F453585

General Info

Members Datasets Scaffolds Average Seq Length
488 253 488 216

Family's Representative Sequence

Representative Sequence 3300006846|Ga0075430_100565194|Ga0075430_1005651942
Length 241
Sequence MTASRGGPRRVRERPNGRASRGSRDRVGGRGGYELRANVRDRLIESRLTPNAISMTGLVLNVVAAVLITQRLFFLAGVAFVVGSLMDTLDGRYSRMSGKGTLFGAFLDSTLDRIEEGIVLTAVAAYFASRGDELAVAATVVVVLGSLMVSYTRARAEALGVECKVGLATRPVRVVLLSGGLLFAKGAGLGDFELLAPAIYAMAGLTVFTVGQRIWHVRQQLAGEAQPPGGVTSGASEGNAT

Samples

Sample ID Description Type Environment
1 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
4 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
49 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
50 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
51 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
52 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
53 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
54 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
55 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
56 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
63 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
64 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
76 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
88 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
132 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
135 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
136 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
137 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
138 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
139 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
140 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
141 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
142 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
143 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
144 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
145 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
146 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
147 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
148 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
149 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
150 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
151 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
152 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
153 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
154 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
155 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
156 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
157 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
158 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
159 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
160 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
161 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
162 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
163 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
164 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
165 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
166 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
167 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
168 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
169 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
170 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
171 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
172 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
173 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
174 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
175 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
176 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
177 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
178 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
179 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
180 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
181 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
182 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
183 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
184 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
185 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
186 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
187 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
188 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
189 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
190 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
191 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
192 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
193 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
194 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
195 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
196 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
197 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
198 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
199 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
200 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
201 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
202 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
203 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
204 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
205 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
206 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
207 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
208 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
209 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
210 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
211 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
212 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
213 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
214 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
215 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
216 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
217 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
218 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
219 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
220 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
226 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
227 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
228 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
229 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
230 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
231 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
232 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
233 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
234 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
235 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
236 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
237 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
238 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
239 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
240 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
241 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
242 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
243 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
244 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
245 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
246 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
247 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
248 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
249 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
250 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
251 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
252 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
253 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.15
Nodule 0
Rhizoplane 14.14
Rhizosphere 77.66
Stem 0
Stem Tuber 0
Unclassified 2.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1001719 3300001977 Bacteria 3509
2 JGI24740J21852_10000392 3300001979 Bacteria 18771
3 JGI24748J21848_1000538 3300002074 Bacteria 4116
4 JGI24742J22300_10000434 3300002244 Bacteria 6167
5 Ga0070658_10074207 3300005327 Bacteria 2789
6 Ga0070683_100022585 3300005329 Bacteria 5625
7 Ga0070666_10013549 3300005335 Bacteria 5176
8 Ga0070666_10352669 3300005335 Bacteria 1053
9 Ga0070682_100000057 3300005337 Bacteria 108832
10 Ga0070682_100000100 3300005337 Bacteria 77054
11 Ga0070682_100033235 3300005337 Bacteria 3132
12 Ga0068868_100010651 3300005338 Bacteria 6664
13 Ga0068868_100013863 3300005338 Bacteria 5925
14 Ga0070689_100077260 3300005340 Bacteria 2609
15 Ga0070669_100004860 3300005353 Bacteria 9698
16 Ga0070675_100000073 3300005354 Bacteria 57652
17 Ga0070674_100000003 3300005356 Bacteria 258221
18 Ga0070674_100341218 3300005356 Bacteria 1207
19 Ga0070674_100904014 3300005356 Bacteria 769
20 Ga0070673_100010571 3300005364 Bacteria 6253
21 Ga0070688_100000848 3300005365 Bacteria 15156
22 Ga0070659_100000018 3300005366 Bacteria 156724
23 Ga0070667_100006805 3300005367 Bacteria 9496
24 Ga0070667_100957454 3300005367 Bacteria 798
25 Ga0070709_10195932 3300005434 Bacteria 1428
26 Ga0070714_100000151 3300005435 Bacteria 55747
27 Ga0070714_100014803 3300005435 Bacteria 6268
28 Ga0070710_10000012 3300005437 Bacteria 124056
29 Ga0070711_100023476 3300005439 Bacteria 4012
30 Ga0070705_100043031 3300005440 Bacteria 2586
31 Ga0070705_100162107 3300005440 Bacteria 1496
32 Ga0070678_100007766 3300005456 Bacteria 6379
33 Ga0070662_100000005 3300005457 Bacteria 183056
34 Ga0070681_10003375 3300005458 Bacteria 14931
35 Ga0068867_100000254 3300005459 Bacteria 35276
36 Ga0070685_10000932 3300005466 Bacteria 15756
37 Ga0070685_10469894 3300005466 Bacteria 885
38 Ga0070679_100012299 3300005530 Bacteria 8176
39 Ga0070684_100023911 3300005535 Bacteria 5119
40 Ga0070684_100188454 3300005535 Bacteria 1876
41 Ga0070684_100260095 3300005535 Bacteria 1588
42 Ga0068853_100981230 3300005539 Bacteria 813
43 Ga0070672_100576233 3300005543 Bacteria 979
44 Ga0070686_100012725 3300005544 Bacteria 4803
45 Ga0070695_100243115 3300005545 Bacteria 1306
46 Ga0070696_100397172 3300005546 Bacteria 1078
47 Ga0070693_100000815 3300005547 Bacteria 13820
48 Ga0070665_100003550 3300005548 Bacteria 16555
49 Ga0070665_100289460 3300005548 Bacteria 1640
50 Ga0070704_100043643 3300005549 Bacteria 3110
51 Ga0070704_100306827 3300005549 Bacteria 1324
52 Ga0068855_100148117 3300005563 Bacteria 2671
53 Ga0068854_100000563 3300005578 Bacteria 22259
54 Ga0068854_100023958 3300005578 Bacteria 4174
55 Ga0068856_100200215 3300005614 Bacteria 2011
56 Ga0068852_100000103 3300005616 Bacteria 56542
57 Ga0068866_10000002 3300005718 Bacteria 394090
58 Ga0068866_10000816 3300005718 Bacteria 13847
59 Ga0068866_10121382 3300005718 Bacteria 1473
60 Ga0068851_10047118 3300005834 Bacteria 2182
61 Ga0068863_100000032 3300005841 Bacteria 172402
62 Ga0068863_100273417 3300005841 Bacteria 1636
63 Ga0068858_100000043 3300005842 Bacteria 132444
64 Ga0068858_100096586 3300005842 Bacteria 2754
65 Ga0068858_100150120 3300005842 Bacteria 2191
66 Ga0068860_100076356 3300005843 Bacteria 3187
67 Ga0068860_100271622 3300005843 Bacteria 1655
68 Ga0068862_100128748 3300005844 Bacteria 2237
69 Ga0081455_10005032 3300005937 Bacteria 14610
70 Ga0081455_10015890 3300005937 Bacteria 7287
71 Ga0081455_10033815 3300005937 Bacteria 4588
72 Ga0081455_10214526 3300005937 Bacteria 1432
73 Ga0081538_10003370 3300005981 Bacteria 15127
74 Ga0081540_1000025 3300005983 Bacteria 157742
75 Ga0081540_1070384 3300005983 Bacteria 1620
76 Ga0081540_1095549 3300005983 Bacteria 1295
77 Ga0081539_10106845 3300005985 Bacteria 1416
78 Ga0070717_10000032 3300006028 Bacteria 136233
79 Ga0075365_10000210 3300006038 Bacteria 19586
80 Ga0075365_10035478 3300006038 Bacteria 3227
81 Ga0075365_10160000 3300006038 Bacteria 1569
82 Ga0075365_10271132 3300006038 Bacteria 1194
83 Ga0075365_10310371 3300006038 Bacteria 1110
84 Ga0075365_10329949 3300006038 Bacteria 1075
85 Ga0075363_100034627 3300006048 Bacteria 2637
86 Ga0075363_100052675 3300006048 Bacteria 2173
87 Ga0075363_100083565 3300006048 Bacteria 1749
88 Ga0075363_100223294 3300006048 Bacteria 1080
89 Ga0075364_10020914 3300006051 Bacteria 4120
90 Ga0075364_10062662 3300006051 Bacteria 2440
91 Ga0075364_10154035 3300006051 Bacteria 1549
92 Ga0075364_10243461 3300006051 Bacteria 1222
93 Ga0070715_10000012 3300006163 Bacteria 173731
94 Ga0075428_100072976 3300006844 Bacteria 3747
95 Ga0075430_100001324 3300006846 Bacteria 19981
96 Ga0075430_100565194 3300006846 Bacteria 938
97 Ga0075431_100016528 3300006847 Bacteria 7490
98 Ga0075431_100035831 3300006847 Bacteria 5108
99 Ga0075433_10005706 3300006852 Bacteria 9790
100 Ga0075433_10048147 3300006852 Bacteria 3707
101 Ga0075434_100020449 3300006871 Bacteria 6422
102 Ga0075434_100257320 3300006871 Bacteria 1764
103 Ga0075434_100452614 3300006871 Bacteria 1305
104 Ga0075429_100026461 3300006880 Bacteria 5037
105 Ga0075436_100084824 3300006914 Bacteria 2198
106 Ga0075435_100207612 3300007076 Bacteria 1661
107 Ga0111539_10003410 3300009094 Bacteria 20938
108 Ga0105245_10000091 3300009098 Bacteria 89925
109 Ga0105245_10001248 3300009098 Bacteria 22969
110 Ga0105245_10521527 3300009098 Bacteria 1207
111 Ga0105247_10000208 3300009101 Bacteria 56889
112 Ga0105247_10100586 3300009101 Bacteria 1848
113 Ga0105247_10376825 3300009101 Bacteria 1005
114 Ga0114129_10087057 3300009147 Bacteria 4333
115 Ga0114129_10093399 3300009147 Bacteria 4167
116 Ga0114129_10536356 3300009147 Bacteria 1524
117 Ga0114129_10646069 3300009147 Bacteria 1366
118 Ga0114129_11502227 3300009147 Bacteria 828
119 Ga0105243_10080664 3300009148 Bacteria 2654
120 Ga0105242_10001420 3300009176 Bacteria 18882
121 Ga0105242_10062051 3300009176 Bacteria 3075
122 Ga0105242_10124952 3300009176 Bacteria 2213
123 Ga0105242_10142166 3300009176 Bacteria 2084
124 Ga0105248_10025218 3300009177 Bacteria 6610
125 Ga0105248_10628225 3300009177 Bacteria 1212
126 Ga0105238_10000028 3300009551 Bacteria 188361
127 Ga0105249_10000192 3300009553 Bacteria 69997
128 Ga0105249_10265240 3300009553 Bacteria 1708
129 Ga0105239_10164698 3300010375 Bacteria 2479
130 Ga0157371_10012496 3300013102 Bacteria 6488
131 Ga0157370_10006452 3300013104 Bacteria 12942
132 Ga0157370_10194592 3300013104 Bacteria 1882
133 Ga0157369_10000128 3300013105 Bacteria 108576
134 Ga0157374_10009691 3300013296 Bacteria 8272
135 Ga0157374_10122228 3300013296 Bacteria 2514
136 Ga0157378_10015777 3300013297 Bacteria 6615
137 Ga0157378_10045890 3300013297 Bacteria 3884
138 Ga0157378_10186776 3300013297 Bacteria 1953
139 Ga0163162_10798205 3300013306 Bacteria 1061
140 Ga0157372_10000121 3300013307 Bacteria 83548
141 Ga0157372_10691489 3300013307 Bacteria 1187
142 Ga0157375_10000322 3300013308 Bacteria 42941
143 Ga0157375_10071829 3300013308 Bacteria 3476
144 Ga0163163_10500940 3300014325 Bacteria 1276
145 Ga0157380_10007477 3300014326 Bacteria 7757
146 Ga0157379_10017712 3300014968 Bacteria 6276
147 Ga0157379_10129624 3300014968 Bacteria 2269
148 Ga0157376_10007555 3300014969 Bacteria 7771
149 Ga0157376_10036952 3300014969 Bacteria 3960
150 Ga0163161_10000073 3300017792 Bacteria 102053
151 Ga0207656_10007456 3300025321 Bacteria 3983
152 Ga0207682_10000003 3300025893 Bacteria 128548
153 Ga0207692_10000012 3300025898 Bacteria 104402
154 Ga0207642_10000001 3300025899 Bacteria 714030
155 Ga0207642_10000003 3300025899 Bacteria 650651
156 Ga0207642_10000004 3300025899 Bacteria 407822
157 Ga0207642_10000399 3300025899 Bacteria 13040
158 Ga0207710_10000112 3300025900 Bacteria 103005
159 Ga0207710_10039837 3300025900 Bacteria 2080
160 Ga0207680_10045139 3300025903 Bacteria 2596
161 Ga0207685_10000001 3300025905 Bacteria 604473
162 Ga0207705_10235383 3300025909 Bacteria 1394
163 Ga0207707_10275492 3300025912 Bacteria 1458
164 Ga0207693_10067789 3300025915 Bacteria 2794
165 Ga0207663_10001084 3300025916 Bacteria 12491
166 Ga0207663_10034049 3300025916 Bacteria 3042
167 Ga0207660_10233550 3300025917 Bacteria 1447
168 Ga0207652_10000351 3300025921 Bacteria 47656
169 Ga0207646_10115118 3300025922 Bacteria 2415
170 Ga0207681_10003096 3300025923 Bacteria 10448
171 Ga0207694_10000008 3300025924 Bacteria 484902
172 Ga0207659_10000082 3300025926 Bacteria 57573
173 Ga0207687_10000012 3300025927 Bacteria 370729
174 Ga0207687_10000042 3300025927 Bacteria 108169
175 Ga0207687_10000613 3300025927 Bacteria 24053
176 Ga0207687_10015756 3300025927 Bacteria 4961
177 Ga0207687_10042455 3300025927 Bacteria 3129
178 Ga0207687_10135120 3300025927 Bacteria 1864
179 Ga0207700_10000032 3300025928 Bacteria 125088
180 Ga0207700_10246554 3300025928 Bacteria 1524
181 Ga0207664_10000152 3300025929 Bacteria 55754
182 Ga0207664_10018628 3300025929 Bacteria 5116
183 Ga0207690_10000136 3300025932 Bacteria 59789
184 Ga0207690_10001263 3300025932 Bacteria 16002
185 Ga0207690_10058559 3300025932 Bacteria 2606
186 Ga0207706_10000006 3300025933 Bacteria 216994
187 Ga0207706_10546993 3300025933 Bacteria 997
188 Ga0207686_10000418 3300025934 Bacteria 28994
189 Ga0207686_10105787 3300025934 Bacteria 1888
190 Ga0207686_10138687 3300025934 Bacteria 1678
191 Ga0207709_10045498 3300025935 Bacteria 2658
192 Ga0207669_10000016 3300025937 Bacteria 124532
193 Ga0207669_10000023 3300025937 Bacteria 96638
194 Ga0207669_10825492 3300025937 Bacteria 770
195 Ga0207711_10000085 3300025941 Bacteria 99467
196 Ga0207661_10035386 3300025944 Bacteria 3891
197 Ga0207661_10569965 3300025944 Bacteria 1038
198 Ga0207667_10084023 3300025949 Bacteria 3296
199 Ga0207651_10001007 3300025960 Bacteria 12456
200 Ga0207651_10068647 3300025960 Bacteria 2500
201 Ga0207712_10000003 3300025961 Bacteria 615314
202 Ga0207712_10053990 3300025961 Bacteria 2821
203 Ga0207712_10135760 3300025961 Bacteria 1881
204 Ga0207668_10005870 3300025972 Bacteria 7232
205 Ga0207640_10000026 3300025981 Bacteria 142343
206 Ga0207640_10086381 3300025981 Bacteria 2160
207 Ga0207658_10006209 3300025986 Bacteria 8161
208 Ga0207677_10001351 3300026023 Bacteria 13129
209 Ga0207677_10008339 3300026023 Bacteria 5783
210 Ga0207677_10085837 3300026023 Bacteria 2273
211 Ga0207703_10000053 3300026035 Bacteria 143924
212 Ga0207703_10057036 3300026035 Bacteria 3183
213 Ga0207639_10004562 3300026041 Bacteria 9330
214 Ga0207639_10117940 3300026041 Bacteria 2176
215 Ga0207678_10288539 3300026067 Bacteria 1409
216 Ga0207708_10119436 3300026075 Bacteria 2053
217 Ga0207708_10365092 3300026075 Bacteria 1187
218 Ga0207708_10806053 3300026075 Bacteria 809
219 Ga0207702_10014458 3300026078 Bacteria 6553
220 Ga0207641_10000071 3300026088 Bacteria 151812
221 Ga0207641_10151451 3300026088 Bacteria 2101
222 Ga0207648_10001595 3300026089 Bacteria 24839
223 Ga0207683_10015745 3300026121 Bacteria 6435
224 Ga0207683_10224990 3300026121 Bacteria 1710
225 Ga0207698_10000009 3300026142 Bacteria 281300
226 Ga0207428_10095217 3300027907 Bacteria 2307
227 Ga0268266_10001388 3300028379 Bacteria 29082
228 Ga0268264_10153201 3300028381 Bacteria 2069
229 Ga0316576_10002289 3300031727 Bacteria 10851
230 Ga0307413_10538390 3300031824 Bacteria 945
231 Ga0307410_10058171 3300031852 Bacteria 2635
232 Ga0307410_10304548 3300031852 Unclassified 1259
233 Ga0307416_100004826 3300032002 Bacteria 8199
234 Ga0307415_100004509 3300032126 Bacteria 7242
235 Ga0373944_0141765 3300035089 Bacteria 842
236 Ga0373955_0307034 3300035172 Bacteria 957
237 Ga0373962_0075575 3300035242 Bacteria 1014
238 Ga0316574_0016641 3300035398 Bacteria 4288
239 Ga0316574_0347627 3300035398 Bacteria 938
240 Ga0373935_0488667 3300035692 Bacteria 893
241 Ga0373937_0048524 3300036401 Bacteria 3887
242 Ga0316582_0051975 3300036647 Bacteria 2603
243 Ga0316584_0089517 3300036712 Bacteria 2304
244 Ga0395900_0181316 3300037418 Bacteria 2140
245 Ga0395900_0419536 3300037418 Bacteria 1299
246 Ga0395898_0011942 3300037466 Bacteria 8995
247 Ga0395898_0242516 3300037466 Bacteria 1719
248 Ga0395905_0146324 3300037471 Bacteria 2223
249 Ga0436364_0006632 3300037853 Bacteria 988
250 Ga0436364_0838148 3300037853 Bacteria 1496
251 Ga0395901_0006154 3300038443 Bacteria 12161
252 Ga0395901_0043088 3300038443 Bacteria 4682
253 Ga0395901_0217886 3300038443 Bacteria 1996
254 Ga0395901_0552508 3300038443 Bacteria 1167
255 Ga0395901_0735013 3300038443 Bacteria 981
256 Ga0451853_2464716 3300041512 Bacteria 4167
257 Ga0451853_2704406 3300041512 Bacteria 1230
258 Ga0466963_0000406 3300044694 Bacteria 19714
259 Ga0466963_0028153 3300044694 Bacteria 3605
260 Ga0466964_0110796 3300044706 Bacteria 1224
261 Ga0466957_0011588 3300044842 Bacteria 5094
262 Ga0466957_0221486 3300044842 Bacteria 1249
263 Ga0466967_0000007 3300045976 Bacteria 135597
264 Ga0466967_0925125 3300045976 Bacteria 867
265 Ga0495592_0008905 3300046454 Bacteria 7538
266 Ga0495603_0000291 3300046455 Bacteria 26643
267 Ga0495603_0028933 3300046455 Bacteria 3342
268 Ga0495603_0125745 3300046455 Bacteria 1494
269 Ga0495641_0006476 3300046461 Bacteria 7578
270 Ga0495651_0124966 3300046462 Bacteria 1885
271 Ga0495653_0139591 3300046463 Bacteria 1706
272 Ga0495653_0167980 3300046463 Bacteria 1517
273 Ga0495582_0000007 3300046473 Bacteria 139882
274 Ga0495582_0208166 3300046473 Bacteria 1118
275 Ga0495662_0007156 3300046476 Bacteria 5529
276 Ga0495662_0009062 3300046476 Bacteria 4887
277 Ga0495594_0000005 3300046499 Bacteria 175437
278 Ga0495608_0000063 3300046511 Bacteria 83763
279 Ga0495608_0001675 3300046511 Bacteria 15943
280 Ga0495608_0088589 3300046511 Bacteria 2003
281 Ga0495618_0000003 3300046514 Bacteria 256269
282 Ga0495618_0248980 3300046514 Bacteria 1115
283 Ga0495620_0000446 3300046515 Bacteria 27496
284 Ga0495628_0025908 3300046516 Bacteria 4789
285 Ga0495628_0068055 3300046516 Bacteria 2779
286 Ga0495628_0069383 3300046516 Bacteria 2749
287 Ga0495628_0073836 3300046516 Bacteria 2657
288 Ga0495628_0282640 3300046516 Bacteria 1232
289 Ga0495630_0000007 3300046517 Bacteria 376915
290 Ga0495644_0036832 3300046523 Bacteria 1845
291 Ga0495640_0063483 3300046533 Bacteria 2501
292 Ga0495586_0000384 3300046535 Bacteria 27060
293 Ga0495587_0084393 3300046536 Bacteria 1839
294 Ga0495587_0097577 3300046536 Bacteria 1694
295 Ga0495598_0102383 3300046537 Bacteria 949
296 Ga0495621_0002454 3300046539 Bacteria 4998
297 Ga0495622_0000026 3300046557 Bacteria 137934
298 Ga0495633_0061641 3300046558 Bacteria 1756
299 Ga0495667_0093086 3300046559 Bacteria 1951
300 Ga0495656_0001151 3300046615 Bacteria 8575
301 Ga0495634_0000125 3300046642 Bacteria 65586
302 Ga0495634_0181222 3300046642 Bacteria 1318
303 Ga0495625_0000319 3300046660 Bacteria 73241
304 Ga0495635_0000009 3300046663 Bacteria 259024
305 Ga0495635_0005067 3300046663 Bacteria 9160
306 Ga0495588_0000241 3300046674 Bacteria 46762
307 Ga0495657_0000084 3300046675 Bacteria 83088
308 Ga0495657_0010871 3300046675 Bacteria 6833
309 Ga0495599_0180047 3300046678 Bacteria 1303
310 Ga0495647_0000014 3300046681 Bacteria 87792
311 Ga0495647_0018797 3300046681 Bacteria 2465
312 Ga0495647_0072893 3300046681 Bacteria 1378
313 Ga0495658_0000007 3300046683 Bacteria 139822
314 Ga0495658_0035444 3300046683 Bacteria 2745
315 Ga0495669_0000074 3300046684 Bacteria 66373
316 Ga0495669_0140237 3300046684 Bacteria 1141
317 Ga0495613_0000003 3300046689 Bacteria 248826
318 Ga0495613_0000522 3300046689 Bacteria 32082
319 Ga0495613_0077335 3300046689 Bacteria 2421
320 Ga0495613_0101200 3300046689 Bacteria 2081
321 Ga0495624_0000002 3300046690 Bacteria 189957
322 Ga0495624_0000256 3300046690 Bacteria 42059
323 Ga0495624_0080088 3300046690 Bacteria 2024
324 Ga0495670_0012536 3300046691 Bacteria 4171
325 Ga0495600_0056852 3300046809 Bacteria 2556
326 Ga0495604_0000344 3300047317 Bacteria 41631
327 Ga0495672_0162348 3300047320 Bacteria 1147
328 Ga0495676_0001046 3300047321 Bacteria 23385
329 Ga0495676_0002096 3300047321 Bacteria 17584
330 Ga0495676_0056079 3300047321 Bacteria 3118
331 Ga0495676_0223929 3300047321 Bacteria 1295
332 Ga0495680_0015114 3300047322 Bacteria 6666
333 Ga0495680_0026325 3300047322 Bacteria 4798
334 Ga0495680_0132401 3300047322 Bacteria 1831
335 Ga0495675_0002313 3300047444 Bacteria 11383
336 Ga0495679_004836 3300047446 Bacteria 6089
337 Ga0495679_034042 3300047446 Bacteria 1624
338 Ga0495673_0087938 3300047469 Bacteria 1274
339 Ga0495602_0000008 3300048088 Bacteria 260157
340 Ga0495602_0274249 3300048088 Bacteria 1245
341 Ga0495602_0302337 3300048088 Bacteria 1170
342 Ga0496100_0000008 3300048903 Bacteria 231974
343 Ga0496100_0000016 3300048903 Bacteria 166058
344 Ga0496100_0010247 3300048903 Bacteria 5301
345 Ga0496101_0000016 3300048904 Bacteria 240753
346 Ga0496101_0000038 3300048904 Bacteria 166058
347 Ga0496101_0006747 3300048904 Bacteria 7404
348 Ga0496101_0010480 3300048904 Bacteria 6121
349 Ga0496101_0408257 3300048904 Bacteria 1070
350 Ga0496102_0032211 3300048905 Bacteria 4709
351 Ga0496102_0225610 3300048905 Bacteria 1766
352 Ga0496102_0257176 3300048905 Bacteria 1646
353 Ga0496102_0570907 3300048905 Bacteria 1054
354 Ga0496103_0005433 3300048906 Bacteria 7627
355 Ga0496103_0015379 3300048906 Bacteria 4551
356 Ga0496104_0000003 3300048907 Bacteria 669219
357 Ga0496104_0000007 3300048907 Bacteria 524804
358 Ga0496104_0046511 3300048907 Bacteria 4087
359 Ga0496104_0047597 3300048907 Bacteria 4041
360 Ga0496105_0000002 3300048908 Bacteria 753215
361 Ga0496105_0000008 3300048908 Bacteria 335652
362 Ga0496105_0048908 3300048908 Bacteria 3490
363 Ga0496105_0204200 3300048908 Bacteria 1612
364 Ga0496106_0000013 3300048909 Bacteria 202263
365 Ga0496106_0000027 3300048909 Bacteria 149560
366 Ga0496106_0000117 3300048909 Bacteria 60781
367 Ga0496106_0025279 3300048909 Bacteria 4418
368 Ga0496106_0064237 3300048909 Bacteria 2792
369 Ga0496106_0151767 3300048909 Bacteria 1828
370 Ga0496106_0552666 3300048909 Bacteria 924
371 Ga0496106_0584497 3300048909 Bacteria 895
372 Ga0496107_0000003 3300048910 Bacteria 304038
373 Ga0496107_0000009 3300048910 Bacteria 231682
374 Ga0496107_0021890 3300048910 Bacteria 4516
375 Ga0496107_0187260 3300048910 Bacteria 1537
376 Ga0496107_0311735 3300048910 Bacteria 1171
377 Ga0496108_0000002 3300048911 Bacteria 700890
378 Ga0496108_0000221 3300048911 Bacteria 51191
379 Ga0496108_0012619 3300048911 Bacteria 6884
380 Ga0496109_0000001 3300048912 Bacteria 700852
381 Ga0496109_0000195 3300048912 Bacteria 60380
382 Ga0496109_0021685 3300048912 Bacteria 5684
383 Ga0496109_0022549 3300048912 Bacteria 5578
384 Ga0496109_0025389 3300048912 Bacteria 5280
385 Ga0496109_0156158 3300048912 Bacteria 2137
386 Ga0496110_0000004 3300048913 Bacteria 122867
387 Ga0496110_0008159 3300048913 Bacteria 8414
388 Ga0496110_0021145 3300048913 Bacteria 5501
389 Ga0496110_0023808 3300048913 Bacteria 5212
390 Ga0496110_0041184 3300048913 Bacteria 4030
391 Ga0496110_0369685 3300048913 Bacteria 1306
392 Ga0496111_0000002 3300048914 Bacteria 135794
393 Ga0496111_0020437 3300048914 Bacteria 4609
394 Ga0496111_0034184 3300048914 Bacteria 3629
395 Ga0496111_0043781 3300048914 Bacteria 3218
396 Ga0496111_0078141 3300048914 Bacteria 2413
397 Ga0496112_0000002 3300048915 Bacteria 782039
398 Ga0496112_0057803 3300048915 Bacteria 3819
399 Ga0496112_0072463 3300048915 Bacteria 3405
400 Ga0496112_0368092 3300048915 Bacteria 1379
401 Ga0496112_0394041 3300048915 Bacteria 1325
402 Ga0496113_0000012 3300048916 Bacteria 81903
403 Ga0496113_0017111 3300048916 Bacteria 5026
404 Ga0496113_0102310 3300048916 Bacteria 2221
405 Ga0496113_0159901 3300048916 Bacteria 1780
406 Ga0496114_0000010 3300048917 Bacteria 363396
407 Ga0496114_0160307 3300048917 Bacteria 1955
408 Ga0496114_0245948 3300048917 Bacteria 1573
409 Ga0496115_0006755 3300048918 Bacteria 8414
410 Ga0496115_0011379 3300048918 Bacteria 6667
411 Ga0496119_0013117 3300048922 Bacteria 6637
412 Ga0496119_0030465 3300048922 Bacteria 3636
413 Ga0496119_0266025 3300048922 Bacteria 858
414 Ga0496120_0058866 3300048923 Bacteria 2156
415 Ga0496121_0165630 3300048924 Bacteria 1611
416 Ga0496121_0346727 3300048924 Bacteria 990
417 Ga0501034_0061317 3300049571 Bacteria 3777
418 Ga0501034_0273475 3300049571 Bacteria 1630
419 Ga0501034_0706775 3300049571 Bacteria 906
420 Ga0501036_0338011 3300049572 Bacteria 1258
421 Ga0501040_0124115 3300049576 Bacteria 1813
422 Ga0501042_0048403 3300049578 Bacteria 3031
423 Ga0501042_0140228 3300049578 Bacteria 1743
424 Ga0501042_0212404 3300049578 Bacteria 1396
425 Ga0501046_0199308 3300049580 Bacteria 1490
426 Ga0501068_0149282 3300049584 Bacteria 1468
427 Ga0501068_0230148 3300049584 Bacteria 1179
428 Ga0501069_0034626 3300049585 Bacteria 2781
429 Ga0501070_0049672 3300049586 Bacteria 3483
430 Ga0501071_0151842 3300049587 Bacteria 1728
431 Ga0501071_0201718 3300049587 Bacteria 1494
432 Ga0501071_0761511 3300049587 Bacteria 746
433 Ga0501072_0614533 3300049588 Bacteria 856
434 Ga0501073_0039098 3300049589 Bacteria 3362
435 Ga0501075_0004569 3300049591 Bacteria 9381
436 Ga0501077_0275229 3300049593 Bacteria 1071
437 Ga0501077_0382408 3300049593 Bacteria 899
438 Ga0501079_0151927 3300049741 Bacteria 1805
439 Ga0501079_0196406 3300049741 Bacteria 1575
440 Ga0501079_0304427 3300049741 Bacteria 1247
441 Ga0501080_0065264 3300049742 Bacteria 3386
442 Ga0501081_0166745 3300049743 Bacteria 1589
443 nmdc:mga03n38_26941_c1 3300050490 Bacteria 2379
444 nmdc:mga03n38_49767_c1 3300050490 Bacteria 1865
445 nmdc:mga00v17_23914_c1 3300050491 Bacteria 3539
446 nmdc:mga00v17_51679_c1 3300050491 Bacteria 2499
447 nmdc:mga00v17_61717_c1 3300050491 Bacteria 2304
448 nmdc:mga00v17_69550_c1 3300050491 Bacteria 2179
449 nmdc:mga0yw44_2101_c1 3300050492 Bacteria 8335
450 nmdc:mga0yw44_47442_c1 3300050492 Bacteria 2586
451 nmdc:mga0yw44_601382_c1 3300050492 Bacteria 747
452 nmdc:mga0yw44_6253_c1 3300050492 Bacteria 5735
453 nmdc:mga0yw44_643193_c1 3300050492 Bacteria 721
454 nmdc:mga0yw44_8125_c1 3300050492 Bacteria 3894
455 nmdc:mga0yw44_84108_c1 3300050492 Bacteria 2000
456 nmdc:mga0yw44_9862_c2 3300050492 Bacteria 3026
457 nmdc:mga06z11_92190_c1 3300050494 Bacteria 1647
458 nmdc:mga06z11_96933_c2 3300050494 Bacteria 1199
459 nmdc:mga05p37_284766_c1 3300050507 Bacteria 1969
460 nmdc:mga05p37_70250_c1 3300050507 Bacteria 4307
461 nmdc:mga05p37_75060_c1 3300050507 Bacteria 4162
462 nmdc:mga09592_19872_c1 3300050508 Bacteria 5517
463 nmdc:mga0qj67_40200_c1 3300050509 Bacteria 3676
464 nmdc:mga06r32_117551_c1 3300050510 Bacteria 2621
465 nmdc:mga08y16_150556_c1 3300050511 Bacteria 2419
466 nmdc:mga0n895_256774_c1 3300050512 Bacteria 1774
467 nmdc:mga0n895_2713_c1 3300050512 Bacteria 13966
468 nmdc:mga0rr50_393985_c1 3300050513 Bacteria 1169
469 nmdc:mga0a205_104938_c1 3300050515 Bacteria 2725
470 nmdc:mga0a205_124_c2 3300050515 Bacteria 20732
471 nmdc:mga0a205_64461_c1 3300050515 Bacteria 3539
472 Ga0495601_0000080 3300053077 Bacteria 51518
473 Ga0495601_0000098 3300053077 Bacteria 48076
474 Ga0495601_0109523 3300053077 Bacteria 1788
475 Ga0495601_0205747 3300053077 Bacteria 1286
476 Ga0495612_0000358 3300053078 Bacteria 18497
477 Ga0495612_0007035 3300053078 Bacteria 4601
478 Ga0495595_0000001 3300053084 Bacteria 495226
479 Ga0495595_0000069 3300053084 Bacteria 50835
480 Ga0495595_0020242 3300053084 Bacteria 2895
481 Ga0495619_0000024 3300053085 Bacteria 180821
482 Ga0495619_0000038 3300053085 Bacteria 121365
483 Ga0495619_0000065 3300053085 Bacteria 83763
484 Ga0495619_0000269 3300053085 Bacteria 37723
485 Ga0495619_0022766 3300053085 Bacteria 4012
486 Ga0495619_0035122 3300053085 Bacteria 3260
487 Ga0501084_0266126 3300054114 Bacteria 1447
488 Ga0501082_0267788 3300060353 Bacteria 1487

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009147 Ga0114129_11502227 Ga0114129_115022271 185
2 3300006844 Ga0075428_100072976 Ga0075428_1000729763 186
3 3300006846 Ga0075430_100001324 Ga0075430_1000013242 186
4 3300006847 Ga0075431_100035831 Ga0075431_1000358313 186
5 3300006880 Ga0075429_100026461 Ga0075429_1000264613 186
6 3300049576 Ga0501040_0124115 Ga0501040_0124115_249_872 186
7 3300049587 Ga0501071_0201718 Ga0501071_0201718_170_793 186
8 3300049741 Ga0501079_0151927 Ga0501079_0151927_695_1318 186
9 3300049743 Ga0501081_0166745 Ga0501081_0166745_603_1226 186
10 3300050508 nmdc:mga09592_19872_c1 nmdc:mga09592_19872_c1_3969_4592 186
11 3300050509 nmdc:mga0qj67_40200_c1 nmdc:mga0qj67_40200_c1_2711_3334 186
12 3300046514 Ga0495618_0248980 Ga0495618_0248980_57_731 188
13 3300044706 Ga0466964_0110796 Ga0466964_0110796_335_919 189
14 3300006038 Ga0075365_10329949 Ga0075365_103299491 191
15 3300037466 Ga0395898_0011942 Ga0395898_0011942_2057_2743 192
16 3300037471 Ga0395905_0146324 Ga0395905_0146324_1422_2108 192
17 3300038443 Ga0395901_0006154 Ga0395901_0006154_6476_7162 192
18 3300047321 Ga0495676_0223929 Ga0495676_0223929_642_1229 192
19 3300049593 Ga0501077_0275229 Ga0501077_0275229_361_951 193
20 3300005340 Ga0070689_100077260 Ga0070689_1000772602 194
21 3300005356 Ga0070674_100341218 Ga0070674_1003412182 194
22 3300005356 Ga0070674_100904014 Ga0070674_1009040141 194
23 3300005367 Ga0070667_100957454 Ga0070667_1009574541 194
24 3300005434 Ga0070709_10195932 Ga0070709_101959322 194
25 3300005435 Ga0070714_100014803 Ga0070714_1000148032 194
26 3300005440 Ga0070705_100162107 Ga0070705_1001621071 194
27 3300005543 Ga0070672_100576233 Ga0070672_1005762332 194
28 3300005544 Ga0070686_100012725 Ga0070686_1000127254 194
29 3300005546 Ga0070696_100397172 Ga0070696_1003971721 194
30 3300005549 Ga0070704_100043643 Ga0070704_1000436432 194
31 3300005718 Ga0068866_10121382 Ga0068866_101213822 194
32 3300005843 Ga0068860_100271622 Ga0068860_1002716222 194
33 3300005937 Ga0081455_10015890 Ga0081455_100158906 194
34 3300006038 Ga0075365_10160000 Ga0075365_101600002 194
35 3300009098 Ga0105245_10521527 Ga0105245_105215271 194
36 3300009177 Ga0105248_10628225 Ga0105248_106282252 194
37 3300013296 Ga0157374_10122228 Ga0157374_101222282 194
38 3300013308 Ga0157375_10071829 Ga0157375_100718294 194
39 3300014325 Ga0163163_10500940 Ga0163163_105009402 194
40 3300025922 Ga0207646_10115118 Ga0207646_101151182 194
41 3300025927 Ga0207687_10042455 Ga0207687_100424552 194
42 3300025929 Ga0207664_10018628 Ga0207664_100186284 194
43 3300025937 Ga0207669_10825492 Ga0207669_108254921 194
44 3300025960 Ga0207651_10068647 Ga0207651_100686473 194
45 3300026023 Ga0207677_10085837 Ga0207677_100858373 194
46 3300031824 Ga0307413_10538390 Ga0307413_105383901 194
47 3300035242 Ga0373962_0075575 Ga0373962_0075575_134_775 194
48 3300035692 Ga0373935_0488667 Ga0373935_0488667_55_696 194
49 3300037418 Ga0395900_0419536 Ga0395900_0419536_62_676 194
50 3300041512 Ga0451853_2704406 Ga0451853_2704406_175_789 194
51 3300046455 Ga0495603_0125745 Ga0495603_0125745_791_1432 194
52 3300046461 Ga0495641_0006476 Ga0495641_0006476_1510_2151 194
53 3300046473 Ga0495582_0208166 Ga0495582_0208166_414_1055 194
54 3300046681 Ga0495647_0072893 Ga0495647_0072893_327_968 194
55 3300047321 Ga0495676_0056079 Ga0495676_0056079_210_851 194
56 3300048904 Ga0496101_0010480 Ga0496101_0010480_2221_2862 194
57 3300048905 Ga0496102_0032211 Ga0496102_0032211_1792_2433 194
58 3300048906 Ga0496103_0015379 Ga0496103_0015379_2012_2653 194
59 3300048907 Ga0496104_0047597 Ga0496104_0047597_3043_3684 194
60 3300048908 Ga0496105_0048908 Ga0496105_0048908_2248_2889 194
61 3300048909 Ga0496106_0025279 Ga0496106_0025279_1793_2434 194
62 3300048910 Ga0496107_0021890 Ga0496107_0021890_1891_2532 194
63 3300048910 Ga0496107_0311735 Ga0496107_0311735_196_807 194
64 3300048911 Ga0496108_0012619 Ga0496108_0012619_1250_1891 194
65 3300048912 Ga0496109_0022549 Ga0496109_0022549_3619_4260 194
66 3300048912 Ga0496109_0025389 Ga0496109_0025389_4363_4974 194
67 3300048913 Ga0496110_0041184 Ga0496110_0041184_1050_1661 194
68 3300048913 Ga0496110_0369685 Ga0496110_0369685_620_1261 194
69 3300048914 Ga0496111_0020437 Ga0496111_0020437_356_997 194
70 3300048914 Ga0496111_0078141 Ga0496111_0078141_1765_2376 194
71 3300048915 Ga0496112_0057803 Ga0496112_0057803_2733_3374 194
72 3300048917 Ga0496114_0245948 Ga0496114_0245948_615_1256 194
73 3300048918 Ga0496115_0011379 Ga0496115_0011379_281_922 194
74 3300048922 Ga0496119_0266025 Ga0496119_0266025_89_730 194
75 3300049584 Ga0501068_0230148 Ga0501068_0230148_245_853 194
76 3300047320 Ga0495672_0162348 Ga0495672_0162348_447_1034 195
77 3300049741 Ga0501079_0196406 Ga0501079_0196406_536_1213 195
78 3300005335 Ga0070666_10352669 Ga0070666_103526691 196
79 3300007076 Ga0075435_100207612 Ga0075435_1002076121 196
80 3300009147 Ga0114129_10536356 Ga0114129_105363562 196
81 3300031852 Ga0307410_10304548 Ga0307410_103045481 196
82 3300048909 Ga0496106_0584497 Ga0496106_0584497_246_842 196
83 3300048910 Ga0496107_0187260 Ga0496107_0187260_686_1282 196
84 3300049571 Ga0501034_0273475 Ga0501034_0273475_984_1577 196
85 3300049571 Ga0501034_0706775 Ga0501034_0706775_258_851 196
86 3300049572 Ga0501036_0338011 Ga0501036_0338011_218_814 196
87 3300049584 Ga0501068_0149282 Ga0501068_0149282_103_696 196
88 3300049585 Ga0501069_0034626 Ga0501069_0034626_646_1239 196
89 3300049586 Ga0501070_0049672 Ga0501070_0049672_2633_3226 196
90 3300049587 Ga0501071_0151842 Ga0501071_0151842_197_790 196
91 3300049587 Ga0501071_0761511 Ga0501071_0761511_28_621 196
92 3300049588 Ga0501072_0614533 Ga0501072_0614533_29_622 196
93 3300049589 Ga0501073_0039098 Ga0501073_0039098_830_1423 196
94 3300049741 Ga0501079_0304427 Ga0501079_0304427_224_817 196
95 3300049742 Ga0501080_0065264 Ga0501080_0065264_1375_1968 196
96 3300050494 nmdc:mga06z11_96933_c2 nmdc:mga06z11_96933_c2_338_934 196
97 3300050512 nmdc:mga0n895_256774_c1 nmdc:mga0n895_256774_c1_172_768 196
98 3300050515 nmdc:mga0a205_104938_c1 nmdc:mga0a205_104938_c1_1737_2333 196
99 3300054114 Ga0501084_0266126 Ga0501084_0266126_828_1424 196
100 3300005535 Ga0070684_100188454 Ga0070684_1001884542 197
101 3300035089 Ga0373944_0141765 Ga0373944_0141765_160_780 197
102 3300045976 Ga0466967_0925125 Ga0466967_0925125_49_729 197
103 3300048922 Ga0496119_0030465 Ga0496119_0030465_627_1271 197
104 3300050492 nmdc:mga0yw44_601382_c1 nmdc:mga0yw44_601382_c1_28_669 197
105 3300005337 Ga0070682_100033235 Ga0070682_1000332352 198
106 3300005353 Ga0070669_100004860 Ga0070669_1000048603 198
107 3300005366 Ga0070659_100000018 Ga0070659_10000001854 198
108 3300005435 Ga0070714_100000151 Ga0070714_1000001514 198
109 3300005437 Ga0070710_10000012 Ga0070710_1000001244 198
110 3300006028 Ga0070717_10000032 Ga0070717_10000032105 198
111 3300014969 Ga0157376_10007555 Ga0157376_100075553 198
112 3300025898 Ga0207692_10000012 Ga0207692_10000012100 198
113 3300025923 Ga0207681_10003096 Ga0207681_100030967 198
114 3300025927 Ga0207687_10135120 Ga0207687_101351203 198
115 3300025929 Ga0207664_10000152 Ga0207664_1000015266 198
116 3300025932 Ga0207690_10000136 Ga0207690_1000013654 198
117 3300046516 Ga0495628_0282640 Ga0495628_0282640_288_974 198
118 3300046689 Ga0495613_0000522 Ga0495613_0000522_10142_10756 198
119 3300048088 Ga0495602_0000008 Ga0495602_0000008_29729_30343 198
120 3300048904 Ga0496101_0408257 Ga0496101_0408257_113_733 198
121 3300048912 Ga0496109_0021685 Ga0496109_0021685_985_1671 198
122 3300048913 Ga0496110_0008159 Ga0496110_0008159_7054_7740 198
123 3300048915 Ga0496112_0394041 Ga0496112_0394041_626_1246 198
124 3300053077 Ga0495601_0000098 Ga0495601_0000098_43649_44263 198
125 3300053077 Ga0495601_0205747 Ga0495601_0205747_122_808 198
126 3300053078 Ga0495612_0000358 Ga0495612_0000358_13696_14382 198
127 3300005937 Ga0081455_10214526 Ga0081455_102145261 199
128 3300006038 Ga0075365_10000210 Ga0075365_100002104 199
129 3300006048 Ga0075363_100052675 Ga0075363_1000526752 199
130 3300006048 Ga0075363_100223294 Ga0075363_1002232942 199
131 3300006871 Ga0075434_100257320 Ga0075434_1002573202 199
132 3300006914 Ga0075436_100084824 Ga0075436_1000848242 199
133 3300037418 Ga0395900_0181316 Ga0395900_0181316_1394_2026 199
134 3300049578 Ga0501042_0140228 Ga0501042_0140228_835_1464 199
135 3300049593 Ga0501077_0382408 Ga0501077_0382408_110_739 199
136 3300050491 nmdc:mga00v17_23914_c1 nmdc:mga00v17_23914_c1_2522_3127 199
137 3300050492 nmdc:mga0yw44_2101_c1 nmdc:mga0yw44_2101_c1_1715_2320 199
138 3300005539 Ga0068853_100981230 Ga0068853_1009812301 200
139 3300006038 Ga0075365_10310371 Ga0075365_103103712 201
140 3300044694 Ga0466963_0028153 Ga0466963_0028153_2666_3358 201
141 3300049578 Ga0501042_0212404 Ga0501042_0212404_351_986 201
142 3300050492 nmdc:mga0yw44_84108_c1 nmdc:mga0yw44_84108_c1_1267_1923 201
143 3300050494 nmdc:mga06z11_92190_c1 nmdc:mga06z11_92190_c1_463_1119 201
144 3300060353 Ga0501082_0267788 Ga0501082_0267788_492_1127 201
145 3300006051 Ga0075364_10243461 Ga0075364_102434612 202
146 3300037853 Ga0436364_0006632 Ga0436364_0006632_235_903 202
147 3300046539 Ga0495621_0002454 Ga0495621_0002454_142_753 202
148 3300048909 Ga0496106_0064237 Ga0496106_0064237_859_1491 202
149 3300048915 Ga0496112_0000002 Ga0496112_0000002_520515_521126 202
150 3300048916 Ga0496113_0102310 Ga0496113_0102310_952_1563 202
151 3300049580 Ga0501046_0199308 Ga0501046_0199308_167_838 202
152 3300050491 nmdc:mga00v17_61717_c1 nmdc:mga00v17_61717_c1_997_1614 202
153 3300050492 nmdc:mga0yw44_643193_c1 nmdc:mga0yw44_643193_c1_65_706 202
154 3300005337 Ga0070682_100000057 Ga0070682_10000005746 203
155 3300005439 Ga0070711_100023476 Ga0070711_1000234765 203
156 3300005981 Ga0081538_10003370 Ga0081538_1000337014 203
157 3300006038 Ga0075365_10271132 Ga0075365_102711321 203
158 3300006048 Ga0075363_100083565 Ga0075363_1000835652 203
159 3300006051 Ga0075364_10062662 Ga0075364_100626623 203
160 3300025916 Ga0207663_10001084 Ga0207663_100010843 203
161 3300026041 Ga0207639_10004562 Ga0207639_100045629 203
162 3300031727 Ga0316576_10002289 Ga0316576_1000228910 203
163 3300035398 Ga0316574_0016641 Ga0316574_0016641_852_1496 203
164 3300036712 Ga0316584_0089517 Ga0316584_0089517_1456_2100 203
165 3300048917 Ga0496114_0160307 Ga0496114_0160307_735_1400 203
166 3300050492 nmdc:mga0yw44_6253_c1 nmdc:mga0yw44_6253_c1_4117_4761 203
167 3300050492 nmdc:mga0yw44_9862_c2 nmdc:mga0yw44_9862_c2_1688_2332 203
168 3300006038 Ga0075365_10035478 Ga0075365_100354784 204
169 3300037853 Ga0436364_0838148 Ga0436364_0838148_365_1063 204
170 3300038443 Ga0395901_0217886 Ga0395901_0217886_581_1255 204
171 3300044842 Ga0466957_0221486 Ga0466957_0221486_367_1059 204
172 3300047317 Ga0495604_0000344 Ga0495604_0000344_3820_4515 204
173 3300050491 nmdc:mga00v17_51679_c1 nmdc:mga00v17_51679_c1_1761_2390 204
174 3300050492 nmdc:mga0yw44_8125_c1 nmdc:mga0yw44_8125_c1_2337_2966 204
175 3300006051 Ga0075364_10020914 Ga0075364_100209144 205
176 3300025961 Ga0207712_10135760 Ga0207712_101357603 205
177 3300031852 Ga0307410_10058171 Ga0307410_100581713 205
178 3300032002 Ga0307416_100004826 Ga0307416_1000048267 205
179 3300048903 Ga0496100_0010247 Ga0496100_0010247_73_756 205
180 3300048904 Ga0496101_0006747 Ga0496101_0006747_4506_5189 205
181 3300048914 Ga0496111_0034184 Ga0496111_0034184_1419_2102 205
182 3300050490 nmdc:mga03n38_49767_c1 nmdc:mga03n38_49767_c1_907_1566 205
183 3300005937 Ga0081455_10005032 Ga0081455_1000503215 206
184 3300005983 Ga0081540_1095549 Ga0081540_10955491 206
185 3300006048 Ga0075363_100034627 Ga0075363_1000346272 206
186 3300006847 Ga0075431_100016528 Ga0075431_1000165283 206
187 3300009094 Ga0111539_10003410 Ga0111539_1000341023 206
188 3300009147 Ga0114129_10087057 Ga0114129_100870572 206
189 3300027907 Ga0207428_10095217 Ga0207428_100952173 206
190 3300035398 Ga0316574_0347627 Ga0316574_0347627_30_683 206
191 3300036647 Ga0316582_0051975 Ga0316582_0051975_632_1276 206
192 3300037466 Ga0395898_0242516 Ga0395898_0242516_459_1103 206
193 3300038443 Ga0395901_0043088 Ga0395901_0043088_3322_3966 206
194 3300038443 Ga0395901_0735013 Ga0395901_0735013_325_957 206
195 3300044694 Ga0466963_0000406 Ga0466963_0000406_3873_4526 206
196 3300050490 nmdc:mga03n38_26941_c1 nmdc:mga03n38_26941_c1_922_1563 206
197 3300050492 nmdc:mga0yw44_47442_c1 nmdc:mga0yw44_47442_c1_666_1310 206
198 3300050507 nmdc:mga05p37_70250_c1 nmdc:mga05p37_70250_c1_2456_3100 206
199 3300050510 nmdc:mga06r32_117551_c1 nmdc:mga06r32_117551_c1_1525_2169 206
200 3300050511 nmdc:mga08y16_150556_c1 nmdc:mga08y16_150556_c1_117_761 206
201 3300013297 Ga0157378_10186776 Ga0157378_101867763 207
202 3300005937 Ga0081455_10033815 Ga0081455_100338155 208
203 3300006852 Ga0075433_10005706 Ga0075433_100057065 208
204 3300006871 Ga0075434_100020449 Ga0075434_1000204491 208
205 3300009147 Ga0114129_10093399 Ga0114129_100933993 208
206 3300038443 Ga0395901_0552508 Ga0395901_0552508_374_1066 208
207 3300048909 Ga0496106_0151767 Ga0496106_0151767_20_730 208
208 3300048913 Ga0496110_0021145 Ga0496110_0021145_2506_3216 208
209 3300048916 Ga0496113_0017111 Ga0496113_0017111_622_1332 208
210 3300049571 Ga0501034_0061317 Ga0501034_0061317_2227_2886 208
211 3300050507 nmdc:mga05p37_75060_c1 nmdc:mga05p37_75060_c1_2502_3212 208
212 3300050512 nmdc:mga0n895_2713_c1 nmdc:mga0n895_2713_c1_6164_6874 208
213 3300050515 nmdc:mga0a205_64461_c1 nmdc:mga0a205_64461_c1_987_1697 208
214 3300026121 Ga0207683_10224990 Ga0207683_102249902 209
215 3300035172 Ga0373955_0307034 Ga0373955_0307034_168_830 209
216 3300053085 Ga0495619_0000269 Ga0495619_0000269_30515_31180 209
217 3300002074 JGI24748J21848_1000538 JGI24748J21848_10005383 210
218 3300002244 JGI24742J22300_10000434 JGI24742J22300_100004344 210
219 3300005329 Ga0070683_100022585 Ga0070683_1000225852 210
220 3300005338 Ga0068868_100013863 Ga0068868_1000138634 210
221 3300005356 Ga0070674_100000003 Ga0070674_10000000389 210
222 3300005364 Ga0070673_100010571 Ga0070673_1000105714 210
223 3300005367 Ga0070667_100006805 Ga0070667_1000068055 210
224 3300005457 Ga0070662_100000005 Ga0070662_100000005140 210
225 3300005458 Ga0070681_10003375 Ga0070681_100033751 210
226 3300005459 Ga0068867_100000254 Ga0068867_1000002546 210
227 3300005530 Ga0070679_100012299 Ga0070679_1000122997 210
228 3300005535 Ga0070684_100023911 Ga0070684_1000239112 210
229 3300005535 Ga0070684_100260095 Ga0070684_1002600952 210
230 3300005547 Ga0070693_100000815 Ga0070693_1000008152 210
231 3300005548 Ga0070665_100289460 Ga0070665_1002894602 210
232 3300005549 Ga0070704_100306827 Ga0070704_1003068272 210
233 3300005578 Ga0068854_100023958 Ga0068854_1000239583 210
234 3300005718 Ga0068866_10000002 Ga0068866_10000002322 210
235 3300005718 Ga0068866_10000816 Ga0068866_1000081611 210
236 3300005841 Ga0068863_100000032 Ga0068863_100000032149 210
237 3300005841 Ga0068863_100273417 Ga0068863_1002734172 210
238 3300005842 Ga0068858_100000043 Ga0068858_10000004329 210
239 3300005842 Ga0068858_100096586 Ga0068858_1000965862 210
240 3300005842 Ga0068858_100150120 Ga0068858_1001501202 210
241 3300005843 Ga0068860_100076356 Ga0068860_1000763563 210
242 3300005844 Ga0068862_100128748 Ga0068862_1001287482 210
243 3300006163 Ga0070715_10000012 Ga0070715_10000012171 210
244 3300006852 Ga0075433_10048147 Ga0075433_100481472 210
245 3300006871 Ga0075434_100452614 Ga0075434_1004526142 210
246 3300009098 Ga0105245_10001248 Ga0105245_100012487 210
247 3300009101 Ga0105247_10100586 Ga0105247_101005862 210
248 3300009148 Ga0105243_10080664 Ga0105243_100806642 210
249 3300009176 Ga0105242_10001420 Ga0105242_1000142018 210
250 3300009176 Ga0105242_10062051 Ga0105242_100620513 210
251 3300009176 Ga0105242_10142166 Ga0105242_101421662 210
252 3300009551 Ga0105238_10000028 Ga0105238_1000002861 210
253 3300009553 Ga0105249_10000192 Ga0105249_100001927 210
254 3300010375 Ga0105239_10164698 Ga0105239_101646983 210
255 3300013296 Ga0157374_10009691 Ga0157374_100096913 210
256 3300013307 Ga0157372_10691489 Ga0157372_106914891 210
257 3300013308 Ga0157375_10000322 Ga0157375_1000032238 210
258 3300014326 Ga0157380_10007477 Ga0157380_100074778 210
259 3300014968 Ga0157379_10017712 Ga0157379_100177127 210
260 3300014968 Ga0157379_10129624 Ga0157379_101296242 210
261 3300017792 Ga0163161_10000073 Ga0163161_1000007351 210
262 3300025893 Ga0207682_10000003 Ga0207682_1000000373 210
263 3300025899 Ga0207642_10000001 Ga0207642_10000001296 210
264 3300025899 Ga0207642_10000003 Ga0207642_10000003296 210
265 3300025899 Ga0207642_10000004 Ga0207642_10000004296 210
266 3300025899 Ga0207642_10000399 Ga0207642_100003996 210
267 3300025900 Ga0207710_10039837 Ga0207710_100398372 210
268 3300025905 Ga0207685_10000001 Ga0207685_10000001587 210
269 3300025912 Ga0207707_10275492 Ga0207707_102754922 210
270 3300025915 Ga0207693_10067789 Ga0207693_100677892 210
271 3300025917 Ga0207660_10233550 Ga0207660_102335502 210
272 3300025921 Ga0207652_10000351 Ga0207652_1000035141 210
273 3300025924 Ga0207694_10000008 Ga0207694_10000008348 210
274 3300025927 Ga0207687_10000012 Ga0207687_10000012114 210
275 3300025927 Ga0207687_10000613 Ga0207687_100006137 210
276 3300025932 Ga0207690_10058559 Ga0207690_100585592 210
277 3300025933 Ga0207706_10000006 Ga0207706_10000006102 210
278 3300025934 Ga0207686_10000418 Ga0207686_1000041811 210
279 3300025934 Ga0207686_10105787 Ga0207686_101057872 210
280 3300025934 Ga0207686_10138687 Ga0207686_101386872 210
281 3300025935 Ga0207709_10045498 Ga0207709_100454982 210
282 3300025937 Ga0207669_10000016 Ga0207669_1000001623 210
283 3300025937 Ga0207669_10000023 Ga0207669_1000002392 210
284 3300025944 Ga0207661_10035386 Ga0207661_100353862 210
285 3300025960 Ga0207651_10001007 Ga0207651_100010075 210
286 3300025961 Ga0207712_10000003 Ga0207712_10000003352 210
287 3300025961 Ga0207712_10053990 Ga0207712_100539903 210
288 3300025972 Ga0207668_10005870 Ga0207668_100058703 210
289 3300025981 Ga0207640_10086381 Ga0207640_100863813 210
290 3300025986 Ga0207658_10006209 Ga0207658_100062096 210
291 3300026023 Ga0207677_10008339 Ga0207677_100083394 210
292 3300026035 Ga0207703_10000053 Ga0207703_10000053133 210
293 3300026035 Ga0207703_10057036 Ga0207703_100570362 210
294 3300026067 Ga0207678_10288539 Ga0207678_102885392 210
295 3300026075 Ga0207708_10119436 Ga0207708_101194363 210
296 3300026075 Ga0207708_10365092 Ga0207708_103650921 210
297 3300026088 Ga0207641_10000071 Ga0207641_10000071149 210
298 3300026088 Ga0207641_10151451 Ga0207641_101514513 210
299 3300026089 Ga0207648_10001595 Ga0207648_1000159519 210
300 3300028381 Ga0268264_10153201 Ga0268264_101532012 210
301 3300036401 Ga0373937_0048524 Ga0373937_0048524_1292_1957 210
302 3300041512 Ga0451853_2464716 Ga0451853_2464716_328_993 210
303 3300046454 Ga0495592_0008905 Ga0495592_0008905_1282_1947 210
304 3300046455 Ga0495603_0000291 Ga0495603_0000291_4236_4901 210
305 3300046455 Ga0495603_0028933 Ga0495603_0028933_509_1174 210
306 3300046462 Ga0495651_0124966 Ga0495651_0124966_146_793 210
307 3300046463 Ga0495653_0139591 Ga0495653_0139591_310_975 210
308 3300046463 Ga0495653_0167980 Ga0495653_0167980_641_1306 210
309 3300046473 Ga0495582_0000007 Ga0495582_0000007_38624_39289 210
310 3300046476 Ga0495662_0009062 Ga0495662_0009062_3261_3926 210
311 3300046511 Ga0495608_0001675 Ga0495608_0001675_14659_15324 210
312 3300046511 Ga0495608_0088589 Ga0495608_0088589_1133_1798 210
313 3300046514 Ga0495618_0000003 Ga0495618_0000003_79770_80435 210
314 3300046515 Ga0495620_0000446 Ga0495620_0000446_19358_20023 210
315 3300046516 Ga0495628_0025908 Ga0495628_0025908_3729_4376 210
316 3300046516 Ga0495628_0068055 Ga0495628_0068055_669_1316 210
317 3300046516 Ga0495628_0069383 Ga0495628_0069383_42_707 210
318 3300046523 Ga0495644_0036832 Ga0495644_0036832_916_1581 210
319 3300046533 Ga0495640_0063483 Ga0495640_0063483_1678_2343 210
320 3300046535 Ga0495586_0000384 Ga0495586_0000384_918_1583 210
321 3300046536 Ga0495587_0097577 Ga0495587_0097577_920_1585 210
322 3300046537 Ga0495598_0102383 Ga0495598_0102383_201_866 210
323 3300046558 Ga0495633_0061641 Ga0495633_0061641_839_1504 210
324 3300046559 Ga0495667_0093086 Ga0495667_0093086_1028_1675 210
325 3300046615 Ga0495656_0001151 Ga0495656_0001151_2273_2938 210
326 3300046642 Ga0495634_0000125 Ga0495634_0000125_53912_54577 210
327 3300046642 Ga0495634_0181222 Ga0495634_0181222_83_748 210
328 3300046663 Ga0495635_0000009 Ga0495635_0000009_164869_165534 210
329 3300046663 Ga0495635_0005067 Ga0495635_0005067_1700_2365 210
330 3300046675 Ga0495657_0010871 Ga0495657_0010871_569_1216 210
331 3300046678 Ga0495599_0180047 Ga0495599_0180047_442_1107 210
332 3300046681 Ga0495647_0000014 Ga0495647_0000014_41263_41928 210
333 3300046681 Ga0495647_0018797 Ga0495647_0018797_258_923 210
334 3300046683 Ga0495658_0000007 Ga0495658_0000007_38618_39283 210
335 3300046684 Ga0495669_0000074 Ga0495669_0000074_11293_11958 210
336 3300046684 Ga0495669_0140237 Ga0495669_0140237_70_735 210
337 3300046689 Ga0495613_0000003 Ga0495613_0000003_21265_21930 210
338 3300046689 Ga0495613_0101200 Ga0495613_0101200_242_889 210
339 3300046690 Ga0495624_0000002 Ga0495624_0000002_45838_46503 210
340 3300046690 Ga0495624_0080088 Ga0495624_0080088_406_1071 210
341 3300046691 Ga0495670_0012536 Ga0495670_0012536_2628_3293 210
342 3300046809 Ga0495600_0056852 Ga0495600_0056852_617_1282 210
343 3300047321 Ga0495676_0001046 Ga0495676_0001046_19406_20071 210
344 3300047321 Ga0495676_0002096 Ga0495676_0002096_3311_4000 210
345 3300047322 Ga0495680_0015114 Ga0495680_0015114_5036_5683 210
346 3300047322 Ga0495680_0132401 Ga0495680_0132401_770_1435 210
347 3300047446 Ga0495679_004836 Ga0495679_004836_3597_4262 210
348 3300047446 Ga0495679_034042 Ga0495679_034042_235_900 210
349 3300047469 Ga0495673_0087938 Ga0495673_0087938_314_979 210
350 3300048088 Ga0495602_0274249 Ga0495602_0274249_472_1137 210
351 3300048903 Ga0496100_0000008 Ga0496100_0000008_213565_214254 210
352 3300048903 Ga0496100_0000016 Ga0496100_0000016_138434_139099 210
353 3300048904 Ga0496101_0000016 Ga0496101_0000016_222347_223036 210
354 3300048904 Ga0496101_0000038 Ga0496101_0000038_26960_27625 210
355 3300048905 Ga0496102_0570907 Ga0496102_0570907_112_801 210
356 3300048907 Ga0496104_0000003 Ga0496104_0000003_327206_327871 210
357 3300048908 Ga0496105_0000008 Ga0496105_0000008_144996_145661 210
358 3300048908 Ga0496105_0204200 Ga0496105_0204200_243_908 210
359 3300048909 Ga0496106_0000013 Ga0496106_0000013_54913_55578 210
360 3300048909 Ga0496106_0000027 Ga0496106_0000027_10474_11139 210
361 3300048909 Ga0496106_0000117 Ga0496106_0000117_17693_18382 210
362 3300048910 Ga0496107_0000003 Ga0496107_0000003_164940_165605 210
363 3300048910 Ga0496107_0000009 Ga0496107_0000009_213279_213968 210
364 3300048911 Ga0496108_0000002 Ga0496108_0000002_390749_391414 210
365 3300048911 Ga0496108_0000221 Ga0496108_0000221_1041_1688 210
366 3300048912 Ga0496109_0000001 Ga0496109_0000001_390711_391376 210
367 3300048912 Ga0496109_0000195 Ga0496109_0000195_7859_8506 210
368 3300048912 Ga0496109_0156158 Ga0496109_0156158_999_1655 210
369 3300048915 Ga0496112_0368092 Ga0496112_0368092_379_1044 210
370 3300048916 Ga0496113_0159901 Ga0496113_0159901_617_1273 210
371 3300048917 Ga0496114_0000010 Ga0496114_0000010_29967_30656 210
372 3300048918 Ga0496115_0006755 Ga0496115_0006755_3039_3728 210
373 3300049578 Ga0501042_0048403 Ga0501042_0048403_205_870 210
374 3300049591 Ga0501075_0004569 Ga0501075_0004569_3213_3878 210
375 3300050513 nmdc:mga0rr50_393985_c1 nmdc:mga0rr50_393985_c1_70_735 210
376 3300050515 nmdc:mga0a205_124_c2 nmdc:mga0a205_124_c2_13682_14338 210
377 3300053077 Ga0495601_0000080 Ga0495601_0000080_22247_22912 210
378 3300053084 Ga0495595_0000069 Ga0495595_0000069_30537_31202 210
379 3300053084 Ga0495595_0020242 Ga0495595_0020242_1798_2481 210
380 3300053085 Ga0495619_0000024 Ga0495619_0000024_153528_154175 210
381 3300053085 Ga0495619_0022766 Ga0495619_0022766_415_1080 210
382 3300053085 Ga0495619_0035122 Ga0495619_0035122_1786_2451 210
383 3300001979 JGI24740J21852_10000392 JGI24740J21852_100003929 211
384 3300005327 Ga0070658_10074207 Ga0070658_100742073 211
385 3300005335 Ga0070666_10013549 Ga0070666_100135492 211
386 3300005337 Ga0070682_100000100 Ga0070682_1000001006 211
387 3300005338 Ga0068868_100010651 Ga0068868_1000106511 211
388 3300005354 Ga0070675_100000073 Ga0070675_10000007363 211
389 3300005365 Ga0070688_100000848 Ga0070688_10000084813 211
390 3300005440 Ga0070705_100043031 Ga0070705_1000430312 211
391 3300005456 Ga0070678_100007766 Ga0070678_1000077665 211
392 3300005466 Ga0070685_10000932 Ga0070685_100009326 211
393 3300005466 Ga0070685_10469894 Ga0070685_104698941 211
394 3300005545 Ga0070695_100243115 Ga0070695_1002431151 211
395 3300005548 Ga0070665_100003550 Ga0070665_10000355016 211
396 3300005563 Ga0068855_100148117 Ga0068855_1001481174 211
397 3300005578 Ga0068854_100000563 Ga0068854_1000005632 211
398 3300005614 Ga0068856_100200215 Ga0068856_1002002152 211
399 3300005616 Ga0068852_100000103 Ga0068852_10000010358 211
400 3300005834 Ga0068851_10047118 Ga0068851_100471183 211
401 3300005983 Ga0081540_1000025 Ga0081540_100002518 211
402 3300005983 Ga0081540_1070384 Ga0081540_10703841 211
403 3300005985 Ga0081539_10106845 Ga0081539_101068452 211
404 3300006051 Ga0075364_10154035 Ga0075364_101540352 211
405 3300006846 Ga0075430_100565194 Ga0075430_1005651942 211
406 3300009098 Ga0105245_10000091 Ga0105245_1000009124 211
407 3300009101 Ga0105247_10000208 Ga0105247_1000020845 211
408 3300009101 Ga0105247_10376825 Ga0105247_103768252 211
409 3300009147 Ga0114129_10646069 Ga0114129_106460692 211
410 3300009176 Ga0105242_10124952 Ga0105242_101249523 211
411 3300009177 Ga0105248_10025218 Ga0105248_100252183 211
412 3300009553 Ga0105249_10265240 Ga0105249_102652402 211
413 3300013102 Ga0157371_10012496 Ga0157371_100124964 211
414 3300013104 Ga0157370_10006452 Ga0157370_1000645210 211
415 3300013104 Ga0157370_10194592 Ga0157370_101945922 211
416 3300013105 Ga0157369_10000128 Ga0157369_1000012853 211
417 3300013297 Ga0157378_10015777 Ga0157378_100157777 211
418 3300013297 Ga0157378_10045890 Ga0157378_100458902 211
419 3300013306 Ga0163162_10798205 Ga0163162_107982051 211
420 3300013307 Ga0157372_10000121 Ga0157372_1000012175 211
421 3300014969 Ga0157376_10036952 Ga0157376_100369523 211
422 3300025321 Ga0207656_10007456 Ga0207656_100074562 211
423 3300025900 Ga0207710_10000112 Ga0207710_1000011297 211
424 3300025903 Ga0207680_10045139 Ga0207680_100451392 211
425 3300025909 Ga0207705_10235383 Ga0207705_102353832 211
426 3300025916 Ga0207663_10034049 Ga0207663_100340493 211
427 3300025926 Ga0207659_10000082 Ga0207659_1000008263 211
428 3300025927 Ga0207687_10000042 Ga0207687_1000004291 211
429 3300025927 Ga0207687_10015756 Ga0207687_100157566 211
430 3300025928 Ga0207700_10000032 Ga0207700_1000003281 211
431 3300025928 Ga0207700_10246554 Ga0207700_102465542 211
432 3300025932 Ga0207690_10001263 Ga0207690_100012637 211
433 3300025933 Ga0207706_10546993 Ga0207706_105469931 211
434 3300025941 Ga0207711_10000085 Ga0207711_1000008563 211
435 3300025944 Ga0207661_10569965 Ga0207661_105699652 211
436 3300025949 Ga0207667_10084023 Ga0207667_100840234 211
437 3300025981 Ga0207640_10000026 Ga0207640_10000026116 211
438 3300026023 Ga0207677_10001351 Ga0207677_100013517 211
439 3300026041 Ga0207639_10117940 Ga0207639_101179402 211
440 3300026075 Ga0207708_10806053 Ga0207708_108060532 211
441 3300026078 Ga0207702_10014458 Ga0207702_100144586 211
442 3300026121 Ga0207683_10015745 Ga0207683_100157453 211
443 3300026142 Ga0207698_10000009 Ga0207698_10000009219 211
444 3300028379 Ga0268266_10001388 Ga0268266_100013882 211
445 3300032126 Ga0307415_100004509 Ga0307415_1000045092 211
446 3300044842 Ga0466957_0011588 Ga0466957_0011588_481_1158 211
447 3300045976 Ga0466967_0000007 Ga0466967_0000007_111670_112347 211
448 3300046476 Ga0495662_0007156 Ga0495662_0007156_755_1429 211
449 3300046499 Ga0495594_0000005 Ga0495594_0000005_161384_162073 211
450 3300046511 Ga0495608_0000063 Ga0495608_0000063_76775_77467 211
451 3300046516 Ga0495628_0073836 Ga0495628_0073836_70_744 211
452 3300046517 Ga0495630_0000007 Ga0495630_0000007_63294_63971 211
453 3300046536 Ga0495587_0084393 Ga0495587_0084393_190_879 211
454 3300046557 Ga0495622_0000026 Ga0495622_0000026_124216_124905 211
455 3300046660 Ga0495625_0000319 Ga0495625_0000319_25113_25802 211
456 3300046674 Ga0495588_0000241 Ga0495588_0000241_35917_36591 211
457 3300046675 Ga0495657_0000084 Ga0495657_0000084_6297_6989 211
458 3300046683 Ga0495658_0035444 Ga0495658_0035444_218_892 211
459 3300046689 Ga0495613_0077335 Ga0495613_0077335_1520_2209 211
460 3300046690 Ga0495624_0000256 Ga0495624_0000256_21624_22301 211
461 3300047322 Ga0495680_0026325 Ga0495680_0026325_386_1075 211
462 3300047444 Ga0495675_0002313 Ga0495675_0002313_4395_5087 211
463 3300048088 Ga0495602_0302337 Ga0495602_0302337_271_948 211
464 3300048905 Ga0496102_0225610 Ga0496102_0225610_188_880 211
465 3300048905 Ga0496102_0257176 Ga0496102_0257176_405_1091 211
466 3300048906 Ga0496103_0005433 Ga0496103_0005433_391_1083 211
467 3300048907 Ga0496104_0000007 Ga0496104_0000007_349634_350323 211
468 3300048907 Ga0496104_0046511 Ga0496104_0046511_2943_3638 211
469 3300048908 Ga0496105_0000002 Ga0496105_0000002_552573_553262 211
470 3300048909 Ga0496106_0552666 Ga0496106_0552666_138_860 211
471 3300048913 Ga0496110_0000004 Ga0496110_0000004_83483_84160 211
472 3300048913 Ga0496110_0023808 Ga0496110_0023808_702_1388 211
473 3300048914 Ga0496111_0000002 Ga0496111_0000002_108696_109373 211
474 3300048914 Ga0496111_0043781 Ga0496111_0043781_1964_2650 211
475 3300048915 Ga0496112_0072463 Ga0496112_0072463_2588_3265 211
476 3300048916 Ga0496113_0000012 Ga0496113_0000012_52776_53453 211
477 3300048922 Ga0496119_0013117 Ga0496119_0013117_1610_2299 211
478 3300048923 Ga0496120_0058866 Ga0496120_0058866_645_1334 211
479 3300048924 Ga0496121_0165630 Ga0496121_0165630_155_850 211
480 3300048924 Ga0496121_0346727 Ga0496121_0346727_239_937 211
481 3300050491 nmdc:mga00v17_69550_c1 nmdc:mga00v17_69550_c1_443_1135 211
482 3300050507 nmdc:mga05p37_284766_c1 nmdc:mga05p37_284766_c1_328_1047 211
483 3300053077 Ga0495601_0109523 Ga0495601_0109523_88_768 211
484 3300053078 Ga0495612_0007035 Ga0495612_0007035_3160_3837 211
485 3300053084 Ga0495595_0000001 Ga0495595_0000001_488238_488930 211
486 3300053085 Ga0495619_0000038 Ga0495619_0000038_107706_108383 211
487 3300053085 Ga0495619_0000065 Ga0495619_0000065_6297_6989 211
488 3300001977 JGI24746J21847_1001719 JGI24746J21847_10017192 215

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01066

CDP-OH_P_transf

CDP-alcohol phosphatidyltransferase

47

211

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
5d92-assembly2.cif.gz_C structure of a phosphatidylinositolphosphate (pip) synthase from renibacterium salmoninarum 0.8113 22 202
6h53-assembly1.cif.gz_A crystal structure of mycobacterium tuberculosis phosphatidylinositol phosphate synthase (pgsa1) in apo form 0.7943 16 196
6h5a-assembly1.cif.gz_B crystal structure of mycobacterium tuberculosis phosphatidylinositol phosphate synthase (pgsa1) in complex with manganese and citrate 0.7889 16 197
6wm5-assembly1.cif.gz_A structure of a phosphatidylinositol-phosphate synthase (pips) from mycobacterium kansasii 0.781 11 194
6wmv-assembly1.cif.gz_A structure of a phosphatidylinositol-phosphate synthase (pips) from mycobacterium kansasii with evidence of substrate binding 0.7715 10 197
ID Description Score Start End Superfamily
af_P9WPG7_9_203_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.819 16 197 1.20.120.1760
5d92A02 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.7714 11 202 1.20.120.1760
af_P9WPG7_9_203_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.765 16 197 1.20.120.1760
af_P76226_9_202_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.748 26 201 1.20.120.1760
4mndA02 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.7446 10 197 1.20.120.1760
ID Description Score Start End GO Terms
AF-A0A7W1ASY7-F1-model_v4 CDP-alcohol phosphatidyltransferase family protein 0.9386 35 202 GO:0008654
GO:0016020
GO:0016780
AF-A0A7V9BE61-F1-model_v4 CDP-alcohol phosphatidyltransferase family protein 0.9317 35 202 GO:0008654
GO:0016020
GO:0016780
AF-A0A7W1ASY7-F1-model_v4 CDP-alcohol phosphatidyltransferase family protein 0.9075 35 202 GO:0008654
GO:0016020
GO:0016780
AF-X0VL54-F1-model_v4 CDP-alcohol phosphatidyltransferase family protein 0.9035 32 203 GO:0008654
GO:0016020
GO:0016780
AF-A0A538D557-F1-model_v4 CDP-alcohol phosphatidyltransferase family protein 0.9 50 202 GO:0008654
GO:0016020
GO:0016780

Feature Viewer

pLDDT pTM Quality
80.28 0.75 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map