 Bacteria 2451
255 Ga0207639_10750501 3300026041 Bacteria 907
256 Ga0207678_10046422 3300026067 Bacteria 3756
257 Ga0207678_10061814 3300026067 Bacteria 3221
258 Ga0207678_10064888 3300026067 Bacteria 3137
259 Ga0207678_10122717 3300026067 Bacteria 2217
260 Ga0207678_10140716 3300026067 Bacteria 2059
261 Ga0207708_10081953 3300026075 Bacteria 2480
262 Ga0207708_10402323 3300026075 Bacteria 1132
263 Ga0207702_10000004 3300026078 Bacteria 422182
264 Ga0207702_10009402 3300026078 Bacteria 8209
265 Ga0207641_10126124 3300026088 Bacteria 2292
266 Ga0207641_10675132 3300026088 Bacteria 1016
267 Ga0207641_10743882 3300026088 Bacteria 968
268 Ga0207648_10023188 3300026089 Bacteria 5566
269 Ga0207648_10275971 3300026089 Bacteria 1503
270 Ga0207676_10209316 3300026095 Bacteria 1729
271 Ga0207674_10000890 3300026116 Bacteria 39065
272 Ga0207674_10012685 3300026116 Bacteria 9415
273 Ga0207674_10262464 3300026116 Bacteria 1674
274 Ga0207675_100112919 3300026118 Bacteria 2565
275 Ga0207683_10056479 3300026121 Bacteria 3443
276 Ga0207683_10059388 3300026121 Bacteria 3359
277 Ga0207683_10187778 3300026121 Bacteria 1875
278 Ga0207698_10063006 3300026142 Bacteria 2899
279 Ga0207698_10138145 3300026142 Bacteria 2094
280 Ga0209813_10024248 3300027866 Bacteria 1733
281 Ga0268266_10001190 3300028379 Bacteria 32120
282 Ga0268266_10003966 3300028379 Bacteria 14358
283 Ga0268266_10318659 3300028379 Bacteria 1455
284 Ga0268266_10504799 3300028379 Bacteria 1155
285 Ga0268264_10088565 3300028381 Bacteria 2664
286 Ga0307517_10001338 3300028786 Bacteria 41372
287 Ga0307517_10278341 3300028786 Bacteria 956
288 Ga0307511_10243079 3300030521 Bacteria 875
289 Ga0265330_10034200 3300031235 Bacteria 2271
290 Ga0265332_10055871 3300031238 Bacteria 1692
291 Ga0265328_10058220 3300031239 Bacteria 1419
292 Ga0265340_10025938 3300031247 Bacteria 2965
293 Ga0265316_10389342 3300031344 Bacteria 1005
294 Ga0307513_10292358 3300031456 Bacteria 1400
295 Ga0307509_10168707 3300031507 Bacteria 2072
296 Ga0307509_10577345 3300031507 Bacteria 799
297 Ga0307516_10219715 3300031730 Bacteria 1610
298 Ga0307405_10411947 3300031731 Bacteria 1061
299 Ga0307413_10038452 3300031824 Bacteria 2774
300 Ga0307412_10275164 3300031911 Bacteria 1319
301 Ga0307412_11208678 3300031911 Bacteria 677
302 Ga0307409_100438250 3300031995 Bacteria 1258
303 Ga0307409_100483087 3300031995 Bacteria 1202
304 Ga0307411_10130416 3300032005 Bacteria 1836
305 Ga0307415_100325089 3300032126 Bacteria 1284
306 Ga0307510_10001271 3300033180 Bacteria 27493
307 Ga0307510_10043589 3300033180 Bacteria 4875
308 Ga0373954_0058546 3300035118 Bacteria 1815
309 Ga0373927_0230191 3300035695 Bacteria 1218
310 Ga0373933_0000031 3300035724 Bacteria 85038
311 Ga0373933_0196265 3300035724 Bacteria 1291
312 Ga0373937_0046264 3300036401 Bacteria 3979
313 Ga0395899_0100188 3300037312 Bacteria 2092
314 Ga0395900_0081148 3300037418 Bacteria 3332
315 Ga0395905_0779649 3300037471 Bacteria 859
316 Ga0439448_0088874 3300042005 Bacteria 1043
317 Ga0451576_0676949 3300045051 Bacteria 1084
318 Ga0466967_0623114 3300045976 Bacteria 1066
319 Ga0495603_0015386 3300046455 Bacteria 4628
320 Ga0495603_0025650 3300046455 Bacteria 3564
321 Ga0495603_0096703 3300046455 Bacteria 1725
322 Ga0495590_0034524 3300046457 Bacteria 1766
323 Ga0495591_066054 3300046458 Bacteria 950
324 Ga0495629_0040530 3300046459 Bacteria 3276
325 Ga0495638_0080333 3300046460 Bacteria 1981
326 Ga0495641_0042320 3300046461 Bacteria 2112
327 Ga0495582_0404588 3300046473 Bacteria 787
328 Ga0495605_0104917 3300046474 Bacteria 1295
329 Ga0495584_0039800 3300046491 Bacteria 2375
330 Ga0495585_0059225 3300046492 Bacteria 2111
331 Ga0495585_0099602 3300046492 Bacteria 1555
332 Ga0495594_0072086 3300046499 Bacteria 1921
333 Ga0495594_0397479 3300046499 Bacteria 784
334 Ga0495583_0034391 3300046506 Bacteria 2428
335 Ga0495606_0157649 3300046507 Bacteria 1327
336 Ga0495606_0363226 3300046507 Bacteria 765
337 Ga0495606_0456612 3300046507 Bacteria 653
338 Ga0495620_0082385 3300046515 Bacteria 1300
339 Ga0495620_0090121 3300046515 Bacteria 1231
340 Ga0495632_0090373 3300046519 Bacteria 1452
341 Ga0495632_0139354 3300046519 Bacteria 1126
342 Ga0495632_0307106 3300046519 Bacteria 702
343 Ga0495644_0055137 3300046523 Bacteria 1493
344 Ga0495644_0084592 3300046523 Bacteria 1196
345 Ga0495663_0113672 3300046525 Bacteria 901
346 Ga0495666_0055322 3300046526 Bacteria 1902
347 Ga0495642_0058689 3300046528 Bacteria 1594
348 Ga0495598_0023245 3300046537 Bacteria 1667
349 Ga0495621_0037585 3300046539 Bacteria 1684
350 Ga0495622_0016497 3300046557 Bacteria 3440
351 Ga0495633_0023633 3300046558 Bacteria 3043
352 Ga0495633_0230315 3300046558 Bacteria 847
353 Ga0495656_0010968 3300046615 Bacteria 3313
354 Ga0495656_0033230 3300046615 Bacteria 2104
355 Ga0495656_0139185 3300046615 Bacteria 1162
356 Ga0495611_0028936 3300046648 Bacteria 2428
357 Ga0495625_0327531 3300046660 Bacteria 974
358 Ga0495625_0422690 3300046660 Bacteria 828
359 Ga0495659_0011528 3300046664 Bacteria 2848
360 Ga0495659_0011645 3300046664 Bacteria 2834
361 Ga0495659_0024645 3300046664 Bacteria 2053
362 Ga0495661_0139551 3300046665 Bacteria 1320
363 Ga0495588_0015061 3300046674 Bacteria 3714
364 Ga0495658_0206415 3300046683 Bacteria 1226
365 Ga0495669_0023468 3300046684 Bacteria 2685
366 Ga0495670_0021268 3300046691 Bacteria 3199
367 Ga0495671_0139525 3300046692 Bacteria 1181
368 Ga0495589_0075529 3300046794 Bacteria 1643
369 Ga0495636_0047517 3300047318 Bacteria 1792
370 Ga0495672_0037014 3300047320 Bacteria 2990
371 Ga0495676_0213437 3300047321 Bacteria 1334
372 Ga0495683_0128992 3300047323 Bacteria 1194
373 Ga0495677_0034964 3300047445 Bacteria 1834
374 Ga0495679_040427 3300047446 Bacteria 1450
375 Ga0495681_0109677 3300047470 Bacteria 1197
376 Ga0495593_0195138 3300047673 Bacteria 1018
377 Ga0495615_0039525 3300048090 Bacteria 1171
378 Ga0496100_0401208 3300048903 Bacteria 1044
379 Ga0496101_0100995 3300048904 Bacteria 2159
380 Ga0496102_0182181 3300048905 Bacteria 1979
381 Ga0496102_0223362 3300048905 Bacteria 1776
382 Ga0496102_0262686 3300048905 Bacteria 1628
383 Ga0496102_0510473 3300048905 Bacteria 1124
384 Ga0496103_0344186 3300048906 Bacteria 959
385 Ga0496104_0152979 3300048907 Bacteria 2214
386 Ga0496104_0221400 3300048907 Bacteria 1805
387 Ga0496106_0101788 3300048909 Bacteria 2228
388 Ga0496106_0192399 3300048909 Bacteria 1622
389 Ga0496106_0461618 3300048909 Bacteria 1020
390 Ga0496107_0048005 3300048910 Bacteria 3075
391 Ga0496107_0149528 3300048910 Bacteria 1727
392 Ga0496108_0116469 3300048911 Bacteria 2289
393 Ga0496109_0128618 3300048912 Bacteria 2363
394 Ga0496109_0842954 3300048912 Bacteria 854
395 Ga0496110_0244413 3300048913 Bacteria 1633
396 Ga0496110_0847324 3300048913 Bacteria 819
397 Ga0496111_0154673 3300048914 Bacteria 1702
398 Ga0496111_0232625 3300048914 Bacteria 1369
399 Ga0496112_0105467 3300048915 Bacteria 2788
400 Ga0496112_0372197 3300048915 Bacteria 1370
401 Ga0496113_0015561 3300048916 Bacteria 5233
402 Ga0496113_0430142 3300048916 Bacteria 1060
403 Ga0496114_0516683 3300048917 Bacteria 1056
404 Ga0496115_0098213 3300048918 Bacteria 2398
405 Ga0496118_0179431 3300048921 Bacteria 1281
406 Ga0496118_0226509 3300048921 Bacteria 1083
407 Ga0496125_0245032 3300048928 Bacteria 1135
408 Ga0496126_0002460 3300048929 Bacteria 24974
409 Ga0496126_0050930 3300048929 Bacteria 3773
410 Ga0496126_0176271 3300048929 Bacteria 1818
411 Ga0496126_0195213 3300048929 Bacteria 1712
412 Ga0495682_0121028 3300049460 Bacteria 937
413 Ga0501032_0032946 3300049569 Bacteria 3551
414 Ga0501032_0419689 3300049569 Bacteria 858
415 Ga0501033_0533828 3300049570 Bacteria 809
416 Ga0501034_0045067 3300049571 Bacteria 4458
417 Ga0501036_0243620 3300049572 Bacteria 1507
418 Ga0501038_0461395 3300049574 Bacteria 976
419 Ga0501039_0529898 3300049575 Bacteria 925
420 Ga0501047_0154913 3300049581 Bacteria 2165
421 Ga0501048_0260943 3300049582 Bacteria 1231
422 Ga0501069_0397578 3300049585 Bacteria 815
423 Ga0501070_0084261 3300049586 Bacteria 2632
424 Ga0501079_0403465 3300049741 Bacteria 1072
425 Ga0501079_0426050 3300049741 Bacteria 1042
426 Ga0501035_0099746 3300049822 Bacteria 2549
427 Ga0501044_0105366 3300049823 Bacteria 2833
428 Ga0501044_0156223 3300049823 Bacteria 2260
429 nmdc:mga03683_432866_c1 3300050489 Bacteria 631
430 nmdc:mga03n38_20190_c1 3300050490 Bacteria 1624
431 nmdc:mga03n38_343072_c1 3300050490 Bacteria 811
432 nmdc:mga0yw44_165494_c1 3300050492 Bacteria 1450
433 nmdc:mga0k408_205498_c1 3300050493 Bacteria 1176
434 nmdc:mga0k408_246831_c1 3300050493 Bacteria 1066
435 nmdc:mga0k408_45110_c1 3300050493 Bacteria 2543
436 nmdc:mga06z11_54791_c1 3300050494 Bacteria 2057
437 nmdc:mga04h51_251967_c1 3300050495 Bacteria 708
438 nmdc:mga07m45_23488_c1 3300050496 Bacteria 3371
439 nmdc:mga07m45_4388_c1 3300050496 Bacteria 6902
440 nmdc:mga05p37_213719_c1 3300050507 Bacteria 2330
441 nmdc:mga0qj67_502945_c1 3300050509 Bacteria 974
442 nmdc:mga08y16_1434773_c1 3300050511 Bacteria 652
443 nmdc:mga08y16_96350_c1 3300050511 Bacteria 3081
444 nmdc:mga0rr50_292057_c1 3300050513 Bacteria 1362
445 nmdc:mga0a205_852013_c1 3300050515 Bacteria 758
446 Ga0500635_0024824 3300053080 Bacteria 1884
447 Ga0495655_0048070 3300053083 Bacteria 1119
448 Ga0495619_0642703 3300053085 Bacteria 724
449 Ga0500566_0000151 3300053094 Bacteria 35674
450 Ga0500566_0003924 3300053094 Bacteria 8868
451 Ga0500641_0002993 3300053096 Bacteria 5985
452 Ga0500641_0017212 3300053096 Bacteria 2700
453 Ga0500554_036882 3300053102 Bacteria 1479
454 Ga0500555_044303 3300053103 Bacteria 1232
455 Ga0500556_0057921 3300053104 Bacteria 1420
456 Ga0500562_069306 3300053108 Bacteria 951
457 Ga0500591_130324 3300053115 Bacteria 1015
458 Ga0500595_000265 3300053119 Bacteria 34660
459 Ga0500595_009408 3300053119 Bacteria 3945
460 Ga0500642_0281570 3300053130 Bacteria 755
461 Ga0500658_0102250 3300053134 Bacteria 1252
462 Ga0500559_0046555 3300053136 Bacteria 1902
463 Ga0500589_093782 3300053147 Bacteria 1316
464 Ga0500590_037600 3300053148 Bacteria 2500
465 Ga0500603_000295 3300053150 Bacteria 13130
466 Ga0500603_038954 3300053150 Bacteria 1260
467 Ga0500603_067870 3300053150 Bacteria 1010
468 Ga0500619_087407 3300053154 Bacteria 1051
469 Ga0500630_032801 3300053159 Bacteria 2548
470 Ga0500638_000539 3300053162 Bacteria 9511
471 Ga0500638_008140 3300053162 Bacteria 4450
472 Ga0500637_0113623 3300053178 Bacteria 1570
473 Ga0500645_041562 3300053730 Bacteria 1357
474 Ga0500596_002798 3300053735 Bacteria 3408
475 2513695096 2513237101 Bacteria 7952346
476 2723841628 2721755755 Bacteria 8322773
477 2728754975 2728368998 Bacteria 8720350
478 2793082764
479 2874608078 2874604998 Bacteria 7834745
480 2876810839 2876808645 Bacteria 8824342
481 2879112157 2879110137 Bacteria 8907982
482 2889035505 2889033259 Bacteria 9099371
483 2922364014 2922361189 Bacteria 7436256
484 2922392552 2922386360 Bacteria 7017218
485 8006969346 8006964411 Bacteria 8966052
486 8006990908 8006984368 Bacteria 9651211
487 8006996525 8006994254 Bacteria 8309700
488 8056675729 8056673599 Bacteria 7871253
489 Ga0157378_10300043
490 JGI24740J21852_10011431
491 JGI24737J22298_10004677
492 JGI25153J46596_10002154
493 rootL2_10276346
494 JGI25405J52794_10017838
495 Ga0070658_10103088
496 Ga0070676_10048724
497 Ga0070683_100033682
498 Ga0070690_100072006
499 Ga0070690_100076091
500 Ga0070690_100558767
501 Ga0070670_100275077
502 Ga0070670_100346957
503 Ga0068869_100146032
504 Ga0070666_10194547
505 Ga0070680_100233288
506 Ga0070682_100152780
507 Ga0068868_100073327
508 Ga0068868_100087203
509 Ga0068868_100210208
510 Ga0070660_100196631
511 Ga0070660_100393644
512 Ga0070689_100188208
513 Ga0070691_10217059
514 Ga0070687_100185719
515 Ga0070668_100012183
516 Ga0070668_100065341
517 Ga0070668_100398625
518 Ga0070669_100297810
519 Ga0070675_100240544
520 Ga0070675_100647018
521 Ga0070674_100102606
522 Ga0070673_100245685
523 Ga0070659_100431903
524 Ga0070659_100906084
525 Ga0070667_100071178
526 Ga0070667_100239191
527 Ga0070713_100151163
528 Ga0070710_10022058
529 Ga0070711_100063995
530 Ga0070663_100016778
531 Ga0070663_100318213
532 Ga0070678_100093668
533 Ga0070678_100204261
534 Ga0070678_100764768
535 Ga0070662_100042885
536 Ga0070662_100136091
537 Ga0070662_100934945
538 Ga0070681_10849517
539 Ga0068867_100109824
540 Ga0070685_10051354
541 Ga0070707_100082155
542 Ga0070679_100044780
543 Ga0070684_100012430
544 Ga0070684_100306996
545 Ga0068853_100104000
546 Ga0068853_100129246
547 Ga0068853_100159652
548 Ga0068853_100434545
549 Ga0070672_100348617
550 Ga0070672_100366873
551 Ga0070686_100233782
552 Ga0070665_100022177
553 Ga0070665_100035947
554 Ga0070665_100094751
555 Ga0070665_100115196
556 Ga0070665_100347277
557 Ga0070665_100632906
558 Ga0070704_100429781
559 Ga0068855_100026374
560 Ga0068855_100055289
561 Ga0068855_100062940
562 Ga0068855_100074325
563 Ga0068855_100348936
564 Ga0068857_100059164
565 Ga0068857_100343928
566 Ga0068854_100003752
567 Ga0068854_100057756
568 Ga0068856_100055177
569 Ga0068856_100481908
570 Ga0070702_100012771
571 Ga0070702_100055804
572 Ga0068852_100055421
573 Ga0068852_100184633
574 Ga0068852_100932985
575 Ga0068859_100205095
576 Ga0068864_100173508
577 Ga0068864_100222665
578 Ga0068866_10244039
579 Ga0068861_100033316
580 Ga0068861_100738305
581 Ga0068851_10000408
582 Ga0068851_10053909
583 Ga0068870_10144331
584 Ga0068858_100076272
585 Ga0068858_100320732
586 Ga0068860_100075850
587 Ga0068862_100095534
588 Ga0068862_100617554
589 Ga0081455_10004129
590 Ga0081455_10007101
591 Ga0081455_10011042
592 Ga0081540_1005183
593 Ga0081540_1006399
594 Ga0081540_1009930
595 Ga0081540_1011637
596 Ga0081540_1014446
597 Ga0081540_1015921
598 Ga0081540_1093813
599 Ga0081539_10024516
600 Ga0081539_10099611
601 Ga0070717_10009120
602 Ga0075365_10086169
603 Ga0075363_100001418
604 Ga0075363_100024204
605 Ga0075363_100035377
606 Ga0075363_100188424
607 Ga0075363_100277586
608 Ga0075364_10022004
609 Ga0075364_10109068
610 Ga0075362_10013703
611 Ga0075367_10037766
612 Ga0075367_10077526
613 Ga0075367_10170766
614 Ga0075369_10047057
615 Ga0075366_10067365
616 Ga0075366_10254910
617 Ga0097621_100294561
618 Ga0075370_10030969
619 Ga0075370_10038515
620 Ga0068871_100175062
621 Ga0068871_100500742
622 Ga0075428_100022218
623 Ga0075434_100251934
624 Ga0068865_100377886
625 Ga0068865_100423018
626 Ga0075436_100177277
627 Ga0097620_100205095
628 Ga0075435_100284264
629 Ga0099795_10040767
630 Ga0099795_10252748
631 Ga0105244_10211006
632 Ga0105250_10036541
633 Ga0105240_10019831
634 Ga0105240_10070563
635 Ga0111539_10054020
636 Ga0111539_10591297
637 Ga0105245_10208395
638 Ga0105245_10735091
639 Ga0105247_10078572
640 Ga0105247_10339011
641 Ga0105247_10505058
642 Ga0114129_10298268
643 Ga0105243_10061651
644 Ga0105243_10553007
645 Ga0105243_10557773
646 Ga0105241_10056204
647 Ga0105242_10188769
648 Ga0105242_10331416
649 Ga0105248_10074328
650 Ga0105248_10730383
651 Ga0105248_10788845
652 Ga0105237_10456579
653 Ga0105237_10576029
654 Ga0105237_10625293
655 Ga0105237_11071365
656 Ga0105238_10005518
657 Ga0105238_10035767
658 Ga0105238_10416457
659 Ga0105238_11390016
660 Ga0105239_10343931
661 Ga0105246_10178855
662 Ga0105246_10732238
663 Ga0157373_10663523
664 Ga0157370_10123520
665 Ga0157374_10108347
666 Ga0157374_10212674
667 Ga0157374_10218167
668 Ga0157378_10184467
669 Ga0157378_11032859
670 Ga0157372_11070507
671 Ga0157375_10246663
672 Ga0157375_11233080
673 Ga0163163_10196731
674 Ga0157380_10154863
675 Ga0157380_10323553
676 Ga0157377_10287795
677 Ga0157379_10149234
678 Ga0157379_10267749
679 Ga0157379_10566607
680 Ga0157376_10152544
681 Ga0163161_10162422
682 Ga0163161_10291639
683 Ga0209758_1003838
684 Ga0209758_1007917
685 Ga0207697_10101856
686 Ga0207656_10005406
687 Ga0207642_10112696
688 Ga0207710_10101197
689 Ga0207688_10110029
690 Ga0207680_10204990
691 Ga0207647_10001150
692 Ga0207647_10362534
693 Ga0207645_10022525
694 Ga0207645_10263631
695 Ga0207643_10079148
696 Ga0207654_10000058
697 Ga0207695_10000453
698 Ga0207695_10066247
699 Ga0207695_10131408
700 Ga0207671_10124157
701 Ga0207660_10093789
702 Ga0207657_10722564
703 Ga0207652_10122654
704 Ga0207694_10001512
705 Ga0207650_10312948
706 Ga0207687_10116362
707 Ga0207687_11117439
708 Ga0207664_10374193
709 Ga0207644_10198077
710 Ga0207690_10343839
711 Ga0207706_10115646
712 Ga0207706_10848324
713 Ga0207709_10206402
714 Ga0207709_10649889
715 Ga0207670_10009317
716 Ga0207669_10566818
717 Ga0207704_10008040
718 Ga0207691_10097203
719 Ga0207711_10359394
720 Ga0207711_10662516
721 Ga0207689_10056391
722 Ga0207689_10167637
723 Ga0207667_10007600
724 Ga0207667_10058734
725 Ga0207667_10466636
726 Ga0207667_10853950
727 Ga0207651_10242049
728 Ga0207651_10622041
729 Ga0207712_10370545
730 Ga0207668_10031635
731 Ga0207668_10335360
732 Ga0207640_10013128
733 Ga0207640_10038241
734 Ga0207640_10078319
735 Ga0207658_10635316
736 Ga0207677_10278054
737 Ga0207703_10029876
738 Ga0207703_10197973
739 Ga0207703_10257829
740 Ga0207639_10041951
741 Ga0207639_10073450
742 Ga0207639_10090193
743 Ga0207639_10750501
744 Ga0207678_10046422
745 Ga0207678_10061814
746 Ga0207678_10064888
747 Ga0207678_10122717
748 Ga0207678_10140716
749 Ga0207708_10081953
750 Ga0207708_10402323
751 Ga0207702_10000004
752 Ga0207702_10009402
753 Ga0207641_10126124
754 Ga0207641_10675132
755 Ga0207641_10743882
756 Ga0207648_10023188
757 Ga0207648_10275971
758 Ga0207676_10209316
759 Ga0207674_10000890
760 Ga0207674_10012685
761 Ga0207674_10262464
762 Ga0207675_100112919
763 Ga0207683_10056479
764 Ga0207683_10059388
765 Ga0207683_10187778
766 Ga0207698_10063006
767 Ga0207698_10138145
768 Ga0209813_10024248
769 Ga0268266_10001190
770 Ga0268266_10003966
771 Ga0268266_10318659
772 Ga0268266_10504799
773 Ga0268264_10088565
774 Ga0307517_10001338
775 Ga0307517_10278341
776 Ga0307511_10243079
777 Ga0265330_10034200
778 Ga0265332_10055871
779 Ga0265328_10058220
780 Ga0265340_10025938
781 Ga0265316_10389342
782 Ga0307513_10292358
783 Ga0307509_10168707
784 Ga0307509_10577345
785 Ga0307516_10219715
786 Ga0307405_10411947
787 Ga0307413_10038452
788 Ga0307412_10275164
789 Ga0307412_11208678
790 Ga0307409_100438250
791 Ga0307409_100483087
792 Ga0307411_10130416
793 Ga0307415_100325089
794 Ga0307510_10001271
795 Ga0307510_10043589
796 Ga0373954_0058546
797 Ga0373927_0230191
798 Ga0373933_0000031
799 Ga0373933_0196265
800 Ga0373937_0046264
801 Ga0395899_0100188
802 Ga0395900_0081148
803 Ga0395905_0779649
804 Ga0439448_0088874
805 Ga0451576_0676949
806 Ga0466967_0623114
807 Ga0495603_0015386
808 Ga0495603_0025650
809 Ga0495603_0096703
810 Ga0495590_0034524
811 Ga0495591_066054
812 Ga0495629_0040530
813 Ga0495638_0080333
814 Ga0495641_0042320
815 Ga0495582_0404588
816 Ga0495605_0104917
817 Ga0495584_0039800
818 Ga0495585_0059225
819 Ga0495585_0099602
820 Ga0495594_0072086
821 Ga0495594_0397479
822 Ga0495583_0034391
823 Ga0495606_0157649
824 Ga0495606_0363226
825 Ga0495606_0456612
826 Ga0495620_0082385
827 Ga0495620_0090121
828 Ga0495632_0090373
829 Ga0495632_0139354
830 Ga0495632_0307106
831 Ga0495644_0055137
832 Ga0495644_0084592
833 Ga0495663_0113672
834 Ga0495666_0055322
835 Ga0495642_0058689
836 Ga0495598_0023245
837 Ga0495621_0037585
838 Ga0495622_0016497
839 Ga0495633_0023633
840 Ga0495633_0230315
841 Ga0495656_0010968
842 Ga0495656_0033230
843 Ga0495656_0139185
844 Ga0495611_0028936
845 Ga0495625_0327531
846 Ga0495625_0422690
847 Ga0495659_0011528
848 Ga0495659_0011645
849 Ga0495659_0024645
850 Ga0495661_0139551
851 Ga0495588_0015061
852 Ga0495658_0206415
853 Ga0495669_0023468
854 Ga0495670_0021268
855 Ga0495671_0139525
856 Ga0495589_0075529
857 Ga0495636_0047517
858 Ga0495672_0037014
859 Ga0495676_0213437
860 Ga0495683_0128992
861 Ga0495677_0034964
862 Ga0495679_040427
863 Ga0495681_0109677
864 Ga0495593_0195138
865 Ga0495615_0039525
866 Ga0496100_0401208
867 Ga0496101_0100995
868 Ga0496102_0182181
869 Ga0496102_0223362
870 Ga0496102_0262686
871 Ga0496102_0510473
872 Ga0496103_0344186
873 Ga0496104_0152979
874 Ga0496104_0221400
875 Ga0496106_0101788
876 Ga0496106_0192399
877 Ga0496106_0461618
878 Ga0496107_0048005
879 Ga0496107_0149528
880 Ga0496108_0116469
881 Ga0496109_0128618
882 Ga0496109_0842954
883 Ga0496110_0244413
884 Ga0496110_0847324
885 Ga0496111_0154673
886 Ga0496111_0232625
887 Ga0496112_0105467
888 Ga0496112_0372197
889 Ga0496113_0015561
890 Ga0496113_0430142
891 Ga0496114_0516683
892 Ga0496115_0098213
893 Ga0496118_0179431
894 Ga0496118_0226509
895 Ga0496125_0245032
896 Ga0496126_0002460
897 Ga0496126_0050930
898 Ga0496126_0176271
899 Ga0496126_0195213
900 Ga0495682_0121028
901 Ga0501032_0032946
902 Ga0501032_0419689
903 Ga0501033_0533828
904 Ga0501034_0045067
905 Ga0501036_0243620
906 Ga0501038_0461395
907 Ga0501039_0529898
908 Ga0501047_0154913
909 Ga0501048_0260943
910 Ga0501069_0397578
911 Ga0501070_0084261
912 Ga0501079_0403465
913 Ga0501079_0426050
914 Ga0501035_0099746
915 Ga0501044_0105366
916 Ga0501044_0156223
917 nmdc:mga03683_432866_c1
918 nmdc:mga03n38_20190_c1
919 nmdc:mga03n38_343072_c1
920 nmdc:mga0yw44_165494_c1
921 nmdc:mga0k408_205498_c1
922 nmdc:mga0k408_246831_c1
923 nmdc:mga0k408_45110_c1
924 nmdc:mga06z11_54791_c1
925 nmdc:mga04h51_251967_c1
926 nmdc:mga07m45_23488_c1
927 nmdc:mga07m45_4388_c1
928 nmdc:mga05p37_213719_c1
929 nmdc:mga0qj67_502945_c1
930 nmdc:mga08y16_1434773_c1
931 nmdc:mga08y16_96350_c1
932 nmdc:mga0rr50_292057_c1
933 nmdc:mga0a205_852013_c1
934 Ga0500635_0024824
935 Ga0495655_0048070
936 Ga0495619_0642703
937 Ga0500566_0000151
938 Ga0500566_0003924
939 Ga0500641_0002993
940 Ga0500641_0017212
941 Ga0500554_036882
942 Ga0500555_044303
943 Ga0500556_0057921
944 Ga0500562_069306
945 Ga0500591_130324
946 Ga0500595_000265
947 Ga0500595_009408
948 Ga0500642_0281570
949 Ga0500658_0102250
950 Ga0500559_0046555
951 Ga0500589_093782
952 Ga0500590_037600
953 Ga0500603_000295
954 Ga0500603_038954
955 Ga0500603_067870
956 Ga0500619_087407
957 Ga0500630_032801
958 Ga0500638_000539
959 Ga0500638_008140
960 Ga0500637_0113623
961 Ga0500645_041562
962 Ga0500596_002798
963 2513695096
964 2723841628
965 2728754975
966 2793082764
967 2874608078
968 2876810839
969 2879112157
970 2889035505
971 2922364014
972 2922392552
973 8006969346
974 8006990908
975 8006996525
976 8056675729

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01713

Smr

Smr domain

95

181

0.93

Map