F453590

General Info

Members Datasets Scaffolds Average Seq Length
488 205 976 319

Family's Representative Sequence

Representative Sequence 3300006914|Ga0075436_100151060|Ga0075436_1001510602
Length 343
Sequence MPIELVAFVATVAAILTAYAAMTRLPGIIAARRLDRRLRDVTIRDTARVDAPARPVPGSRDDRMTDGDGPASSQTAAETVVKRRAEGPLPSLDRRLAASTLSRLIEQSGVPTTPSAILVICFGGGLAAGLAASVMVRQAFVAPIAALFGACAPIVFLMRRRTIRVKRFEEQFPEALDLLSRAIRAGHAFQTAMGMVADELPAPVGPEFRKTFDQQNYGLPLPDALRELADRNPILDVRFFVTAVLIQRESGGNLAEILDNLAGVVRERFKIRRQVRVHTAHGRFTGYVLLALPASLAVALTIINPELMRLLFQERMGQMLVTAAIVLQTIGFFWIRQVIKIEV

Samples

Sample ID Description Type Environment
1 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
58 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
59 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
60 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
61 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
92 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
135 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
139 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
140 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
141 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
142 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
143 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
144 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
145 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
146 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
147 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
148 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
149 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
150 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
151 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
152 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
153 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
154 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
155 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
156 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
157 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
158 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
159 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
160 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
161 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
162 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
163 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
164 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
165 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
166 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
167 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
168 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
169 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
170 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
171 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
172 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
173 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
174 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
175 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
176 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
177 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
178 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
179 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
180 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
181 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
182 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
183 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
184 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
185 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
186 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
187 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
188 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
189 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
190 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
191 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
192 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
193 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
194 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
195 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
196 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
197 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
198 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
199 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
200 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
201 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
202 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
203 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
204 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
205 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.02
Nodule 0
Rhizoplane 2.87
Rhizosphere 96.11
Stem 0
Stem Tuber 0
Unclassified 2.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075436_100151060 3300006914 Bacteria 1634
2 Ga0065712_10069274 3300005290 Bacteria 7617
3 Ga0065715_10090199 3300005293 Bacteria 7429
4 Ga0065715_10135197 3300005293 Bacteria 1942
5 Ga0065715_10174685 3300005293 Bacteria 1520
6 Ga0065707_10086081 3300005295 Bacteria 5679
7 Ga0065707_10113682 3300005295 Bacteria 2320
8 Ga0070676_10054275 3300005328 Bacteria 2362
9 Ga0070676_10074771 3300005328 Bacteria 2041
10 Ga0070676_10118138 3300005328 Bacteria 1660
11 Ga0070676_10130460 3300005328 Bacteria 1589
12 Ga0070683_100608998 3300005329 Bacteria 1045
13 Ga0070677_10002936 3300005333 Bacteria 5479
14 Ga0070677_10073522 3300005333 Bacteria 1444
15 Ga0068869_100010049 3300005334 Bacteria 6155
16 Ga0070666_10014565 3300005335 Bacteria 5009
17 Ga0070682_100159390 3300005337 Bacteria 1557
18 Ga0068868_100004123 3300005338 Bacteria 10158
19 Ga0068868_100081754 3300005338 Bacteria 2590
20 Ga0068868_100229273 3300005338 Bacteria 1558
21 Ga0068868_100482982 3300005338 Unclassified 1083
22 Ga0070660_100307780 3300005339 Bacteria 1300
23 Ga0070689_100019892 3300005340 Bacteria 4971
24 Ga0070689_100259001 3300005340 Bacteria 1437
25 Ga0070691_10072502 3300005341 Bacteria 1673
26 Ga0070687_100029403 3300005343 Bacteria 2676
27 Ga0070668_100021252 3300005347 Bacteria 4906
28 Ga0070668_100331697 3300005347 Bacteria 1283
29 Ga0070669_100008866 3300005353 Bacteria 7176
30 Ga0070669_100018637 3300005353 Bacteria 4960
31 Ga0070675_100044719 3300005354 Bacteria 3621
32 Ga0070675_100062497 3300005354 Bacteria 3077
33 Ga0070671_100033900 3300005355 Bacteria 4225
34 Ga0070671_100362306 3300005355 Bacteria 1238
35 Ga0070674_100094065 3300005356 Bacteria 2170
36 Ga0070673_100005719 3300005364 Bacteria 7995
37 Ga0070673_100066690 3300005364 Bacteria 2876
38 Ga0070688_100001290 3300005365 Bacteria 12484
39 Ga0070688_100102577 3300005365 Bacteria 1888
40 Ga0070688_100102789 3300005365 Bacteria 1887
41 Ga0070659_100218265 3300005366 Bacteria 1573
42 Ga0070667_100160979 3300005367 Bacteria 1977
43 Ga0070701_10044526 3300005438 Bacteria 2274
44 Ga0070705_100063021 3300005440 Bacteria 2210
45 Ga0070700_100007083 3300005441 Bacteria 6028
46 Ga0070700_100021579 3300005441 Bacteria 3745
47 Ga0070700_100066730 3300005441 Bacteria 2285
48 Ga0070700_100100211 3300005441 Bacteria 1907
49 Ga0070694_100010135 3300005444 Bacteria 5800
50 Ga0070694_100061360 3300005444 Bacteria 2566
51 Ga0070694_100093524 3300005444 Bacteria 2113
52 Ga0070662_100418815 3300005457 Bacteria 1108
53 Ga0070681_10115146 3300005458 Bacteria 2627
54 Ga0068867_100024384 3300005459 Bacteria 4333
55 Ga0070685_10006586 3300005466 Bacteria 5924
56 Ga0070685_10009815 3300005466 Bacteria 4964
57 Ga0070706_100109454 3300005467 Bacteria 2571
58 Ga0070706_100431105 3300005467 Unclassified 1227
59 Ga0070707_100034445 3300005468 Bacteria 4829
60 Ga0070707_100136308 3300005468 Bacteria 2388
61 Ga0070707_100182589 3300005468 Bacteria 2045
62 Ga0070698_100003151 3300005471 Bacteria 18175
63 Ga0070698_100006486 3300005471 Bacteria 12692
64 Ga0070698_100049037 3300005471 Bacteria 4313
65 Ga0070699_100000475 3300005518 Bacteria 38225
66 Ga0070699_100008844 3300005518 Bacteria 8721
67 Ga0070699_100060409 3300005518 Bacteria 3284
68 Ga0070699_100142028 3300005518 Bacteria 2121
69 Ga0070699_100167741 3300005518 Bacteria 1945
70 Ga0070697_100071045 3300005536 Bacteria 2855
71 Ga0070697_100114369 3300005536 Bacteria 2252
72 Ga0070697_100213122 3300005536 Bacteria 1645
73 Ga0070672_100212626 3300005543 Bacteria 1620
74 Ga0070672_100259729 3300005543 Bacteria 1464
75 Ga0070672_100305191 3300005543 Bacteria 1350
76 Ga0070686_100005995 3300005544 Bacteria 6744
77 Ga0070695_100001664 3300005545 Bacteria 12507
78 Ga0070695_100004647 3300005545 Bacteria 8071
79 Ga0070695_100205619 3300005545 Bacteria 1410
80 Ga0070696_100002737 3300005546 Bacteria 11701
81 Ga0070696_100006712 3300005546 Bacteria 7689
82 Ga0070696_100013209 3300005546 Bacteria 5542
83 Ga0070696_100235233 3300005546 Bacteria 1380
84 Ga0070665_100003820 3300005548 Bacteria 15949
85 Ga0070704_100001492 3300005549 Bacteria 12582
86 Ga0070704_100150039 3300005549 Bacteria 1831
87 Ga0070704_100401557 3300005549 Bacteria 1170
88 Ga0068855_100090370 3300005563 Bacteria 3534
89 Ga0070664_100002655 3300005564 Bacteria 14420
90 Ga0070664_100109793 3300005564 Bacteria 2406
91 Ga0070664_100167238 3300005564 Bacteria 1949
92 Ga0068854_100078901 3300005578 Bacteria 2426
93 Ga0070702_100143015 3300005615 Bacteria 1526
94 Ga0068859_100009537 3300005617 Bacteria 9801
95 Ga0068859_100041236 3300005617 Bacteria 4637
96 Ga0068859_100096386 3300005617 Bacteria 3011
97 Ga0068864_100144259 3300005618 Bacteria 2151
98 Ga0068866_10042044 3300005718 Bacteria 2272
99 Ga0068861_100042313 3300005719 Bacteria 3414
100 Ga0068861_100117218 3300005719 Bacteria 2142
101 Ga0068861_100271495 3300005719 Bacteria 1456
102 Ga0068861_100279642 3300005719 Bacteria 1436
103 Ga0068861_100316004 3300005719 Bacteria 1359
104 Ga0068851_10055687 3300005834 Bacteria 2015
105 Ga0068870_10153995 3300005840 Bacteria 1357
106 Ga0068858_100032602 3300005842 Bacteria 4837
107 Ga0068860_100011122 3300005843 Bacteria 8865
108 Ga0068860_100057663 3300005843 Bacteria 3692
109 Ga0068860_100214245 3300005843 Bacteria 1869
110 Ga0068862_100008460 3300005844 Bacteria 8509
111 Ga0068862_100039571 3300005844 Bacteria 4005
112 Ga0068862_100048114 3300005844 Bacteria 3640
113 Ga0068862_100173826 3300005844 Bacteria 1929
114 Ga0068862_100298998 3300005844 Unclassified 1480
115 Ga0081455_10050373 3300005937 Bacteria 3582
116 Ga0081455_10170061 3300005937 Bacteria 1661
117 Ga0081539_10029438 3300005985 Bacteria 3430
118 Ga0075368_10051843 3300006042 Bacteria 1632
119 Ga0075367_10037472 3300006178 Bacteria 2818
120 Ga0075366_10062684 3300006195 Bacteria 2210
121 Ga0097621_100023387 3300006237 Bacteria 4812
122 Ga0097621_100033450 3300006237 Bacteria 4094
123 Ga0097621_100139524 3300006237 Bacteria 2070
124 Ga0097621_100203536 3300006237 Bacteria 1719
125 Ga0068871_100000886 3300006358 Bacteria 19951
126 Ga0068871_100092473 3300006358 Bacteria 2522
127 Ga0075428_100000017 3300006844 Bacteria 147833
128 Ga0075428_100003466 3300006844 Bacteria 17256
129 Ga0075428_100086142 3300006844 Bacteria 3426
130 Ga0075428_100166794 3300006844 Bacteria 2388
131 Ga0075430_100000262 3300006846 Bacteria 36942
132 Ga0075430_100031640 3300006846 Bacteria 4490
133 Ga0075430_100040846 3300006846 Bacteria 3926
134 Ga0075431_100000517 3300006847 Bacteria 32332
135 Ga0075431_100028475 3300006847 Bacteria 5742
136 Ga0075431_100230089 3300006847 Bacteria 1889
137 Ga0075431_100380888 3300006847 Bacteria 1415
138 Ga0075433_10000668 3300006852 Bacteria 23233
139 Ga0075433_10001213 3300006852 Bacteria 18802
140 Ga0075433_10003764 3300006852 Bacteria 11737
141 Ga0075433_10016511 3300006852 Bacteria 6088
142 Ga0075433_10035474 3300006852 Bacteria 4289
143 Ga0075433_10059821 3300006852 Bacteria 3334
144 Ga0075433_10117336 3300006852 Bacteria 2361
145 Ga0075433_10123394 3300006852 Bacteria 2301
146 Ga0075434_100000776 3300006871 Bacteria 25295
147 Ga0075434_100002394 3300006871 Bacteria 16457
148 Ga0075434_100004299 3300006871 Bacteria 12797
149 Ga0075434_100022059 3300006871 Bacteria 6199
150 Ga0075434_100086489 3300006871 Bacteria 3135
151 Ga0075434_100094349 3300006871 Bacteria 2997
152 Ga0075434_100131844 3300006871 Bacteria 2519
153 Ga0075434_100148793 3300006871 Bacteria 2361
154 Ga0075434_100152430 3300006871 Bacteria 2332
155 Ga0075434_100309012 3300006871 Bacteria 1601
156 Ga0075434_100466054 3300006871 Unclassified 1285
157 Ga0075429_100004563 3300006880 Bacteria 11904
158 Ga0075429_100022264 3300006880 Bacteria 5498
159 Ga0075429_100050280 3300006880 Bacteria 3627
160 Ga0068865_100004376 3300006881 Bacteria 8511
161 Ga0068865_100015023 3300006881 Bacteria 4930
162 Ga0075436_100007465 3300006914 Bacteria 7478
163 Ga0075436_100012376 3300006914 Bacteria 5848
164 Ga0075436_100051077 3300006914 Bacteria 2853
165 Ga0075436_100118068 3300006914 Bacteria 1854
166 Ga0075436_100158466 3300006914 Bacteria 1595
167 Ga0097620_100009538 3300006931 Bacteria 9801
168 Ga0097620_100041236 3300006931 Bacteria 4637
169 Ga0097620_100096382 3300006931 Bacteria 3011
170 Ga0075435_100000189 3300007076 Bacteria 36888
171 Ga0075435_100003794 3300007076 Bacteria 10303
172 Ga0075435_100014303 3300007076 Bacteria 5927
173 Ga0075435_100016466 3300007076 Bacteria 5575
174 Ga0075435_100025993 3300007076 Bacteria 4564
175 Ga0075435_100048549 3300007076 Bacteria 3411
176 Ga0075435_100052786 3300007076 Bacteria 3276
177 Ga0075435_100065306 3300007076 Bacteria 2958
178 Ga0075435_100081092 3300007076 Bacteria 2665
179 Ga0105240_10136105 3300009093 Bacteria 2942
180 Ga0105240_10268199 3300009093 Bacteria 1967
181 Ga0111539_10000002 3300009094 Bacteria 983359
182 Ga0111539_10011717 3300009094 Bacteria 11001
183 Ga0111539_10020905 3300009094 Bacteria 8059
184 Ga0111539_10023599 3300009094 Bacteria 7558
185 Ga0111539_10073900 3300009094 Bacteria 4018
186 Ga0111539_10100110 3300009094 Bacteria 3403
187 Ga0111539_10148958 3300009094 Bacteria 2740
188 Ga0111539_10188878 3300009094 Bacteria 2405
189 Ga0111539_10289108 3300009094 Bacteria 1907
190 Ga0105245_10011522 3300009098 Bacteria 7699
191 Ga0105247_10071409 3300009101 Bacteria 2171
192 Ga0114129_10001304 3300009147 Bacteria 33279
193 Ga0114129_10010673 3300009147 Bacteria 13100
194 Ga0114129_10019000 3300009147 Bacteria 9790
195 Ga0114129_10029839 3300009147 Bacteria 7723
196 Ga0114129_10047764 3300009147 Bacteria 6013
197 Ga0114129_10050070 3300009147 Bacteria 5869
198 Ga0114129_10053753 3300009147 Bacteria 5649
199 Ga0114129_10072830 3300009147 Bacteria 4788
200 Ga0114129_10151568 3300009147 Bacteria 3173
201 Ga0114129_10164967 3300009147 Bacteria 3024
202 Ga0114129_10314538 3300009147 Bacteria 2083
203 Ga0114129_10315510 3300009147 Bacteria 2080
204 Ga0114129_10510164 3300009147 Bacteria 1569
205 Ga0114129_10555570 3300009147 Bacteria 1492
206 Ga0105243_10072653 3300009148 Bacteria 2785
207 Ga0105241_10138962 3300009174 Bacteria 1976
208 Ga0105242_10003085 3300009176 Bacteria 13001
209 Ga0105248_10022495 3300009177 Bacteria 6992
210 Ga0105248_10168579 3300009177 Bacteria 2468
211 Ga0105238_10262399 3300009551 Bacteria 1707
212 Ga0105249_10010840 3300009553 Bacteria 8009
213 Ga0105249_10288661 3300009553 Bacteria 1641
214 Ga0105249_10348586 3300009553 Bacteria 1499
215 Ga0105249_10637329 3300009553 Bacteria 1123
216 Ga0157374_10149082 3300013296 Bacteria 2273
217 Ga0157374_10151065 3300013296 Bacteria 2258
218 Ga0157378_10221691 3300013297 Bacteria 1798
219 Ga0157378_10326278 3300013297 Bacteria 1493
220 Ga0157375_10277000 3300013308 Bacteria 1840
221 Ga0157375_10355005 3300013308 Bacteria 1632
222 Ga0157380_10001788 3300014326 Bacteria 14197
223 Ga0157380_10002539 3300014326 Bacteria 12321
224 Ga0157380_10022266 3300014326 Bacteria 4767
225 Ga0157380_10110489 3300014326 Bacteria 2309
226 Ga0157380_10310343 3300014326 Bacteria 1457
227 Ga0157377_10003051 3300014745 Bacteria 7509
228 Ga0157377_10265537 3300014745 Bacteria 1119
229 Ga0157379_10013418 3300014968 Bacteria 7176
230 Ga0157379_10064058 3300014968 Bacteria 3286
231 Ga0157376_10128111 3300014969 Bacteria 2261
232 Ga0157376_10160360 3300014969 Bacteria 2038
233 Ga0157376_10315677 3300014969 Bacteria 1484
234 Ga0163161_10004534 3300017792 Bacteria 9666
235 Ga0207697_10000862 3300025315 Bacteria 17181
236 Ga0207697_10051488 3300025315 Bacteria 1702
237 Ga0207682_10001500 3300025893 Bacteria 10777
238 Ga0207642_10022849 3300025899 Bacteria 2488
239 Ga0207642_10043311 3300025899 Bacteria 1984
240 Ga0207642_10045331 3300025899 Bacteria 1951
241 Ga0207688_10000543 3300025901 Bacteria 18375
242 Ga0207680_10019011 3300025903 Bacteria 3668
243 Ga0207680_10027116 3300025903 Bacteria 3185
244 Ga0207680_10029276 3300025903 Bacteria 3091
245 Ga0207645_10001978 3300025907 Bacteria 16464
246 Ga0207645_10057965 3300025907 Bacteria 2473
247 Ga0207645_10094811 3300025907 Bacteria 1921
248 Ga0207643_10003962 3300025908 Bacteria 7971
249 Ga0207643_10117312 3300025908 Bacteria 1573
250 Ga0207684_10253094 3300025910 Bacteria 1520
251 Ga0207684_10256589 3300025910 Bacteria 1509
252 Ga0207654_10143707 3300025911 Bacteria 1524
253 Ga0207695_10073986 3300025913 Bacteria 3469
254 Ga0207662_10012484 3300025918 Bacteria 4730
255 Ga0207662_10055148 3300025918 Bacteria 2371
256 Ga0207657_10288283 3300025919 Bacteria 1302
257 Ga0207646_10130504 3300025922 Bacteria 2261
258 Ga0207646_10155840 3300025922 Bacteria 2060
259 Ga0207646_10197068 3300025922 Bacteria 1819
260 Ga0207681_10020423 3300025923 Bacteria 4197
261 Ga0207681_10067404 3300025923 Unclassified 2481
262 Ga0207659_10000469 3300025926 Bacteria 24218
263 Ga0207659_10020682 3300025926 Bacteria 4354
264 Ga0207659_10050871 3300025926 Bacteria 2945
265 Ga0207659_10079294 3300025926 Unclassified 2422
266 Ga0207687_10018987 3300025927 Bacteria 4548
267 Ga0207687_10020499 3300025927 Bacteria 4386
268 Ga0207687_10033310 3300025927 Bacteria 3494
269 Ga0207706_10003430 3300025933 Bacteria 15140
270 Ga0207706_10120305 3300025933 Unclassified 2309
271 Ga0207706_10315887 3300025933 Bacteria 1360
272 Ga0207686_10008188 3300025934 Bacteria 5641
273 Ga0207686_10016272 3300025934 Bacteria 4172
274 Ga0207686_10047118 3300025934 Bacteria 2663
275 Ga0207686_10061342 3300025934 Bacteria 2384
276 Ga0207670_10068217 3300025936 Bacteria 2450
277 Ga0207670_10225456 3300025936 Bacteria 1437
278 Ga0207669_10025467 3300025937 Bacteria 3199
279 Ga0207669_10204138 3300025937 Bacteria 1437
280 Ga0207704_10017309 3300025938 Bacteria 3731
281 Ga0207704_10092370 3300025938 Bacteria 1992
282 Ga0207691_10005955 3300025940 Bacteria 11775
283 Ga0207691_10178227 3300025940 Bacteria 1858
284 Ga0207691_10266857 3300025940 Bacteria 1475
285 Ga0207691_10307698 3300025940 Bacteria 1360
286 Ga0207691_10363141 3300025940 Unclassified 1238
287 Ga0207711_10211600 3300025941 Bacteria 1771
288 Ga0207689_10001150 3300025942 Bacteria 25470
289 Ga0207689_10048944 3300025942 Bacteria 3487
290 Ga0207661_10294735 3300025944 Bacteria 1453
291 Ga0207661_10317079 3300025944 Bacteria 1401
292 Ga0207679_10007928 3300025945 Bacteria 6751
293 Ga0207679_10102621 3300025945 Bacteria 2240
294 Ga0207651_10428406 3300025960 Unclassified 1131
295 Ga0207712_10032026 3300025961 Bacteria 3546
296 Ga0207712_10055468 3300025961 Bacteria 2788
297 Ga0207712_10061706 3300025961 Bacteria 2662
298 Ga0207712_10065445 3300025961 Bacteria 2594
299 Ga0207668_10040853 3300025972 Bacteria 3132
300 Ga0207668_10087410 3300025972 Bacteria 2280
301 Ga0207668_10421385 3300025972 Bacteria 1133
302 Ga0207640_10064900 3300025981 Bacteria 2434
303 Ga0207658_10105855 3300025986 Bacteria 2213
304 Ga0207677_10117100 3300026023 Bacteria 1996
305 Ga0207677_10189557 3300026023 Bacteria 1625
306 Ga0207677_10246578 3300026023 Bacteria 1448
307 Ga0207703_10017299 3300026035 Bacteria 5628
308 Ga0207703_10102863 3300026035 Bacteria 2424
309 Ga0207703_10576028 3300026035 Bacteria 1063
310 Ga0207708_10047142 3300026075 Bacteria 3282
311 Ga0207708_10060383 3300026075 Bacteria 2893
312 Ga0207708_10065373 3300026075 Bacteria 2780
313 Ga0207708_10113184 3300026075 Bacteria 2108
314 Ga0207702_10019341 3300026078 Bacteria 5636
315 Ga0207641_10011933 3300026088 Bacteria 7129
316 Ga0207641_10224630 3300026088 Bacteria 1743
317 Ga0207641_10332083 3300026088 Bacteria 1444
318 Ga0207648_10024886 3300026089 Bacteria 5338
319 Ga0207648_10094647 3300026089 Bacteria 2612
320 Ga0207648_10219631 3300026089 Bacteria 1689
321 Ga0207648_10233516 3300026089 Bacteria 1636
322 Ga0207676_10106844 3300026095 Bacteria 2333
323 Ga0207676_10170868 3300026095 Bacteria 1894
324 Ga0207674_10070657 3300026116 Bacteria 3510
325 Ga0207675_100005749 3300026118 Bacteria 11863
326 Ga0207675_100006207 3300026118 Bacteria 11348
327 Ga0207675_100074064 3300026118 Bacteria 3186
328 Ga0207675_100076455 3300026118 Bacteria 3135
329 Ga0207675_100257153 3300026118 Bacteria 1692
330 Ga0207675_100258124 3300026118 Bacteria 1688
331 Ga0207683_10002309 3300026121 Bacteria 16723
332 Ga0207683_10022865 3300026121 Bacteria 5371
333 Ga0207683_10300287 3300026121 Bacteria 1469
334 Ga0207698_10278884 3300026142 Bacteria 1545
335 Ga0207428_10000004 3300027907 Bacteria 727800
336 Ga0207428_10008285 3300027907 Bacteria 9398
337 Ga0207428_10013831 3300027907 Bacteria 7030
338 Ga0207428_10015504 3300027907 Bacteria 6590
339 Ga0207428_10018190 3300027907 Bacteria 6009
340 Ga0207428_10024144 3300027907 Bacteria 5106
341 Ga0268266_10076012 3300028379 Bacteria 2918
342 Ga0268265_10014309 3300028380 Bacteria 5403
343 Ga0268265_10015569 3300028380 Bacteria 5206
344 Ga0268265_10025365 3300028380 Bacteria 4206
345 Ga0268265_10178786 3300028380 Bacteria 1821
346 Ga0268264_10147461 3300028381 Bacteria 2106
347 Ga0268264_10454422 3300028381 Bacteria 1242
348 Ga0268264_10560911 3300028381 Bacteria 1121
349 Ga0307408_100199210 3300031548 Bacteria 1619
350 Ga0307408_100338338 3300031548 Bacteria 1273
351 Ga0307408_100372750 3300031548 Bacteria 1218
352 Ga0307409_100084611 3300031995 Bacteria 2576
353 Ga0307409_100335642 3300031995 Bacteria 1420
354 Ga0307416_100069909 3300032002 Bacteria 2908
355 Ga0307416_100151880 3300032002 Bacteria 2125
356 Ga0307414_10065314 3300032004 Bacteria 2596
357 Ga0307411_10073838 3300032005 Bacteria 2322
358 Ga0307415_100023002 3300032126 Bacteria 3860
359 Ga0373930_0003255 3300034816 Bacteria 2568
360 Ga0373948_0003137 3300034817 Bacteria 2514
361 Ga0373950_0004750 3300034818 Bacteria 2000
362 Ga0373959_0001235 3300034820 Bacteria 4124
363 Ga0373929_0005265 3300035085 Bacteria 2326
364 Ga0373949_0001113 3300035090 Bacteria 8147
365 Ga0373951_0002359 3300035091 Bacteria 4787
366 Ga0373951_0017410 3300035091 Bacteria 1626
367 Ga0373952_0000406 3300035092 Bacteria 7398
368 Ga0373932_0001419 3300035112 Bacteria 6718
369 Ga0373939_0000596 3300035114 Bacteria 8983
370 Ga0373941_0001790 3300035115 Bacteria 4624
371 Ga0373953_0062282 3300035117 Bacteria 1527
372 Ga0373960_0000967 3300035121 Bacteria 6177
373 Ga0373943_0043080 3300035170 Bacteria 2191
374 Ga0373942_0001095 3300035207 Bacteria 7252
375 Ga0373961_0002928 3300035241 Bacteria 4324
376 Ga0373933_0033710 3300035724 Bacteria 2981
377 Ga0373937_0019618 3300036401 Bacteria 6052
378 Ga0373937_0096815 3300036401 Bacteria 2737
379 Ga0395905_0234635 3300037471 Bacteria 1715
380 Ga0439441_013013 3300042001 Bacteria 1437
381 Ga0439455_0026207 3300042012 Bacteria 1422
382 Ga0450905_010724 3300042142 Bacteria 1273
383 Ga0439464_0010378 3300042439 Bacteria 2458
384 Ga0439440_0018534 3300042993 Unclassified 1543
385 Ga0451576_0010717 3300045051 Bacteria 10496
386 Ga0451576_0368285 3300045051 Bacteria 1505
387 Ga0451576_0695480 3300045051 Bacteria 1068
388 Ga0495603_0074167 3300046455 Bacteria 1998
389 Ga0495629_0008369 3300046459 Bacteria 7608
390 Ga0495584_0013157 3300046491 Bacteria 4221
391 Ga0495643_0007709 3300046522 Bacteria 6898
392 Ga0495642_0122827 3300046528 Bacteria 1115
393 Ga0495586_0007998 3300046535 Bacteria 5640
394 Ga0495598_0038745 3300046537 Bacteria 1382
395 Ga0495645_0007627 3300046543 Bacteria 7528
396 Ga0495635_0050102 3300046663 Bacteria 2879
397 Ga0495659_0000896 3300046664 Bacteria 10607
398 Ga0495659_0055347 3300046664 Bacteria 1453
399 Ga0495647_0087040 3300046681 Bacteria 1275
400 Ga0495669_0025733 3300046684 Bacteria 2568
401 Ga0495677_0008003 3300047445 Bacteria 3929
402 Ga0495684_0038585 3300047471 Bacteria 3662
403 Ga0496102_0096843 3300048905 Bacteria 2736
404 Ga0496102_0277723 3300048905 Bacteria 1579
405 Ga0496102_0292373 3300048905 Bacteria 1536
406 Ga0496102_0324999 3300048905 Bacteria 1449
407 Ga0496104_0138802 3300048907 Bacteria 2336
408 Ga0496106_0025834 3300048909 Bacteria 4370
409 Ga0496109_0311505 3300048912 Bacteria 1485
410 Ga0496112_0051260 3300048915 Bacteria 4048
411 Ga0496112_0069036 3300048915 Bacteria 3491
412 Ga0496112_0184591 3300048915 Bacteria 2049
413 Ga0496114_0089464 3300048917 Bacteria 2613
414 Ga0496114_0113358 3300048917 Bacteria 2324
415 Ga0496114_0190531 3300048917 Bacteria 1794
416 Ga0496115_0096530 3300048918 Bacteria 2420
417 Ga0501079_0061373 3300049741 Bacteria 2900
418 Ga0501079_0314879 3300049741 Bacteria 1225
419 nmdc:mga0k408_15798_c2 3300050493 Bacteria 2517
420 nmdc:mga06z11_37090_c1 3300050494 Bacteria 2412
421 nmdc:mga05p37_123749_c1 3300050507 Bacteria 3177
422 nmdc:mga05p37_22313_c1 3300050507 Bacteria 7677
423 nmdc:mga05p37_2382_c1 3300050507 Bacteria 21864
424 nmdc:mga05p37_272897_c1 3300050507 Bacteria 2020
425 nmdc:mga05p37_29948_c1 3300050507 Bacteria 6643
426 nmdc:mga05p37_37138_c1 3300050507 Bacteria 5975
427 nmdc:mga05p37_43348_c1 3300050507 Bacteria 5535
428 nmdc:mga05p37_47253_c1 3300050507 Unclassified 4219
429 nmdc:mga05p37_5466_c1 3300050507 Bacteria 14916
430 nmdc:mga05p37_56435_c1 3300050507 Bacteria 4836
431 nmdc:mga05p37_80691_c1 3300050507 Bacteria 4007
432 nmdc:mga05p37_90287_c1 3300050507 Bacteria 3776
433 nmdc:mga09592_13865_c1 3300050508 Bacteria 6587
434 nmdc:mga09592_198261_c1 3300050508 Bacteria 1738
435 nmdc:mga09592_7395_c1 3300050508 Bacteria 8929
436 nmdc:mga09592_9128_c1 3300050508 Bacteria 8065
437 nmdc:mga0qj67_138273_c1 3300050509 Bacteria 1974
438 nmdc:mga0qj67_258_c1 3300050509 Bacteria 36243
439 nmdc:mga0qj67_41941_c1 3300050509 Bacteria 3601
440 nmdc:mga0qj67_94105_c1 3300050509 Bacteria 2410
441 nmdc:mga06r32_1786_c1 3300050510 Bacteria 19309
442 nmdc:mga06r32_215236_c1 3300050510 Bacteria 1909
443 nmdc:mga06r32_65143_c1 3300050510 Bacteria 3515
444 nmdc:mga08y16_118011_c1 3300050511 Bacteria 2761
445 nmdc:mga08y16_15581_c1 3300050511 Bacteria 7994
446 nmdc:mga08y16_2_c1 3300050511 Bacteria 983367
447 nmdc:mga08y16_331301_c1 3300050511 Bacteria 1257
448 nmdc:mga08y16_80229_c1 3300050511 Bacteria 3402
449 nmdc:mga08y16_88864_c1 3300050511 Bacteria 3220
450 nmdc:mga0n895_121_c1 3300050512 Bacteria 46448
451 nmdc:mga0n895_176756_c1 3300050512 Bacteria 2166
452 nmdc:mga0n895_179638_c1 3300050512 Bacteria 2148
453 nmdc:mga0n895_21582_c1 3300050512 Bacteria 6026
454 nmdc:mga0n895_282834_c1 3300050512 Bacteria 1682
455 nmdc:mga0n895_411_c1 3300050512 Bacteria 28740
456 nmdc:mga0n895_425937_c1 3300050512 Bacteria 1341
457 nmdc:mga0n895_60891_c1 3300050512 Bacteria 3725
458 nmdc:mga0n895_69250_c1 3300050512 Bacteria 3495
459 nmdc:mga0n895_8256_c1 3300050512 Bacteria 9006
460 nmdc:mga0rr50_107_c1 3300050513 Bacteria 46254
461 nmdc:mga0rr50_133227_c1 3300050513 Bacteria 1992
462 nmdc:mga0rr50_269059_c1 3300050513 Bacteria 1420
463 nmdc:mga0rr50_31768_c1 3300050513 Bacteria 3755
464 nmdc:mga0rr50_41621_c1 3300050513 Bacteria 3349
465 nmdc:mga0rr50_45972_c1 3300050513 Bacteria 3212
466 nmdc:mga0rr50_5261_c1 3300050513 Bacteria 7699
467 nmdc:mga0rr50_698_c1 3300050513 Bacteria 17989
468 nmdc:mga08x19_100136_c1 3300050514 Bacteria 1922
469 nmdc:mga08x19_205009_c1 3300050514 Bacteria 1352
470 nmdc:mga08x19_243383_c1 3300050514 Bacteria 1240
471 nmdc:mga08x19_810_c1 3300050514 Bacteria 19891
472 nmdc:mga08x19_83852_c1 3300050514 Bacteria 2096
473 nmdc:mga08x19_95213_c1 3300050514 Bacteria 1970
474 nmdc:mga0a205_183941_c1 3300050515 Bacteria 1688
475 nmdc:mga0a205_19178_c1 3300050515 Bacteria 6445
476 nmdc:mga0a205_26289_c1 3300050515 Bacteria 5548
477 nmdc:mga0a205_327005_c1 3300050515 Bacteria 1403
478 nmdc:mga0a205_54296_c1 3300050515 Bacteria 3868
479 nmdc:mga0a205_67034_c1 3300050515 Bacteria 3467
480 nmdc:mga0a205_69191_c1 3300050515 Bacteria 3409
481 nmdc:mga0a205_72665_c1 3300050515 Bacteria 3323
482 nmdc:mga0a205_83938_c1 3300050515 Bacteria 3076
483 nmdc:mga0a205_900_c1 3300050515 Bacteria 24469
484 Ga0495619_0139658 3300053085 Bacteria 1668
485 Ga0501084_0247509 3300054114 Bacteria 1505
486 Ga0590075_010617 3300059424 Bacteria 2220
487 Ga0501082_0013253 3300060353 Bacteria 7091
488 Ga0501082_0214629 3300060353 Bacteria 1674
489 Ga0075436_100151060
490 Ga0065712_10069274
491 Ga0065715_10090199
492 Ga0065715_10135197
493 Ga0065715_10174685
494 Ga0065707_10086081
495 Ga0065707_10113682
496 Ga0070676_10054275
497 Ga0070676_10074771
498 Ga0070676_10118138
499 Ga0070676_10130460
500 Ga0070683_100608998
501 Ga0070677_10002936
502 Ga0070677_10073522
503 Ga0068869_100010049
504 Ga0070666_10014565
505 Ga0070682_100159390
506 Ga0068868_100004123
507 Ga0068868_100081754
508 Ga0068868_100229273
509 Ga0068868_100482982
510 Ga0070660_100307780
511 Ga0070689_100019892
512 Ga0070689_100259001
513 Ga0070691_10072502
514 Ga0070687_100029403
515 Ga0070668_100021252
516 Ga0070668_100331697
517 Ga0070669_100008866
518 Ga0070669_100018637
519 Ga0070675_100044719
520 Ga0070675_100062497
521 Ga0070671_100033900
522 Ga0070671_100362306
523 Ga0070674_100094065
524 Ga0070673_100005719
525 Ga0070673_100066690
526 Ga0070688_100001290
527 Ga0070688_100102577
528 Ga0070688_100102789
529 Ga0070659_100218265
530 Ga0070667_100160979
531 Ga0070701_10044526
532 Ga0070705_100063021
533 Ga0070700_100007083
534 Ga0070700_100021579
535 Ga0070700_100066730
536 Ga0070700_100100211
537 Ga0070694_100010135
538 Ga0070694_100061360
539 Ga0070694_100093524
540 Ga0070662_100418815
541 Ga0070681_10115146
542 Ga0068867_100024384
543 Ga0070685_10006586
544 Ga0070685_10009815
545 Ga0070706_100109454
546 Ga0070706_100431105
547 Ga0070707_100034445
548 Ga0070707_100136308
549 Ga0070707_100182589
550 Ga0070698_100003151
551 Ga0070698_100006486
552 Ga0070698_100049037
553 Ga0070699_100000475
554 Ga0070699_100008844
555 Ga0070699_100060409
556 Ga0070699_100142028
557 Ga0070699_100167741
558 Ga0070697_100071045
559 Ga0070697_100114369
560 Ga0070697_100213122
561 Ga0070672_100212626
562 Ga0070672_100259729
563 Ga0070672_100305191
564 Ga0070686_100005995
565 Ga0070695_100001664
566 Ga0070695_100004647
567 Ga0070695_100205619
568 Ga0070696_100002737
569 Ga0070696_100006712
570 Ga0070696_100013209
571 Ga0070696_100235233
572 Ga0070665_100003820
573 Ga0070704_100001492
574 Ga0070704_100150039
575 Ga0070704_100401557
576 Ga0068855_100090370
577 Ga0070664_100002655
578 Ga0070664_100109793
579 Ga0070664_100167238
580 Ga0068854_100078901
581 Ga0070702_100143015
582 Ga0068859_100009537
583 Ga0068859_100041236
584 Ga0068859_100096386
585 Ga0068864_100144259
586 Ga0068866_10042044
587 Ga0068861_100042313
588 Ga0068861_100117218
589 Ga0068861_100271495
590 Ga0068861_100279642
591 Ga0068861_100316004
592 Ga0068851_10055687
593 Ga0068870_10153995
594 Ga0068858_100032602
595 Ga0068860_100011122
596 Ga0068860_100057663
597 Ga0068860_100214245
598 Ga0068862_100008460
599 Ga0068862_100039571
600 Ga0068862_100048114
601 Ga0068862_100173826
602 Ga0068862_100298998
603 Ga0081455_10050373
604 Ga0081455_10170061
605 Ga0081539_10029438
606 Ga0075368_10051843
607 Ga0075367_10037472
608 Ga0075366_10062684
609 Ga0097621_100023387
610 Ga0097621_100033450
611 Ga0097621_100139524
612 Ga0097621_100203536
613 Ga0068871_100000886
614 Ga0068871_100092473
615 Ga0075428_100000017
616 Ga0075428_100003466
617 Ga0075428_100086142
618 Ga0075428_100166794
619 Ga0075430_100000262
620 Ga0075430_100031640
621 Ga0075430_100040846
622 Ga0075431_100000517
623 Ga0075431_100028475
624 Ga0075431_100230089
625 Ga0075431_100380888
626 Ga0075433_10000668
627 Ga0075433_10001213
628 Ga0075433_10003764
629 Ga0075433_10016511
630 Ga0075433_10035474
631 Ga0075433_10059821
632 Ga0075433_10117336
633 Ga0075433_10123394
634 Ga0075434_100000776
635 Ga0075434_100002394
636 Ga0075434_100004299
637 Ga0075434_100022059
638 Ga0075434_100086489
639 Ga0075434_100094349
640 Ga0075434_100131844
641 Ga0075434_100148793
642 Ga0075434_100152430
643 Ga0075434_100309012
644 Ga0075434_100466054
645 Ga0075429_100004563
646 Ga0075429_100022264
647 Ga0075429_100050280
648 Ga0068865_100004376
649 Ga0068865_100015023
650 Ga0075436_100007465
651 Ga0075436_100012376
652 Ga0075436_100051077
653 Ga0075436_100118068
654 Ga0075436_100158466
655 Ga0097620_100009538
656 Ga0097620_100041236
657 Ga0097620_100096382
658 Ga0075435_100000189
659 Ga0075435_100003794
660 Ga0075435_100014303
661 Ga0075435_100016466
662 Ga0075435_100025993
663 Ga0075435_100048549
664 Ga0075435_100052786
665 Ga0075435_100065306
666 Ga0075435_100081092
667 Ga0105240_10136105
668 Ga0105240_10268199
669 Ga0111539_10000002
670 Ga0111539_10011717
671 Ga0111539_10020905
672 Ga0111539_10023599
673 Ga0111539_10073900
674 Ga0111539_10100110
675 Ga0111539_10148958
676 Ga0111539_10188878
677 Ga0111539_10289108
678 Ga0105245_10011522
679 Ga0105247_10071409
680 Ga0114129_10001304
681 Ga0114129_10010673
682 Ga0114129_10019000
683 Ga0114129_10029839
684 Ga0114129_10047764
685 Ga0114129_10050070
686 Ga0114129_10053753
687 Ga0114129_10072830
688 Ga0114129_10151568
689 Ga0114129_10164967
690 Ga0114129_10314538
691 Ga0114129_10315510
692 Ga0114129_10510164
693 Ga0114129_10555570
694 Ga0105243_10072653
695 Ga0105241_10138962
696 Ga0105242_10003085
697 Ga0105248_10022495
698 Ga0105248_10168579
699 Ga0105238_10262399
700 Ga0105249_10010840
701 Ga0105249_10288661
702 Ga0105249_10348586
703 Ga0105249_10637329
704 Ga0157374_10149082
705 Ga0157374_10151065
706 Ga0157378_10221691
707 Ga0157378_10326278
708 Ga0157375_10277000
709 Ga0157375_10355005
710 Ga0157380_10001788
711 Ga0157380_10002539
712 Ga0157380_10022266
713 Ga0157380_10110489
714 Ga0157380_10310343
715 Ga0157377_10003051
716 Ga0157377_10265537
717 Ga0157379_10013418
718 Ga0157379_10064058
719 Ga0157376_10128111
720 Ga0157376_10160360
721 Ga0157376_10315677
722 Ga0163161_10004534
723 Ga0207697_10000862
724 Ga0207697_10051488
725 Ga0207682_10001500
726 Ga0207642_10022849
727 Ga0207642_10043311
728 Ga0207642_10045331
729 Ga0207688_10000543
730 Ga0207680_10019011
731 Ga0207680_10027116
732 Ga0207680_10029276
733 Ga0207645_10001978
734 Ga0207645_10057965
735 Ga0207645_10094811
736 Ga0207643_10003962
737 Ga0207643_10117312
738 Ga0207684_10253094
739 Ga0207684_10256589
740 Ga0207654_10143707
741 Ga0207695_10073986
742 Ga0207662_10012484
743 Ga0207662_10055148
744 Ga0207657_10288283
745 Ga0207646_10130504
746 Ga0207646_10155840
747 Ga0207646_10197068
748 Ga0207681_10020423
749 Ga0207681_10067404
750 Ga0207659_10000469
751 Ga0207659_10020682
752 Ga0207659_10050871
753 Ga0207659_10079294
754 Ga0207687_10018987
755 Ga0207687_10020499
756 Ga0207687_10033310
757 Ga0207706_10003430
758 Ga0207706_10120305
759 Ga0207706_10315887
760 Ga0207686_10008188
761 Ga0207686_10016272
762 Ga0207686_10047118
763 Ga0207686_10061342
764 Ga0207670_10068217
765 Ga0207670_10225456
766 Ga0207669_10025467
767 Ga0207669_10204138
768 Ga0207704_10017309
769 Ga0207704_10092370
770 Ga0207691_10005955
771 Ga0207691_10178227
772 Ga0207691_10266857
773 Ga0207691_10307698
774 Ga0207691_10363141
775 Ga0207711_10211600
776 Ga0207689_10001150
777 Ga0207689_10048944
778 Ga0207661_10294735
779 Ga0207661_10317079
780 Ga0207679_10007928
781 Ga0207679_10102621
782 Ga0207651_10428406
783 Ga0207712_10032026
784 Ga0207712_10055468
785 Ga0207712_10061706
786 Ga0207712_10065445
787 Ga0207668_10040853
788 Ga0207668_10087410
789 Ga0207668_10421385
790 Ga0207640_10064900
791 Ga0207658_10105855
792 Ga0207677_10117100
793 Ga0207677_10189557
794 Ga0207677_10246578
795 Ga0207703_10017299
796 Ga0207703_10102863
797 Ga0207703_10576028
798 Ga0207708_10047142
799 Ga0207708_10060383
800 Ga0207708_10065373
801 Ga0207708_10113184
802 Ga0207702_10019341
803 Ga0207641_10011933
804 Ga0207641_10224630
805 Ga0207641_10332083
806 Ga0207648_10024886
807 Ga0207648_10094647
808 Ga0207648_10219631
809 Ga0207648_10233516
810 Ga0207676_10106844
811 Ga0207676_10170868
812 Ga0207674_10070657
813 Ga0207675_100005749
814 Ga0207675_100006207
815 Ga0207675_100074064
816 Ga0207675_100076455
817 Ga0207675_100257153
818 Ga0207675_100258124
819 Ga0207683_10002309
820 Ga0207683_10022865
821 Ga0207683_10300287
822 Ga0207698_10278884
823 Ga0207428_10000004
824 Ga0207428_10008285
825 Ga0207428_10013831
826 Ga0207428_10015504
827 Ga0207428_10018190
828 Ga0207428_10024144
829 Ga0268266_10076012
830 Ga0268265_10014309
831 Ga0268265_10015569
832 Ga0268265_10025365
833 Ga0268265_10178786
834 Ga0268264_10147461
835 Ga0268264_10454422
836 Ga0268264_10560911
837 Ga0307408_100199210
838 Ga0307408_100338338
839 Ga0307408_100372750
840 Ga0307409_100084611
841 Ga0307409_100335642
842 Ga0307416_100069909
843 Ga0307416_100151880
844 Ga0307414_10065314
845 Ga0307411_10073838
846 Ga0307415_100023002
847 Ga0373930_0003255
848 Ga0373948_0003137
849 Ga0373950_0004750
850 Ga0373959_0001235
851 Ga0373929_0005265
852 Ga0373949_0001113
853 Ga0373951_0002359
854 Ga0373951_0017410
855 Ga0373952_0000406
856 Ga0373932_0001419
857 Ga0373939_0000596
858 Ga0373941_0001790
859 Ga0373953_0062282
860 Ga0373960_0000967
861 Ga0373943_0043080
862 Ga0373942_0001095
863 Ga0373961_0002928
864 Ga0373933_0033710
865 Ga0373937_0019618
866 Ga0373937_0096815
867 Ga0395905_0234635
868 Ga0439441_013013
869 Ga0439455_0026207
870 Ga0450905_010724
871 Ga0439464_0010378
872 Ga0439440_0018534
873 Ga0451576_0010717
874 Ga0451576_0368285
875 Ga0451576_0695480
876 Ga0495603_0074167
877 Ga0495629_0008369
878 Ga0495584_0013157
879 Ga0495643_0007709
880 Ga0495642_0122827
881 Ga0495586_0007998
882 Ga0495598_0038745
883 Ga0495645_0007627
884 Ga0495635_0050102
885 Ga0495659_0000896
886 Ga0495659_0055347
887 Ga0495647_0087040
888 Ga0495669_0025733
889 Ga0495677_0008003
890 Ga0495684_0038585
891 Ga0496102_0096843
892 Ga0496102_0277723
893 Ga0496102_0292373
894 Ga0496102_0324999
895 Ga0496104_0138802
896 Ga0496106_0025834
897 Ga0496109_0311505
898 Ga0496112_0051260
899 Ga0496112_0069036
900 Ga0496112_0184591
901 Ga0496114_0089464
902 Ga0496114_0113358
903 Ga0496114_0190531
904 Ga0496115_0096530
905 Ga0501079_0061373
906 Ga0501079_0314879
907 nmdc:mga0k408_15798_c2
908 nmdc:mga06z11_37090_c1
909 nmdc:mga05p37_123749_c1
910 nmdc:mga05p37_22313_c1
911 nmdc:mga05p37_2382_c1
912 nmdc:mga05p37_272897_c1
913 nmdc:mga05p37_29948_c1
914 nmdc:mga05p37_37138_c1
915 nmdc:mga05p37_43348_c1
916 nmdc:mga05p37_47253_c1
917 nmdc:mga05p37_5466_c1
918 nmdc:mga05p37_56435_c1
919 nmdc:mga05p37_80691_c1
920 nmdc:mga05p37_90287_c1
921 nmdc:mga09592_13865_c1
922 nmdc:mga09592_198261_c1
923 nmdc:mga09592_7395_c1
924 nmdc:mga09592_9128_c1
925 nmdc:mga0qj67_138273_c1
926 nmdc:mga0qj67_258_c1
927 nmdc:mga0qj67_41941_c1
928 nmdc:mga0qj67_94105_c1
929 nmdc:mga06r32_1786_c1
930 nmdc:mga06r32_215236_c1
931 nmdc:mga06r32_65143_c1
932 nmdc:mga08y16_118011_c1
933 nmdc:mga08y16_15581_c1
934 nmdc:mga08y16_2_c1
935 nmdc:mga08y16_331301_c1
936 nmdc:mga08y16_80229_c1
937 nmdc:mga08y16_88864_c1
938 nmdc:mga0n895_121_c1
939 nmdc:mga0n895_176756_c1
940 nmdc:mga0n895_179638_c1
941 nmdc:mga0n895_21582_c1
942 nmdc:mga0n895_282834_c1
943 nmdc:mga0n895_411_c1
944 nmdc:mga0n895_425937_c1
945 nmdc:mga0n895_60891_c1
946 nmdc:mga0n895_69250_c1
947 nmdc:mga0n895_8256_c1
948 nmdc:mga0rr50_107_c1
949 nmdc:mga0rr50_133227_c1
950 nmdc:mga0rr50_269059_c1
951 nmdc:mga0rr50_31768_c1
952 nmdc:mga0rr50_41621_c1
953 nmdc:mga0rr50_45972_c1
954 nmdc:mga0rr50_5261_c1
955 nmdc:mga0rr50_698_c1
956 nmdc:mga08x19_100136_c1
957 nmdc:mga08x19_205009_c1
958 nmdc:mga08x19_243383_c1
959 nmdc:mga08x19_810_c1
960 nmdc:mga08x19_83852_c1
961 nmdc:mga08x19_95213_c1
962 nmdc:mga0a205_183941_c1
963 nmdc:mga0a205_19178_c1
964 nmdc:mga0a205_26289_c1
965 nmdc:mga0a205_327005_c1
966 nmdc:mga0a205_54296_c1
967 nmdc:mga0a205_67034_c1
968 nmdc:mga0a205_69191_c1
969 nmdc:mga0a205_72665_c1
970 nmdc:mga0a205_83938_c1
971 nmdc:mga0a205_900_c1
972 Ga0495619_0139658
973 Ga0501084_0247509
974 Ga0590075_010617
975 Ga0501082_0013253
976 Ga0501082_0214629

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00482

T2SSF

Type II secretion system (T2SS), protein F

175

302

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2whn-assembly1.cif.gz_A n-terminal domain from the pilc type iv pilus biogenesis protein 0.84 151 253
5nbg-assembly1.cif.gz_B structure of the cytoplasmic domain i of outf in the d. dadantii type ii secretion system 0.8326 151 258
2whn-assembly2.cif.gz_B n-terminal domain from the pilc type iv pilus biogenesis protein 0.8088 151 253
5nbg-assembly1.cif.gz_B structure of the cytoplasmic domain i of outf in the d. dadantii type ii secretion system 0.8054 151 258
3c1q-assembly1.cif.gz_A the three-dimensional structure of the cytoplasmic domains of epsf from the type 2 secretion system of vibrio cholerae 0.8001 151 258
ID Description Score Start End Superfamily
af_I6Y479_96_222_1.20.81.30 Mainly Alpha;Up-down Bundle;Receptor-associated Protein;Type II secretion system (T2SS), domain F 0.8653 158 281 1.20.81.30
af_I6Y479_96_222_1.20.81.30 Mainly Alpha;Up-down Bundle;Receptor-associated Protein;Type II secretion system (T2SS), domain F 0.8411 158 281 1.20.81.30
2whnB00 Mainly Alpha;Up-down Bundle;Receptor-associated Protein;Type II secretion system (T2SS), domain F 0.8088 151 253 1.20.81.30
af_P36646_249_359_1.20.81.30 Mainly Alpha;Up-down Bundle;Receptor-associated Protein;Type II secretion system (T2SS), domain F 0.7777 144 254 1.20.81.30
2whnB00 Mainly Alpha;Up-down Bundle;Receptor-associated Protein;Type II secretion system (T2SS), domain F 0.7683 151 253 1.20.81.30
ID Description Score Start End GO Terms
AF-A0A535R8U2-F1-model_v4 Type II secretion system protein GspF domain-containing protein 0.8841 97 320 GO:0005886
AF-A0A1Q7FJ45-F1-model_v4 Type II secretion system protein GspF domain-containing protein 0.8767 87 325 GO:0005886
AF-A0A1Q7FJ45-F1-model_v4 Type II secretion system protein GspF domain-containing protein 0.8635 87 325 GO:0005886
AF-A0A1Q8QSQ9-F1-model_v4 Flp pilus assembly protein TadB 0.8541 108 321 GO:0005886
AF-A0A5C9CMH2-F1-model_v4 Tight adherence protein B 0.8458 88 324 GO:0005886

Map