F453578

General Info

Members Datasets Scaffolds Average Seq Length
488 241 976 234

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10412879|Ga0081455_104128792
Length 262
Sequence VLPLRDNVPTRTFPFVTVAIIVVNAVVWFWELGGRGVDYHVVKDGYYPCSVQGPCEGVQIGTSVFMHHLPWWEGTFTSMFMHGSWEHIIGNMLFLWIFGNNVEDALGKVRFLLWYLAAGIAATALQTFVTLAFGTVRDASIPNIGASGAIAGVLGAYFLLLPRARVLTVIFFGLIFFREIAAIWFLGIWIALQLWQGGVGLTHPDQTGGVAVFAHIGGIAFGFALMLGSIAWWLAPVLGEPNDGDDRPRPDAAGTTADTAAA

Samples

Sample ID Description Type Environment
1 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
44 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
45 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
46 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
47 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
48 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
51 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
52 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
53 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
56 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
70 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
71 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
72 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
80 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
83 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
119 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
121 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
122 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
123 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
124 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
125 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
126 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
127 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
128 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
129 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
130 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
131 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
132 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
133 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
134 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
135 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
136 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
137 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
138 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
139 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
140 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
141 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
142 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
143 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
144 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
145 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
146 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
147 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
148 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
149 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
150 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
151 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
152 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
153 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
154 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
155 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
156 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
157 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
158 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
159 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
160 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
161 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
162 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
163 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
164 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
165 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
166 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
167 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
168 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
169 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
170 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
171 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
172 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
173 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
174 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
175 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
176 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
177 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
178 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
179 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
180 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
181 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
182 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
183 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
184 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
185 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
186 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
187 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
188 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
189 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
190 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
191 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
192 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
193 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
194 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
195 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
196 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
197 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
198 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
199 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
200 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
214 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
215 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
216 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
217 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
218 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
219 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
220 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
221 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
222 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
223 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
224 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
225 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
226 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
227 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
229 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
230 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
231 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
232 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
233 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
234 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
235 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
236 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
237 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
238 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
239 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
240 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
241 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.39
Metatranscriptomes 0.61
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.41
Nodule 0
Rhizoplane 13.11
Rhizosphere 85.66
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081455_10412879 3300005937 Bacteria 933
2 Ga0070658_10010084 3300005327 Bacteria 7584
3 Ga0070658_10046964 3300005327 Bacteria 3494
4 Ga0070658_10555287 3300005327 Bacteria 994
5 Ga0070658_10811954 3300005327 Bacteria 813
6 Ga0070683_100011669 3300005329 Bacteria 7608
7 Ga0070683_100012407 3300005329 Bacteria 7406
8 Ga0070683_100034873 3300005329 Bacteria 4599
9 Ga0070683_100037472 3300005329 Bacteria 4439
10 Ga0070683_100076301 3300005329 Bacteria 3133
11 Ga0070683_100151743 3300005329 Bacteria 2197
12 Ga0070670_100790066 3300005331 Bacteria 857
13 Ga0070680_100094415 3300005336 Bacteria 2479
14 Ga0070680_100199319 3300005336 Bacteria 1688
15 Ga0070682_100014723 3300005337 Bacteria 4524
16 Ga0070682_100577268 3300005337 Bacteria 884
17 Ga0068868_100079209 3300005338 Bacteria 2632
18 Ga0068868_100710900 3300005338 Bacteria 900
19 Ga0070660_100009290 3300005339 Bacteria 6910
20 Ga0070660_100018464 3300005339 Bacteria 5096
21 Ga0070660_100045840 3300005339 Bacteria 3349
22 Ga0070660_100059260 3300005339 Bacteria 2969
23 Ga0070691_10072699 3300005341 Bacteria 1671
24 Ga0070691_10185228 3300005341 Bacteria 1086
25 Ga0070661_100630532 3300005344 Bacteria 869
26 Ga0070669_100416662 3300005353 Bacteria 1102
27 Ga0070671_100260607 3300005355 Bacteria 1473
28 Ga0070671_100725838 3300005355 Bacteria 863
29 Ga0070688_100151006 3300005365 Bacteria 1588
30 Ga0070688_100464230 3300005365 Bacteria 949
31 Ga0070703_10128185 3300005406 Bacteria 929
32 Ga0070709_10004896 3300005434 Bacteria 7236
33 Ga0070714_100364821 3300005435 Bacteria 1359
34 Ga0070714_100778486 3300005435 Bacteria 926
35 Ga0070713_100028695 3300005436 Bacteria 4396
36 Ga0070713_100209069 3300005436 Bacteria 1766
37 Ga0070701_10261216 3300005438 Bacteria 1050
38 Ga0070711_100256053 3300005439 Bacteria 1375
39 Ga0070711_100311453 3300005439 Bacteria 1255
40 Ga0070705_100019939 3300005440 Bacteria 3537
41 Ga0070705_100198775 3300005440 Bacteria 1373
42 Ga0070700_100048008 3300005441 Bacteria 2644
43 Ga0070708_100578976 3300005445 Bacteria 1058
44 Ga0070678_100437824 3300005456 Bacteria 1143
45 Ga0070678_100561356 3300005456 Bacteria 1015
46 Ga0070662_100051028 3300005457 Bacteria 2986
47 Ga0070681_10016972 3300005458 Bacteria 7274
48 Ga0070681_10063245 3300005458 Bacteria 3673
49 Ga0070681_10121865 3300005458 Bacteria 2542
50 Ga0070681_10147205 3300005458 Bacteria 2284
51 Ga0070681_10485937 3300005458 Bacteria 1148
52 Ga0070706_100096539 3300005467 Bacteria 2744
53 Ga0070707_100225943 3300005468 Bacteria 1823
54 Ga0070698_100078846 3300005471 Bacteria 3291
55 Ga0070698_100192854 3300005471 Bacteria 1974
56 Ga0070698_100222987 3300005471 Bacteria 1819
57 Ga0070698_100320877 3300005471 Bacteria 1480
58 Ga0070699_100056138 3300005518 Bacteria 3410
59 Ga0070699_100056708 3300005518 Bacteria 3392
60 Ga0070679_100051268 3300005530 Bacteria 4110
61 Ga0070679_100064231 3300005530 Bacteria 3659
62 Ga0070679_100235076 3300005530 Bacteria 1792
63 Ga0070679_100236143 3300005530 Bacteria 1787
64 Ga0070679_100322600 3300005530 Bacteria 1493
65 Ga0070684_100061778 3300005535 Bacteria 3280
66 Ga0070684_100145021 3300005535 Bacteria 2149
67 Ga0068853_100264262 3300005539 Bacteria 1583
68 Ga0070672_100529061 3300005543 Bacteria 1022
69 Ga0070686_100145093 3300005544 Bacteria 1656
70 Ga0070695_100505342 3300005545 Bacteria 935
71 Ga0070696_100024202 3300005546 Bacteria 4126
72 Ga0070704_100082851 3300005549 Bacteria 2366
73 Ga0070704_100550648 3300005549 Bacteria 1008
74 Ga0068855_100093031 3300005563 Bacteria 3477
75 Ga0068855_100292668 3300005563 Bacteria 1805
76 Ga0068855_100301406 3300005563 Bacteria 1774
77 Ga0068856_100084884 3300005614 Bacteria 3146
78 Ga0068856_100278345 3300005614 Bacteria 1690
79 Ga0070702_100008304 3300005615 Bacteria 5020
80 Ga0068861_100242508 3300005719 Bacteria 1534
81 Ga0068861_100248450 3300005719 Bacteria 1517
82 Ga0068858_100420679 3300005842 Bacteria 1285
83 Ga0081540_1018576 3300005983 Bacteria 4259
84 Ga0081540_1019750 3300005983 Bacteria 4081
85 Ga0081539_10000840 3300005985 Bacteria 58916
86 Ga0081539_10002154 3300005985 Bacteria 29055
87 Ga0081539_10007031 3300005985 Bacteria 10430
88 Ga0070717_10008335 3300006028 Bacteria 7741
89 Ga0070717_10057662 3300006028 Bacteria 3211
90 Ga0070717_10117213 3300006028 Bacteria 2277
91 Ga0075365_10075189 3300006038 Bacteria 2279
92 Ga0075432_10015702 3300006058 Bacteria 2583
93 Ga0070712_100060008 3300006175 Bacteria 2681
94 Ga0075428_100136273 3300006844 Bacteria 2669
95 Ga0075431_100307089 3300006847 Bacteria 1602
96 Ga0075433_10009904 3300006852 Bacteria 7642
97 Ga0075433_10032576 3300006852 Bacteria 4464
98 Ga0075433_10070545 3300006852 Bacteria 3071
99 Ga0075433_10240115 3300006852 Bacteria 1608
100 Ga0075434_100008855 3300006871 Bacteria 9368
101 Ga0075434_100030141 3300006871 Bacteria 5341
102 Ga0075429_100672904 3300006880 Bacteria 907
103 Ga0068865_100037689 3300006881 Bacteria 3266
104 Ga0075436_100003758 3300006914 Bacteria 10404
105 Ga0075436_100063723 3300006914 Bacteria 2547
106 Ga0075436_100201115 3300006914 Bacteria 1411
107 Ga0075435_100004861 3300007076 Bacteria 9304
108 Ga0075435_100036713 3300007076 Bacteria 3897
109 Ga0075435_100546560 3300007076 Bacteria 1003
110 Ga0075435_100805554 3300007076 Bacteria 818
111 Ga0105240_10067436 3300009093 Bacteria 4435
112 Ga0105240_10349892 3300009093 Bacteria 1677
113 Ga0111539_10161096 3300009094 Bacteria 2624
114 Ga0105245_10012951 3300009098 Bacteria 7271
115 Ga0105247_10118006 3300009101 Bacteria 1716
116 Ga0114129_10003577 3300009147 Bacteria 21868
117 Ga0114129_10083758 3300009147 Bacteria 4428
118 Ga0114129_10540706 3300009147 Bacteria 1516
119 Ga0105243_10126801 3300009148 Bacteria 2160
120 Ga0105241_10955937 3300009174 Bacteria 799
121 Ga0105242_10303374 3300009176 Bacteria 1458
122 Ga0105242_10485536 3300009176 Bacteria 1172
123 Ga0105242_10663163 3300009176 Bacteria 1016
124 Ga0105248_10151321 3300009177 Bacteria 2618
125 Ga0105248_10167500 3300009177 Bacteria 2476
126 Ga0105248_10224992 3300009177 Bacteria 2112
127 Ga0105249_10141896 3300009553 Bacteria 2304
128 Ga0105239_10075605 3300010375 Bacteria 3704
129 Ga0105246_10228913 3300011119 Bacteria 1462
130 Ga0157345_1006732 3300012498 Bacteria 923
131 Ga0157338_1006367 3300012515 Bacteria 1089
132 Ga0157371_10091092 3300013102 Bacteria 2160
133 Ga0157370_10077719 3300013104 Bacteria 3126
134 Ga0157369_10057025 3300013105 Bacteria 4215
135 Ga0157374_10138264 3300013296 Bacteria 2363
136 Ga0163162_10575192 3300013306 Bacteria 1254
137 Ga0163162_11242657 3300013306 Bacteria 846
138 Ga0157375_10015265 3300013308 Bacteria 6873
139 Ga0157375_10093814 3300013308 Bacteria 3068
140 Ga0157375_10693581 3300013308 Bacteria 1172
141 Ga0163163_10519792 3300014325 Bacteria 1252
142 Ga0157380_10072689 3300014326 Bacteria 2786
143 Ga0157380_10484225 3300014326 Bacteria 1197
144 Ga0182008_10046660 3300014497 Bacteria 2154
145 Ga0157377_10193386 3300014745 Bacteria 1287
146 Ga0157376_10590548 3300014969 Bacteria 1104
147 Ga0163161_10008316 3300017792 Bacteria 7184
148 Ga0163161_10239431 3300017792 Bacteria 1411
149 Ga0206356_10435972 3300020070 Bacteria 3238
150 Ga0206354_10306743 3300020081 Bacteria 1525
151 Ga0206353_10603087 3300020082 Bacteria 2797
152 Ga0207692_10004349 3300025898 Bacteria 5607
153 Ga0207642_10157560 3300025899 Bacteria 1215
154 Ga0207699_10005764 3300025906 Bacteria 5959
155 Ga0207699_10096489 3300025906 Bacteria 1867
156 Ga0207705_10129384 3300025909 Bacteria 1878
157 Ga0207705_10336983 3300025909 Bacteria 1161
158 Ga0207684_10234000 3300025910 Bacteria 1585
159 Ga0207684_10268646 3300025910 Bacteria 1472
160 Ga0207707_10005030 3300025912 Bacteria 11611
161 Ga0207707_10073761 3300025912 Bacteria 2976
162 Ga0207707_10161414 3300025912 Bacteria 1959
163 Ga0207707_10270389 3300025912 Bacteria 1473
164 Ga0207707_10339134 3300025912 Bacteria 1296
165 Ga0207695_10059936 3300025913 Bacteria 3944
166 Ga0207693_10000856 3300025915 Bacteria 27152
167 Ga0207660_10012122 3300025917 Bacteria 5635
168 Ga0207660_10041190 3300025917 Bacteria 3236
169 Ga0207662_10091194 3300025918 Bacteria 1875
170 Ga0207662_10318932 3300025918 Bacteria 1037
171 Ga0207657_10001199 3300025919 Bacteria 27571
172 Ga0207657_10006734 3300025919 Bacteria 11862
173 Ga0207657_10085860 3300025919 Bacteria 2635
174 Ga0207657_10121743 3300025919 Bacteria 2146
175 Ga0207652_10009207 3300025921 Bacteria 7947
176 Ga0207652_10065405 3300025921 Bacteria 3149
177 Ga0207652_10189737 3300025921 Bacteria 1849
178 Ga0207652_10253681 3300025921 Bacteria 1586
179 Ga0207652_10340426 3300025921 Bacteria 1354
180 Ga0207646_10153643 3300025922 Bacteria 2075
181 Ga0207646_10239405 3300025922 Bacteria 1639
182 Ga0207687_10034396 3300025927 Bacteria 3440
183 Ga0207687_10224345 3300025927 Bacteria 1481
184 Ga0207700_10140105 3300025928 Bacteria 1986
185 Ga0207700_10407953 3300025928 Bacteria 1192
186 Ga0207644_10246863 3300025931 Bacteria 1423
187 Ga0207644_10527858 3300025931 Bacteria 976
188 Ga0207690_10044247 3300025932 Bacteria 2934
189 Ga0207706_10036233 3300025933 Bacteria 4383
190 Ga0207686_10191473 3300025934 Bacteria 1458
191 Ga0207686_10261431 3300025934 Bacteria 1269
192 Ga0207686_10437678 3300025934 Bacteria 1003
193 Ga0207665_10000058 3300025939 Bacteria 72882
194 Ga0207711_10108892 3300025941 Bacteria 2461
195 Ga0207711_10141863 3300025941 Bacteria 2162
196 Ga0207661_10015417 3300025944 Bacteria 5623
197 Ga0207661_10133044 3300025944 Bacteria 2133
198 Ga0207661_10166651 3300025944 Bacteria 1915
199 Ga0207661_10632296 3300025944 Bacteria 983
200 Ga0207667_10121964 3300025949 Bacteria 2686
201 Ga0207667_10145293 3300025949 Bacteria 2441
202 Ga0207712_10309887 3300025961 Bacteria 1299
203 Ga0207640_10232475 3300025981 Bacteria 1419
204 Ga0207639_10538708 3300026041 Bacteria 1071
205 Ga0207708_10074022 3300026075 Bacteria 2611
206 Ga0207702_10326434 3300026078 Bacteria 1463
207 Ga0207702_10408348 3300026078 Bacteria 1311
208 Ga0207702_10774528 3300026078 Bacteria 948
209 Ga0207648_10008285 3300026089 Bacteria 10093
210 Ga0207675_100022531 3300026118 Bacteria 5865
211 Ga0207683_10059958 3300026121 Bacteria 3344
212 Ga0207683_10227574 3300026121 Bacteria 1700
213 Ga0207683_10240643 3300026121 Bacteria 1651
214 Ga0207698_10426995 3300026142 Bacteria 1273
215 Ga0207428_10082853 3300027907 Bacteria 2503
216 Ga0268265_10386185 3300028380 Bacteria 1290
217 Ga0265318_10000220 3300028577 Bacteria 49763
218 Ga0265322_10023263 3300028654 Bacteria 1772
219 Ga0265338_10155536 3300028800 Bacteria 1771
220 Ga0265330_10002778 3300031235 Bacteria 9395
221 Ga0265332_10003330 3300031238 Bacteria 7794
222 Ga0265328_10029907 3300031239 Bacteria 2031
223 Ga0265320_10004689 3300031240 Bacteria 8920
224 Ga0265320_10159397 3300031240 Bacteria 1016
225 Ga0265325_10002188 3300031241 Bacteria 13300
226 Ga0265340_10091794 3300031247 Bacteria 1418
227 Ga0265339_10037888 3300031249 Bacteria 2692
228 Ga0265331_10074057 3300031250 Bacteria 1589
229 Ga0265327_10032367 3300031251 Bacteria 2927
230 Ga0265327_10157524 3300031251 Bacteria 1051
231 Ga0265316_10012728 3300031344 Bacteria 7520
232 Ga0265313_10007824 3300031595 Bacteria 7216
233 Ga0265314_10004402 3300031711 Bacteria 13086
234 Ga0307409_100174787 3300031995 Bacteria 1894
235 Ga0373945_0050317 3300035116 Bacteria 1531
236 Ga0373943_0002641 3300035170 Bacteria 8155
237 Ga0373931_0169433 3300035691 Bacteria 1286
238 Ga0373927_0166423 3300035695 Bacteria 1445
239 Ga0373947_0007550 3300035725 Bacteria 6291
240 Ga0395899_0035841 3300037312 Bacteria 3723
241 Ga0395899_0085365 3300037312 Bacteria 2293
242 Ga0395899_0097483 3300037312 Bacteria 2125
243 Ga0395899_0106272 3300037312 Bacteria 2021
244 Ga0395900_0031206 3300037418 Bacteria 5473
245 Ga0395900_0076742 3300037418 Bacteria 3433
246 Ga0395900_0178608 3300037418 Bacteria 2158
247 Ga0395900_0239925 3300037418 Bacteria 1819
248 Ga0395900_0253202 3300037418 Bacteria 1761
249 Ga0395900_0312619 3300037418 Bacteria 1554
250 Ga0395900_0317052 3300037418 Bacteria 1540
251 Ga0395900_0337302 3300037418 Bacteria 1484
252 Ga0395900_0401369 3300037418 Bacteria 1335
253 Ga0395900_0591166 3300037418 Bacteria 1051
254 Ga0395900_0807081 3300037418 Bacteria 866
255 Ga0395898_0001676 3300037466 Bacteria 29679
256 Ga0395898_0038777 3300037466 Bacteria 4719
257 Ga0395898_0058088 3300037466 Bacteria 3767
258 Ga0395898_0073500 3300037466 Bacteria 3303
259 Ga0395898_0098838 3300037466 Bacteria 2802
260 Ga0395898_0108142 3300037466 Bacteria 2666
261 Ga0395898_0131944 3300037466 Bacteria 2392
262 Ga0395898_0189810 3300037466 Bacteria 1963
263 Ga0395898_0234067 3300037466 Bacteria 1752
264 Ga0395898_0278773 3300037466 Bacteria 1595
265 Ga0395898_0386325 3300037466 Bacteria 1335
266 Ga0395898_0503245 3300037466 Bacteria 1152
267 Ga0395898_0656722 3300037466 Bacteria 991
268 Ga0395905_0004079 3300037471 Bacteria 15313
269 Ga0395905_0014353 3300037471 Bacteria 7569
270 Ga0395905_0021158 3300037471 Bacteria 6157
271 Ga0395905_0054210 3300037471 Bacteria 3752
272 Ga0395905_0059707 3300037471 Bacteria 3565
273 Ga0395905_0118504 3300037471 Bacteria 2488
274 Ga0395905_0189776 3300037471 Bacteria 1928
275 Ga0395905_0316884 3300037471 Bacteria 1449
276 Ga0395905_0421849 3300037471 Bacteria 1230
277 Ga0395905_0460165 3300037471 Bacteria 1170
278 Ga0395905_0636389 3300037471 Bacteria 968
279 Ga0395905_0857170 3300037471 Bacteria 811
280 Ga0395901_0015105 3300038443 Bacteria 7852
281 Ga0395901_0024547 3300038443 Bacteria 6190
282 Ga0395901_0034536 3300038443 Bacteria 5222
283 Ga0395901_0039749 3300038443 Bacteria 4869
284 Ga0395901_0067068 3300038443 Bacteria 3737
285 Ga0395901_0106459 3300038443 Bacteria 2943
286 Ga0395901_0122066 3300038443 Bacteria 2738
287 Ga0395901_0148358 3300038443 Bacteria 2465
288 Ga0395901_0171334 3300038443 Bacteria 2278
289 Ga0395901_0203176 3300038443 Bacteria 2076
290 Ga0395901_0211079 3300038443 Bacteria 2032
291 Ga0395901_0212046 3300038443 Bacteria 2027
292 Ga0395901_0233133 3300038443 Bacteria 1921
293 Ga0395901_0271754 3300038443 Bacteria 1763
294 Ga0395901_0284435 3300038443 Bacteria 1717
295 Ga0395901_0308481 3300038443 Bacteria 1639
296 Ga0395901_0686279 3300038443 Bacteria 1023
297 Ga0395901_0963921 3300038443 Bacteria 831
298 Ga0451789_0138349 3300041443 Bacteria 1820
299 Ga0451789_1087392 3300041443 Bacteria 867
300 Ga0451800_0284180 3300041459 Bacteria 914
301 Ga0451802_0443405 3300041460 Bacteria 1187
302 Ga0451802_0917049 3300041460 Bacteria 2556
303 Ga0451807_0158951 3300041486 Bacteria 862
304 Ga0451807_1321690 3300041486 Bacteria 746
305 Ga0451835_0544511 3300041492 Bacteria 1725
306 Ga0451849_1253064 3300041505 Bacteria 1761
307 Ga0451855_2056077 3300041511 Bacteria 3123
308 Ga0451853_2170804 3300041512 Bacteria 1754
309 Ga0439448_0003568 3300042005 Bacteria 4322
310 Ga0439448_0079541 3300042005 Bacteria 1099
311 Ga0439450_047898 3300042008 Bacteria 1008
312 Ga0439446_0038805 3300042156 Bacteria 1397
313 Ga0439458_0006675 3300042157 Bacteria 2572
314 Ga0439464_0154390 3300042439 Bacteria 719
315 Ga0466966_0163329 3300044684 Bacteria 1355
316 Ga0466961_0004299 3300044693 Bacteria 8917
317 Ga0466961_0109287 3300044693 Bacteria 1740
318 Ga0466963_0011519 3300044694 Bacteria 5386
319 Ga0466963_0024457 3300044694 Bacteria 3846
320 Ga0466963_0028625 3300044694 Bacteria 3579
321 Ga0466963_0328851 3300044694 Bacteria 1076
322 Ga0466964_0009742 3300044706 Bacteria 3619
323 Ga0466964_0026429 3300044706 Bacteria 2272
324 Ga0466964_0074093 3300044706 Bacteria 1446
325 Ga0466971_0031309 3300044719 Bacteria 2382
326 Ga0466971_0053000 3300044719 Bacteria 1827
327 Ga0466968_0084193 3300044735 Bacteria 1401
328 Ga0466957_0003460 3300044842 Bacteria 8665
329 Ga0466957_0267737 3300044842 Bacteria 1140
330 Ga0466960_0004342 3300044901 Bacteria 5533
331 Ga0466960_0184519 3300044901 Bacteria 1132
332 Ga0466959_0003299 3300045049 Bacteria 10529
333 Ga0466959_0087595 3300045049 Bacteria 2239
334 Ga0451576_0022856 3300045051 Bacteria 6775
335 Ga0451576_0408661 3300045051 Bacteria 1424
336 Ga0466958_0001304 3300045836 Bacteria 11739
337 Ga0466958_0001389 3300045836 Bacteria 11458
338 Ga0466958_0092210 3300045836 Bacteria 1875
339 Ga0466958_0208849 3300045836 Bacteria 1243
340 Ga0466958_0235664 3300045836 Bacteria 1169
341 Ga0466967_0000085 3300045976 Bacteria 34226
342 Ga0466967_0000723 3300045976 Bacteria 16868
343 Ga0466967_0021475 3300045976 Bacteria 5245
344 Ga0466967_0025730 3300045976 Bacteria 4857
345 Ga0466967_0038280 3300045976 Bacteria 4111
346 Ga0466967_0106566 3300045976 Bacteria 2569
347 Ga0466967_0108485 3300045976 Bacteria 2547
348 Ga0466967_0124840 3300045976 Bacteria 2383
349 Ga0466967_0126392 3300045976 Bacteria 2369
350 Ga0466967_0135755 3300045976 Bacteria 2287
351 Ga0466967_0631803 3300045976 Bacteria 1058
352 Ga0495653_0092550 3300046463 Bacteria 2207
353 Ga0495582_0236123 3300046473 Bacteria 1047
354 Ga0495584_0176495 3300046491 Bacteria 1086
355 Ga0495608_0460413 3300046511 Bacteria 773
356 Ga0495663_0007640 3300046525 Bacteria 2991
357 Ga0495663_0098786 3300046525 Bacteria 959
358 Ga0495667_0317760 3300046559 Bacteria 985
359 Ga0495656_0081000 3300046615 Bacteria 1465
360 Ga0495635_0074497 3300046663 Bacteria 2326
361 Ga0495659_0039876 3300046664 Bacteria 1671
362 Ga0495658_0091339 3300046683 Bacteria 1803
363 Ga0495613_0085425 3300046689 Bacteria 2290
364 Ga0495613_0113122 3300046689 Bacteria 1955
365 Ga0495676_0103899 3300047321 Bacteria 2097
366 Ga0495676_0153906 3300047321 Bacteria 1633
367 Ga0495593_0064694 3300047673 Bacteria 1909
368 Ga0496100_0154649 3300048903 Bacteria 1639
369 Ga0496100_0183227 3300048903 Bacteria 1515
370 Ga0496101_0007007 3300048904 Bacteria 7280
371 Ga0496101_0506827 3300048904 Bacteria 953
372 Ga0496102_0107060 3300048905 Bacteria 2603
373 Ga0496102_0380565 3300048905 Bacteria 1328
374 Ga0496102_0402321 3300048905 Bacteria 1287
375 Ga0496103_0046688 3300048906 Bacteria 2675
376 Ga0496104_0000967 3300048907 Bacteria 24709
377 Ga0496104_0001618 3300048907 Bacteria 19424
378 Ga0496104_0009189 3300048907 Bacteria 8788
379 Ga0496104_0020197 3300048907 Bacteria 6103
380 Ga0496105_0010997 3300048908 Bacteria 7132
381 Ga0496105_0012880 3300048908 Bacteria 6628
382 Ga0496105_0028968 3300048908 Bacteria 4530
383 Ga0496105_0259541 3300048908 Bacteria 1405
384 Ga0496106_0009008 3300048909 Bacteria 7376
385 Ga0496106_0009936 3300048909 Bacteria 7027
386 Ga0496106_0046368 3300048909 Bacteria 3267
387 Ga0496107_0004358 3300048910 Bacteria 9582
388 Ga0496107_0011054 3300048910 Bacteria 6280
389 Ga0496107_0194182 3300048910 Bacteria 1508
390 Ga0496108_0002223 3300048911 Bacteria 15540
391 Ga0496108_0016122 3300048911 Bacteria 6091
392 Ga0496108_0025760 3300048911 Bacteria 4849
393 Ga0496108_0431327 3300048911 Bacteria 1151
394 Ga0496109_0002279 3300048912 Bacteria 15952
395 Ga0496109_0022051 3300048912 Bacteria 5638
396 Ga0496109_0042001 3300048912 Bacteria 4141
397 Ga0496109_0363236 3300048912 Bacteria 1368
398 Ga0496109_0436673 3300048912 Bacteria 1237
399 Ga0496109_0599151 3300048912 Bacteria 1038
400 Ga0496110_0032430 3300048913 Bacteria 4511
401 Ga0496110_0034164 3300048913 Bacteria 4403
402 Ga0496110_0197829 3300048913 Bacteria 1826
403 Ga0496111_0000489 3300048914 Bacteria 20380
404 Ga0496111_0010234 3300048914 Bacteria 6283
405 Ga0496111_0027859 3300048914 Bacteria 4001
406 Ga0496111_0520633 3300048914 Bacteria 874
407 Ga0496112_0002067 3300048915 Bacteria 15918
408 Ga0496112_0003903 3300048915 Bacteria 12479
409 Ga0496112_0005644 3300048915 Bacteria 10864
410 Ga0496112_0040412 3300048915 Bacteria 4560
411 Ga0496112_0055569 3300048915 Bacteria 3893
412 Ga0496112_0059292 3300048915 Bacteria 3771
413 Ga0496112_0130608 3300048915 Bacteria 2483
414 Ga0496112_0147583 3300048915 Bacteria 2320
415 Ga0496112_0153087 3300048915 Bacteria 2273
416 Ga0496112_0702262 3300048915 Bacteria 939
417 Ga0496112_0736493 3300048915 Bacteria 913
418 Ga0496113_0000591 3300048916 Bacteria 18099
419 Ga0496113_0010927 3300048916 Bacteria 6027
420 Ga0496114_0048996 3300048917 Bacteria 3514
421 Ga0496114_0085165 3300048917 Bacteria 2677
422 Ga0496114_0851593 3300048917 Bacteria 792
423 Ga0496115_0026042 3300048918 Bacteria 4560
424 Ga0496115_0027224 3300048918 Bacteria 4470
425 Ga0501031_0002709 3300049568 Bacteria 11275
426 Ga0501032_0157933 3300049569 Bacteria 1489
427 Ga0501034_0028990 3300049571 Bacteria 5629
428 Ga0501036_0030142 3300049572 Bacteria 4583
429 Ga0501037_0064768 3300049573 Bacteria 2663
430 Ga0501038_0037924 3300049574 Bacteria 4222
431 Ga0501039_0042294 3300049575 Bacteria 3520
432 Ga0501040_0040527 3300049576 Bacteria 3169
433 Ga0501041_0004380 3300049577 Bacteria 8168
434 Ga0501042_0004366 3300049578 Bacteria 9024
435 Ga0501046_0030071 3300049580 Bacteria 4411
436 Ga0501047_0487696 3300049581 Bacteria 1060
437 Ga0501048_0083776 3300049582 Bacteria 2248
438 Ga0501067_0005982 3300049583 Bacteria 6745
439 Ga0501067_0018748 3300049583 Bacteria 3830
440 Ga0501068_0111566 3300049584 Bacteria 1700
441 Ga0501069_0003669 3300049585 Bacteria 7901
442 Ga0501069_0066481 3300049585 Bacteria 2016
443 Ga0501070_0004253 3300049586 Bacteria 12309
444 Ga0501070_0016941 3300049586 Bacteria 6115
445 Ga0501070_0110276 3300049586 Bacteria 2274
446 Ga0501070_0160400 3300049586 Bacteria 1854
447 Ga0501071_0019307 3300049587 Bacteria 4730
448 Ga0501072_0009541 3300049588 Bacteria 7381
449 Ga0501072_0034656 3300049588 Bacteria 3957
450 Ga0501073_0062999 3300049589 Bacteria 2586
451 Ga0501073_0138808 3300049589 Bacteria 1684
452 Ga0501073_0420758 3300049589 Bacteria 923
453 Ga0501074_0002927 3300049590 Bacteria 11991
454 Ga0501074_0008398 3300049590 Bacteria 7486
455 Ga0501076_0008131 3300049592 Bacteria 7672
456 Ga0501077_0011570 3300049593 Bacteria 5513
457 Ga0501079_0129269 3300049741 Bacteria 1965
458 Ga0501079_0625526 3300049741 Bacteria 847
459 Ga0501080_0006169 3300049742 Bacteria 10755
460 Ga0501080_0006220 3300049742 Bacteria 10716
461 Ga0501080_0018628 3300049742 Bacteria 6425
462 Ga0501081_0005510 3300049743 Bacteria 8173
463 Ga0501083_0000851 3300049744 Bacteria 20088
464 Ga0501035_0184457 3300049822 Bacteria 1796
465 Ga0501045_0002796 3300049824 Bacteria 11929
466 nmdc:mga0yw44_52642_c1 3300050492 Bacteria 2469
467 nmdc:mga05p37_132263_c1 3300050507 Bacteria 3061
468 nmdc:mga09592_57630_c1 3300050508 Bacteria 3283
469 nmdc:mga09592_811860_c1 3300050508 Bacteria 791
470 nmdc:mga06r32_139246_c1 3300050510 Bacteria 2402
471 nmdc:mga06r32_351336_c1 3300050510 Bacteria 1459
472 nmdc:mga0n895_23426_c1 3300050512 Bacteria 5804
473 nmdc:mga0n895_246123_c1 3300050512 Bacteria 1815
474 nmdc:mga0n895_314600_c1 3300050512 Bacteria 1587
475 nmdc:mga0rr50_134697_c1 3300050513 Bacteria 1982
476 nmdc:mga0rr50_26852_c1 3300050513 Bacteria 4025
477 nmdc:mga0rr50_37688_c1 3300050513 Bacteria 3493
478 nmdc:mga0rr50_455309_c1 3300050513 Bacteria 1085
479 nmdc:mga08x19_103012_c1 3300050514 Bacteria 1896
480 nmdc:mga08x19_185291_c1 3300050514 Bacteria 1422
481 nmdc:mga08x19_554054_c1 3300050514 Bacteria 814
482 nmdc:mga0a205_26845_c1 3300050515 Bacteria 5495
483 Ga0495619_0057013 3300053085 Bacteria 2591
484 Ga0501084_0015433 3300054114 Bacteria 6334
485 Ga0501082_0005518 3300060353 Bacteria 10981
486 Ga0466962_0006204 3300061719 Bacteria 5741
487 Ga0466962_0046177 3300061719 Bacteria 2081
488 Ga0530510_0019976 3300061734 Bacteria 4761
489 Ga0081455_10412879
490 Ga0070658_10010084
491 Ga0070658_10046964
492 Ga0070658_10555287
493 Ga0070658_10811954
494 Ga0070683_100011669
495 Ga0070683_100012407
496 Ga0070683_100034873
497 Ga0070683_100037472
498 Ga0070683_100076301
499 Ga0070683_100151743
500 Ga0070670_100790066
501 Ga0070680_100094415
502 Ga0070680_100199319
503 Ga0070682_100014723
504 Ga0070682_100577268
505 Ga0068868_100079209
506 Ga0068868_100710900
507 Ga0070660_100009290
508 Ga0070660_100018464
509 Ga0070660_100045840
510 Ga0070660_100059260
511 Ga0070691_10072699
512 Ga0070691_10185228
513 Ga0070661_100630532
514 Ga0070669_100416662
515 Ga0070671_100260607
516 Ga0070671_100725838
517 Ga0070688_100151006
518 Ga0070688_100464230
519 Ga0070703_10128185
520 Ga0070709_10004896
521 Ga0070714_100364821
522 Ga0070714_100778486
523 Ga0070713_100028695
524 Ga0070713_100209069
525 Ga0070701_10261216
526 Ga0070711_100256053
527 Ga0070711_100311453
528 Ga0070705_100019939
529 Ga0070705_100198775
530 Ga0070700_100048008
531 Ga0070708_100578976
532 Ga0070678_100437824
533 Ga0070678_100561356
534 Ga0070662_100051028
535 Ga0070681_10016972
536 Ga0070681_10063245
537 Ga0070681_10121865
538 Ga0070681_10147205
539 Ga0070681_10485937
540 Ga0070706_100096539
541 Ga0070707_100225943
542 Ga0070698_100078846
543 Ga0070698_100192854
544 Ga0070698_100222987
545 Ga0070698_100320877
546 Ga0070699_100056138
547 Ga0070699_100056708
548 Ga0070679_100051268
549 Ga0070679_100064231
550 Ga0070679_100235076
551 Ga0070679_100236143
552 Ga0070679_100322600
553 Ga0070684_100061778
554 Ga0070684_100145021
555 Ga0068853_100264262
556 Ga0070672_100529061
557 Ga0070686_100145093
558 Ga0070695_100505342
559 Ga0070696_100024202
560 Ga0070704_100082851
561 Ga0070704_100550648
562 Ga0068855_100093031
563 Ga0068855_100292668
564 Ga0068855_100301406
565 Ga0068856_100084884
566 Ga0068856_100278345
567 Ga0070702_100008304
568 Ga0068861_100242508
569 Ga0068861_100248450
570 Ga0068858_100420679
571 Ga0081540_1018576
572 Ga0081540_1019750
573 Ga0081539_10000840
574 Ga0081539_10002154
575 Ga0081539_10007031
576 Ga0070717_10008335
577 Ga0070717_10057662
578 Ga0070717_10117213
579 Ga0075365_10075189
580 Ga0075432_10015702
581 Ga0070712_100060008
582 Ga0075428_100136273
583 Ga0075431_100307089
584 Ga0075433_10009904
585 Ga0075433_10032576
586 Ga0075433_10070545
587 Ga0075433_10240115
588 Ga0075434_100008855
589 Ga0075434_100030141
590 Ga0075429_100672904
591 Ga0068865_100037689
592 Ga0075436_100003758
593 Ga0075436_100063723
594 Ga0075436_100201115
595 Ga0075435_100004861
596 Ga0075435_100036713
597 Ga0075435_100546560
598 Ga0075435_100805554
599 Ga0105240_10067436
600 Ga0105240_10349892
601 Ga0111539_10161096
602 Ga0105245_10012951
603 Ga0105247_10118006
604 Ga0114129_10003577
605 Ga0114129_10083758
606 Ga0114129_10540706
607 Ga0105243_10126801
608 Ga0105241_10955937
609 Ga0105242_10303374
610 Ga0105242_10485536
611 Ga0105242_10663163
612 Ga0105248_10151321
613 Ga0105248_10167500
614 Ga0105248_10224992
615 Ga0105249_10141896
616 Ga0105239_10075605
617 Ga0105246_10228913
618 Ga0157345_1006732
619 Ga0157338_1006367
620 Ga0157371_10091092
621 Ga0157370_10077719
622 Ga0157369_10057025
623 Ga0157374_10138264
624 Ga0163162_10575192
625 Ga0163162_11242657
626 Ga0157375_10015265
627 Ga0157375_10093814
628 Ga0157375_10693581
629 Ga0163163_10519792
630 Ga0157380_10072689
631 Ga0157380_10484225
632 Ga0182008_10046660
633 Ga0157377_10193386
634 Ga0157376_10590548
635 Ga0163161_10008316
636 Ga0163161_10239431
637 Ga0206356_10435972
638 Ga0206354_10306743
639 Ga0206353_10603087
640 Ga0207692_10004349
641 Ga0207642_10157560
642 Ga0207699_10005764
643 Ga0207699_10096489
644 Ga0207705_10129384
645 Ga0207705_10336983
646 Ga0207684_10234000
647 Ga0207684_10268646
648 Ga0207707_10005030
649 Ga0207707_10073761
650 Ga0207707_10161414
651 Ga0207707_10270389
652 Ga0207707_10339134
653 Ga0207695_10059936
654 Ga0207693_10000856
655 Ga0207660_10012122
656 Ga0207660_10041190
657 Ga0207662_10091194
658 Ga0207662_10318932
659 Ga0207657_10001199
660 Ga0207657_10006734
661 Ga0207657_10085860
662 Ga0207657_10121743
663 Ga0207652_10009207
664 Ga0207652_10065405
665 Ga0207652_10189737
666 Ga0207652_10253681
667 Ga0207652_10340426
668 Ga0207646_10153643
669 Ga0207646_10239405
670 Ga0207687_10034396
671 Ga0207687_10224345
672 Ga0207700_10140105
673 Ga0207700_10407953
674 Ga0207644_10246863
675 Ga0207644_10527858
676 Ga0207690_10044247
677 Ga0207706_10036233
678 Ga0207686_10191473
679 Ga0207686_10261431
680 Ga0207686_10437678
681 Ga0207665_10000058
682 Ga0207711_10108892
683 Ga0207711_10141863
684 Ga0207661_10015417
685 Ga0207661_10133044
686 Ga0207661_10166651
687 Ga0207661_10632296
688 Ga0207667_10121964
689 Ga0207667_10145293
690 Ga0207712_10309887
691 Ga0207640_10232475
692 Ga0207639_10538708
693 Ga0207708_10074022
694 Ga0207702_10326434
695 Ga0207702_10408348
696 Ga0207702_10774528
697 Ga0207648_10008285
698 Ga0207675_100022531
699 Ga0207683_10059958
700 Ga0207683_10227574
701 Ga0207683_10240643
702 Ga0207698_10426995
703 Ga0207428_10082853
704 Ga0268265_10386185
705 Ga0265318_10000220
706 Ga0265322_10023263
707 Ga0265338_10155536
708 Ga0265330_10002778
709 Ga0265332_10003330
710 Ga0265328_10029907
711 Ga0265320_10004689
712 Ga0265320_10159397
713 Ga0265325_10002188
714 Ga0265340_10091794
715 Ga0265339_10037888
716 Ga0265331_10074057
717 Ga0265327_10032367
718 Ga0265327_10157524
719 Ga0265316_10012728
720 Ga0265313_10007824
721 Ga0265314_10004402
722 Ga0307409_100174787
723 Ga0373945_0050317
724 Ga0373943_0002641
725 Ga0373931_0169433
726 Ga0373927_0166423
727 Ga0373947_0007550
728 Ga0395899_0035841
729 Ga0395899_0085365
730 Ga0395899_0097483
731 Ga0395899_0106272
732 Ga0395900_0031206
733 Ga0395900_0076742
734 Ga0395900_0178608
735 Ga0395900_0239925
736 Ga0395900_0253202
737 Ga0395900_0312619
738 Ga0395900_0317052
739 Ga0395900_0337302
740 Ga0395900_0401369
741 Ga0395900_0591166
742 Ga0395900_0807081
743 Ga0395898_0001676
744 Ga0395898_0038777
745 Ga0395898_0058088
746 Ga0395898_0073500
747 Ga0395898_0098838
748 Ga0395898_0108142
749 Ga0395898_0131944
750 Ga0395898_0189810
751 Ga0395898_0234067
752 Ga0395898_0278773
753 Ga0395898_0386325
754 Ga0395898_0503245
755 Ga0395898_0656722
756 Ga0395905_0004079
757 Ga0395905_0014353
758 Ga0395905_0021158
759 Ga0395905_0054210
760 Ga0395905_0059707
761 Ga0395905_0118504
762 Ga0395905_0189776
763 Ga0395905_0316884
764 Ga0395905_0421849
765 Ga0395905_0460165
766 Ga0395905_0636389
767 Ga0395905_0857170
768 Ga0395901_0015105
769 Ga0395901_0024547
770 Ga0395901_0034536
771 Ga0395901_0039749
772 Ga0395901_0067068
773 Ga0395901_0106459
774 Ga0395901_0122066
775 Ga0395901_0148358
776 Ga0395901_0171334
777 Ga0395901_0203176
778 Ga0395901_0211079
779 Ga0395901_0212046
780 Ga0395901_0233133
781 Ga0395901_0271754
782 Ga0395901_0284435
783 Ga0395901_0308481
784 Ga0395901_0686279
785 Ga0395901_0963921
786 Ga0451789_0138349
787 Ga0451789_1087392
788 Ga0451800_0284180
789 Ga0451802_0443405
790 Ga0451802_0917049
791 Ga0451807_0158951
792 Ga0451807_1321690
793 Ga0451835_0544511
794 Ga0451849_1253064
795 Ga0451855_2056077
796 Ga0451853_2170804
797 Ga0439448_0003568
798 Ga0439448_0079541
799 Ga0439450_047898
800 Ga0439446_0038805
801 Ga0439458_0006675
802 Ga0439464_0154390
803 Ga0466966_0163329
804 Ga0466961_0004299
805 Ga0466961_0109287
806 Ga0466963_0011519
807 Ga0466963_0024457
808 Ga0466963_0028625
809 Ga0466963_0328851
810 Ga0466964_0009742
811 Ga0466964_0026429
812 Ga0466964_0074093
813 Ga0466971_0031309
814 Ga0466971_0053000
815 Ga0466968_0084193
816 Ga0466957_0003460
817 Ga0466957_0267737
818 Ga0466960_0004342
819 Ga0466960_0184519
820 Ga0466959_0003299
821 Ga0466959_0087595
822 Ga0451576_0022856
823 Ga0451576_0408661
824 Ga0466958_0001304
825 Ga0466958_0001389
826 Ga0466958_0092210
827 Ga0466958_0208849
828 Ga0466958_0235664
829 Ga0466967_0000085
830 Ga0466967_0000723
831 Ga0466967_0021475
832 Ga0466967_0025730
833 Ga0466967_0038280
834 Ga0466967_0106566
835 Ga0466967_0108485
836 Ga0466967_0124840
837 Ga0466967_0126392
838 Ga0466967_0135755
839 Ga0466967_0631803
840 Ga0495653_0092550
841 Ga0495582_0236123
842 Ga0495584_0176495
843 Ga0495608_0460413
844 Ga0495663_0007640
845 Ga0495663_0098786
846 Ga0495667_0317760
847 Ga0495656_0081000
848 Ga0495635_0074497
849 Ga0495659_0039876
850 Ga0495658_0091339
851 Ga0495613_0085425
852 Ga0495613_0113122
853 Ga0495676_0103899
854 Ga0495676_0153906
855 Ga0495593_0064694
856 Ga0496100_0154649
857 Ga0496100_0183227
858 Ga0496101_0007007
859 Ga0496101_0506827
860 Ga0496102_0107060
861 Ga0496102_0380565
862 Ga0496102_0402321
863 Ga0496103_0046688
864 Ga0496104_0000967
865 Ga0496104_0001618
866 Ga0496104_0009189
867 Ga0496104_0020197
868 Ga0496105_0010997
869 Ga0496105_0012880
870 Ga0496105_0028968
871 Ga0496105_0259541
872 Ga0496106_0009008
873 Ga0496106_0009936
874 Ga0496106_0046368
875 Ga0496107_0004358
876 Ga0496107_0011054
877 Ga0496107_0194182
878 Ga0496108_0002223
879 Ga0496108_0016122
880 Ga0496108_0025760
881 Ga0496108_0431327
882 Ga0496109_0002279
883 Ga0496109_0022051
884 Ga0496109_0042001
885 Ga0496109_0363236
886 Ga0496109_0436673
887 Ga0496109_0599151
888 Ga0496110_0032430
889 Ga0496110_0034164
890 Ga0496110_0197829
891 Ga0496111_0000489
892 Ga0496111_0010234
893 Ga0496111_0027859
894 Ga0496111_0520633
895 Ga0496112_0002067
896 Ga0496112_0003903
897 Ga0496112_0005644
898 Ga0496112_0040412
899 Ga0496112_0055569
900 Ga0496112_0059292
901 Ga0496112_0130608
902 Ga0496112_0147583
903 Ga0496112_0153087
904 Ga0496112_0702262
905 Ga0496112_0736493
906 Ga0496113_0000591
907 Ga0496113_0010927
908 Ga0496114_0048996
909 Ga0496114_0085165
910 Ga0496114_0851593
911 Ga0496115_0026042
912 Ga0496115_0027224
913 Ga0501031_0002709
914 Ga0501032_0157933
915 Ga0501034_0028990
916 Ga0501036_0030142
917 Ga0501037_0064768
918 Ga0501038_0037924
919 Ga0501039_0042294
920 Ga0501040_0040527
921 Ga0501041_0004380
922 Ga0501042_0004366
923 Ga0501046_0030071
924 Ga0501047_0487696
925 Ga0501048_0083776
926 Ga0501067_0005982
927 Ga0501067_0018748
928 Ga0501068_0111566
929 Ga0501069_0003669
930 Ga0501069_0066481
931 Ga0501070_0004253
932 Ga0501070_0016941
933 Ga0501070_0110276
934 Ga0501070_0160400
935 Ga0501071_0019307
936 Ga0501072_0009541
937 Ga0501072_0034656
938 Ga0501073_0062999
939 Ga0501073_0138808
940 Ga0501073_0420758
941 Ga0501074_0002927
942 Ga0501074_0008398
943 Ga0501076_0008131
944 Ga0501077_0011570
945 Ga0501079_0129269
946 Ga0501079_0625526
947 Ga0501080_0006169
948 Ga0501080_0006220
949 Ga0501080_0018628
950 Ga0501081_0005510
951 Ga0501083_0000851
952 Ga0501035_0184457
953 Ga0501045_0002796
954 nmdc:mga0yw44_52642_c1
955 nmdc:mga05p37_132263_c1
956 nmdc:mga09592_57630_c1
957 nmdc:mga09592_811860_c1
958 nmdc:mga06r32_139246_c1
959 nmdc:mga06r32_351336_c1
960 nmdc:mga0n895_23426_c1
961 nmdc:mga0n895_246123_c1
962 nmdc:mga0n895_314600_c1
963 nmdc:mga0rr50_134697_c1
964 nmdc:mga0rr50_26852_c1
965 nmdc:mga0rr50_37688_c1
966 nmdc:mga0rr50_455309_c1
967 nmdc:mga08x19_103012_c1
968 nmdc:mga08x19_185291_c1
969 nmdc:mga08x19_554054_c1
970 nmdc:mga0a205_26845_c1
971 Ga0495619_0057013
972 Ga0501084_0015433
973 Ga0501082_0005518
974 Ga0466962_0006204
975 Ga0466962_0046177
976 Ga0530510_0019976

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01694

Rhomboid

Rhomboid family

69

231

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3odj-assembly1.cif.gz_A crystal structure of h. influenzae rhomboid glpg with disordered loop 4, helix 5 and loop 5 0.7838 16 221
2nr9-assembly1.cif.gz_A crystal structure of glpg, rhomboid peptidase from haemophilus influenzae 0.7618 16 221
3zmj-assembly1.cif.gz_A structure of e.coli rhomboid protease glpg in complex with monobactam l61 0.749 13 221
6pja-assembly1.cif.gz_A time-resolved structural snapshot of proteolysis by glpg inside the membrane 0.7489 13 221
6pjp-assembly1.cif.gz_A time-resolved structural snapshot of proteolysis by glpg inside the membrane 0.7453 12 221
ID Description Score Start End Superfamily
af_F1R9M8_118_305_1.20.1540.10 Mainly Alpha;Up-down Bundle;Rhomboid-like fold;Rhomboid-like 0.8297 13 220 1.20.1540.10
af_Q54D88_171_373_1.20.1540.10 Mainly Alpha;Up-down Bundle;Rhomboid-like fold;Rhomboid-like 0.8163 15 222 1.20.1540.10
af_A0A6V7QZA6_121_312_1.20.1540.10 Mainly Alpha;Up-down Bundle;Rhomboid-like fold;Rhomboid-like 0.8083 17 220 1.20.1540.10
af_F1R9M8_118_305_1.20.1540.10 Mainly Alpha;Up-down Bundle;Rhomboid-like fold;Rhomboid-like 0.8059 13 220 1.20.1540.10
af_O53632_31_206_1.20.1540.10 Mainly Alpha;Up-down Bundle;Rhomboid-like fold;Rhomboid-like 0.7938 9 222 1.20.1540.10
ID Description Score Start End GO Terms
AF-A0A537ZPH6-F1-model_v4 Rhomboid family intramembrane serine protease 0.9701 1 155 GO:0004252
GO:0006508
GO:0016020
AF-A0A7Y5WXM5-F1-model_v4 Rhomboid family intramembrane serine protease 0.9367 1 223 GO:0004252
GO:0006508
GO:0016020
AF-A0A7V9FM67-F1-model_v4 Rhomboid family intramembrane serine protease 0.9344 1 232 GO:0004252
GO:0006508
GO:0016020
AF-A0A7V9FM67-F1-model_v4 Rhomboid family intramembrane serine protease 0.9305 1 232 GO:0004252
GO:0006508
GO:0016020
AF-F2LVX4-F1-model_v4 Peptidase S54, rhomboid domain protein 0.9299 1 222 GO:0004252
GO:0016020

Map