F453576

General Info

Members Datasets Scaffolds Average Seq Length
488 249 976 245

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10019525|Ga0081455_100195258
Length 285
Sequence VRDLELDLDAFEGPFDLLLTLVLREELAPGDVDMAAIVVAFVERHLGDGSSRSAGQGREELDLEACGEFLVLIAALLELKARSLFPEEAAELDELGELARRLAEYRRMREAAXWAGERARFFRLGPAPLAPRSERRLAPQQPEQLAAALRALAVPPPAVSISHMALRFPPVGQFLERFRALLRRRRRFDFDAEMGGLSRVEQAVAFLALLELRKAGELELAQAAPFAPIRVSARPWPATAPAGRGPYSHTVPSAYVPPATTQERADRQDNPMLRERSTEWTVRSA

Samples

Sample ID Description Type Environment
1 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
52 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
55 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
56 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
82 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
83 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
125 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
129 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
130 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
131 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
132 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
133 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
134 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
135 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
136 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
137 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
138 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
139 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
140 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
141 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
142 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
143 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
144 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
145 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
146 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
147 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
148 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
149 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
150 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
151 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
152 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
153 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
154 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
155 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
156 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
157 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
158 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
159 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
160 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
161 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
162 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
163 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
164 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
165 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
166 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
167 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
168 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
169 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
170 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
171 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
172 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
173 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
174 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
175 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
176 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
177 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
178 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
179 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
180 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
181 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
182 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
183 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
184 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
185 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
186 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
187 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
188 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
189 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
190 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
191 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
192 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
193 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
194 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
195 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
196 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
197 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
198 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
199 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
200 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
201 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
202 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
203 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
204 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
205 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
220 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
221 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
222 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
223 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
224 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
225 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
226 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
227 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
228 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
229 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
230 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
231 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
232 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
233 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
234 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
236 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
237 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
238 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
239 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
240 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
241 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
242 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
243 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
244 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
245 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
246 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
247 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
248 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
249 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.8
Metatranscriptomes 0.2
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.41
Nodule 0
Rhizoplane 12.91
Rhizosphere 86.68
Stem 0
Stem Tuber 0
Unclassified 9.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081455_10019525 3300005937 Bacteria 6411
2 Ga0070658_10005872 3300005327 Bacteria 9954
3 Ga0070658_10026784 3300005327 Bacteria 4628
4 Ga0070683_100015350 3300005329 Bacteria 6724
5 Ga0070683_100016818 3300005329 Bacteria 6453
6 Ga0070683_100094891 3300005329 Bacteria 2804
7 Ga0070683_100616224 3300005329 Bacteria 1039
8 Ga0070670_100028691 3300005331 Bacteria 4789
9 Ga0070670_100031578 3300005331 Bacteria 4562
10 Ga0070680_100028128 3300005336 Bacteria 4508
11 Ga0070682_100022489 3300005337 Bacteria 3735
12 Ga0070682_100034693 3300005337 Bacteria 3075
13 Ga0070682_100273654 3300005337 Bacteria 1228
14 Ga0068868_100055994 3300005338 Bacteria 3113
15 Ga0068868_100062998 3300005338 Bacteria 2941
16 Ga0068868_100678489 3300005338 Bacteria 920
17 Ga0070660_100001675 3300005339 Bacteria 15212
18 Ga0070660_100079706 3300005339 Bacteria 2569
19 Ga0070660_100241932 3300005339 Bacteria 1470
20 Ga0070660_100266856 3300005339 Unclassified 1399
21 Ga0070689_100170629 3300005340 Unclassified 1762
22 Ga0070661_100063590 3300005344 Bacteria 2711
23 Ga0070661_100212863 3300005344 Bacteria 1480
24 Ga0070668_100382161 3300005347 Unclassified 1198
25 Ga0070669_100383824 3300005353 Bacteria 1146
26 Ga0070675_100266304 3300005354 Bacteria 1503
27 Ga0070671_100041154 3300005355 Bacteria 3840
28 Ga0070671_100056793 3300005355 Bacteria 3257
29 Ga0070674_100008814 3300005356 Bacteria 6021
30 Ga0070674_100244461 3300005356 Bacteria 1407
31 Ga0070673_100061633 3300005364 Unclassified 2976
32 Ga0070673_100285875 3300005364 Unclassified 1448
33 Ga0070688_100002013 3300005365 Bacteria 10254
34 Ga0070667_100295047 3300005367 Unclassified 1459
35 Ga0070713_100147329 3300005436 Bacteria 2091
36 Ga0070710_10205063 3300005437 Unclassified 1247
37 Ga0070701_10204267 3300005438 Unclassified 1169
38 Ga0070711_100034831 3300005439 Bacteria 3361
39 Ga0070711_100113734 3300005439 Bacteria 1991
40 Ga0070711_100330509 3300005439 Bacteria 1220
41 Ga0070700_100070445 3300005441 Bacteria 2230
42 Ga0070694_100173862 3300005444 Unclassified 1588
43 Ga0070678_100010950 3300005456 Bacteria 5567
44 Ga0070678_100112417 3300005456 Bacteria 2133
45 Ga0070681_10003063 3300005458 Bacteria 15501
46 Ga0070681_10010270 3300005458 Bacteria 9239
47 Ga0070681_10023052 3300005458 Bacteria 6260
48 Ga0070681_10585842 3300005458 Unclassified 1029
49 Ga0068867_100264066 3300005459 Bacteria 1405
50 Ga0070685_10044499 3300005466 Bacteria 2542
51 Ga0070706_100168490 3300005467 Unclassified 2045
52 Ga0070679_100002341 3300005530 Bacteria 17150
53 Ga0070679_100028112 3300005530 Bacteria 5542
54 Ga0070679_100090439 3300005530 Bacteria 3049
55 Ga0070684_100035608 3300005535 Bacteria 4261
56 Ga0070684_100385615 3300005535 Bacteria 1291
57 Ga0068853_100380080 3300005539 Unclassified 1319
58 Ga0070672_100056123 3300005543 Bacteria 3087
59 Ga0070686_100013259 3300005544 Bacteria 4714
60 Ga0070686_100320113 3300005544 Bacteria 1156
61 Ga0070696_100114259 3300005546 Bacteria 1947
62 Ga0070696_100138605 3300005546 Bacteria 1775
63 Ga0070693_100040470 3300005547 Bacteria 2617
64 Ga0070693_100057784 3300005547 Bacteria 2243
65 Ga0070693_100427271 3300005547 Bacteria 924
66 Ga0070665_100100955 3300005548 Bacteria 2889
67 Ga0068855_100023498 3300005563 Bacteria 7382
68 Ga0070664_100260696 3300005564 Bacteria 1560
69 Ga0068857_100022129 3300005577 Bacteria 5592
70 Ga0068854_100350503 3300005578 Unclassified 1208
71 Ga0068856_100011070 3300005614 Bacteria 8758
72 Ga0068856_100150932 3300005614 Bacteria 2333
73 Ga0068856_100248994 3300005614 Bacteria 1792
74 Ga0070702_100009005 3300005615 Bacteria 4864
75 Ga0068859_100217485 3300005617 Unclassified 1998
76 Ga0068864_100052313 3300005618 Bacteria 3519
77 Ga0068866_10009991 3300005718 Bacteria 4053
78 Ga0068861_100280510 3300005719 Unclassified 1435
79 Ga0068870_10004635 3300005840 Bacteria 5929
80 Ga0068858_100380906 3300005842 Unclassified 1354
81 Ga0068862_100231383 3300005844 Bacteria 1677
82 Ga0081455_10027501 3300005937 Bacteria 5212
83 Ga0081455_10136560 3300005937 Bacteria 1910
84 Ga0075365_10131679 3300006038 Bacteria 1731
85 Ga0070712_100029827 3300006175 Bacteria 3660
86 Ga0070712_100106276 3300006175 Bacteria 2086
87 Ga0068871_100111911 3300006358 Bacteria 2297
88 Ga0075431_100705146 3300006847 Bacteria 987
89 Ga0075433_10078505 3300006852 Bacteria 2909
90 Ga0075433_10583357 3300006852 Bacteria 982
91 Ga0075434_100296319 3300006871 Bacteria 1637
92 Ga0075434_100494464 3300006871 Bacteria 1244
93 Ga0068865_100012338 3300006881 Bacteria 5375
94 Ga0068865_100051470 3300006881 Bacteria 2851
95 Ga0068865_100099763 3300006881 Bacteria 2123
96 Ga0068865_100312161 3300006881 Bacteria 1262
97 Ga0075436_100126291 3300006914 Bacteria 1792
98 Ga0097620_100217489 3300006931 Unclassified 1998
99 Ga0075435_100067610 3300007076 Bacteria 2910
100 Ga0075435_100291199 3300007076 Bacteria 1395
101 Ga0105240_10108289 3300009093 Bacteria 3367
102 Ga0105240_10122551 3300009093 Bacteria 3129
103 Ga0105240_10637676 3300009093 Bacteria 1169
104 Ga0105240_10789582 3300009093 Bacteria 1029
105 Ga0111539_10082761 3300009094 Unclassified 3775
106 Ga0111539_10154840 3300009094 Unclassified 2682
107 Ga0105245_10006343 3300009098 Bacteria 10406
108 Ga0105245_10359402 3300009098 Bacteria 1445
109 Ga0105245_10545763 3300009098 Bacteria 1181
110 Ga0114129_10071837 3300009147 Bacteria 4825
111 Ga0114129_10247503 3300009147 Bacteria 2394
112 Ga0114129_10338229 3300009147 Bacteria 1997
113 Ga0114129_10463774 3300009147 Bacteria 1660
114 Ga0114129_11044052 3300009147 Bacteria 1026
115 Ga0105243_10071162 3300009148 Bacteria 2811
116 Ga0105243_10090678 3300009148 Bacteria 2516
117 Ga0105243_10213393 3300009148 Unclassified 1701
118 Ga0105241_10469692 3300009174 Bacteria 1116
119 Ga0105242_10066714 3300009176 Bacteria 2973
120 Ga0105242_10071349 3300009176 Bacteria 2882
121 Ga0105242_10157426 3300009176 Bacteria 1985
122 Ga0105248_10142256 3300009177 Bacteria 2706
123 Ga0105237_10023350 3300009545 Bacteria 6339
124 Ga0105238_10388532 3300009551 Bacteria 1388
125 Ga0105249_10632094 3300009553 Bacteria 1127
126 Ga0105239_10285644 3300010375 Bacteria 1858
127 Ga0105246_10070366 3300011119 Bacteria 2461
128 Ga0105246_10141755 3300011119 Unclassified 1808
129 Ga0105246_10177750 3300011119 Unclassified 1636
130 Ga0105246_10706588 3300011119 Bacteria 884
131 Ga0157374_10207047 3300013296 Unclassified 1922
132 Ga0157374_10277473 3300013296 Bacteria 1654
133 Ga0157378_10068092 3300013297 Bacteria 3191
134 Ga0163162_10170121 3300013306 Bacteria 2303
135 Ga0157372_11128061 3300013307 Unclassified 907
136 Ga0157375_10087917 3300013308 Bacteria 3161
137 Ga0157375_10982677 3300013308 Unclassified 985
138 Ga0163163_10110503 3300014325 Bacteria 2777
139 Ga0163163_10120357 3300014325 Bacteria 2659
140 Ga0163163_10193518 3300014325 Bacteria 2082
141 Ga0163163_10426796 3300014325 Bacteria 1385
142 Ga0157380_10081344 3300014326 Bacteria 2649
143 Ga0157377_10012160 3300014745 Bacteria 4320
144 Ga0163161_10280837 3300017792 Unclassified 1306
145 Ga0206353_11185693 3300020082 Bacteria 4227
146 Ga0207688_10004350 3300025901 Bacteria 7727
147 Ga0207643_10005394 3300025908 Bacteria 6843
148 Ga0207705_10037710 3300025909 Bacteria 3458
149 Ga0207684_10154522 3300025910 Unclassified 1975
150 Ga0207654_10461884 3300025911 Unclassified 892
151 Ga0207707_10002791 3300025912 Bacteria 15576
152 Ga0207707_10012832 3300025912 Bacteria 7288
153 Ga0207707_10125053 3300025912 Bacteria 2249
154 Ga0207695_10107851 3300025913 Bacteria 2770
155 Ga0207693_10015750 3300025915 Bacteria 6059
156 Ga0207693_10045689 3300025915 Bacteria 3441
157 Ga0207663_10024897 3300025916 Bacteria 3452
158 Ga0207660_10060332 3300025917 Bacteria 2726
159 Ga0207660_10152522 3300025917 Unclassified 1776
160 Ga0207657_10000640 3300025919 Bacteria 37138
161 Ga0207657_10003576 3300025919 Bacteria 16581
162 Ga0207657_10213650 3300025919 Bacteria 1547
163 Ga0207649_10096943 3300025920 Bacteria 1944
164 Ga0207652_10005903 3300025921 Bacteria 9903
165 Ga0207652_10023852 3300025921 Bacteria 5073
166 Ga0207652_10041350 3300025921 Bacteria 3918
167 Ga0207650_10042915 3300025925 Bacteria 3318
168 Ga0207659_10416819 3300025926 Unclassified 1126
169 Ga0207659_10658654 3300025926 Bacteria 895
170 Ga0207687_10000517 3300025927 Bacteria 25969
171 Ga0207664_10256020 3300025929 Bacteria 1529
172 Ga0207644_10029794 3300025931 Bacteria 3789
173 Ga0207690_10078970 3300025932 Bacteria 2292
174 Ga0207690_10090336 3300025932 Bacteria 2162
175 Ga0207690_10226346 3300025932 Unclassified 1434
176 Ga0207686_10028765 3300025934 Bacteria 3270
177 Ga0207686_10037783 3300025934 Bacteria 2917
178 Ga0207686_10077413 3300025934 Bacteria 2160
179 Ga0207686_10157519 3300025934 Bacteria 1588
180 Ga0207709_10024494 3300025935 Bacteria 3447
181 Ga0207709_10112367 3300025935 Unclassified 1824
182 Ga0207709_10133375 3300025935 Bacteria 1696
183 Ga0207670_10101297 3300025936 Unclassified 2057
184 Ga0207669_10006413 3300025937 Bacteria 5375
185 Ga0207669_10042957 3300025937 Bacteria 2644
186 Ga0207704_10008254 3300025938 Bacteria 4965
187 Ga0207704_10134602 3300025938 Bacteria 1718
188 Ga0207665_10037999 3300025939 Bacteria 3204
189 Ga0207691_10061398 3300025940 Bacteria 3414
190 Ga0207691_10180602 3300025940 Bacteria 1844
191 Ga0207691_10735250 3300025940 Bacteria 831
192 Ga0207689_10045530 3300025942 Bacteria 3627
193 Ga0207661_10000797 3300025944 Bacteria 20566
194 Ga0207661_10171401 3300025944 Bacteria 1889
195 Ga0207667_10128103 3300025949 Bacteria 2614
196 Ga0207651_10320802 3300025960 Bacteria 1295
197 Ga0207712_10386537 3300025961 Unclassified 1173
198 Ga0207677_10014684 3300026023 Bacteria 4583
199 Ga0207677_10365684 3300026023 Unclassified 1213
200 Ga0207678_10041396 3300026067 Bacteria 3995
201 Ga0207678_10565923 3300026067 Bacteria 995
202 Ga0207708_10004962 3300026075 Bacteria 9806
203 Ga0207702_10009941 3300026078 Bacteria 7977
204 Ga0207702_10050968 3300026078 Bacteria 3496
205 Ga0207702_10119802 3300026078 Bacteria 2354
206 Ga0207648_10008067 3300026089 Bacteria 10261
207 Ga0207648_10191057 3300026089 Bacteria 1814
208 Ga0207648_10549479 3300026089 Bacteria 1061
209 Ga0207674_10042268 3300026116 Bacteria 4709
210 Ga0207674_10722494 3300026116 Bacteria 961
211 Ga0207675_100156262 3300026118 Unclassified 2173
212 Ga0207675_100239794 3300026118 Bacteria 1752
213 Ga0207675_100459647 3300026118 Bacteria 1262
214 Ga0207683_10028106 3300026121 Bacteria 4863
215 Ga0207698_10069756 3300026142 Bacteria 2781
216 Ga0207428_10106197 3300027907 Bacteria 2165
217 Ga0268266_10221351 3300028379 Bacteria 1740
218 Ga0268266_10367088 3300028379 Unclassified 1355
219 Ga0268265_10077579 3300028380 Unclassified 2610
220 Ga0268264_10434773 3300028381 Unclassified 1268
221 Ga0265319_1008237 3300028563 Bacteria 4592
222 Ga0265318_10038718 3300028577 Bacteria 1822
223 Ga0265338_10067651 3300028800 Bacteria 3083
224 Ga0265320_10043334 3300031240 Bacteria 2225
225 Ga0265325_10063335 3300031241 Bacteria 1871
226 Ga0265340_10101401 3300031247 Bacteria 1337
227 Ga0307409_100095823 3300031995 Bacteria 2446
228 Ga0307416_101010122 3300032002 Bacteria 935
229 Ga0307414_10424922 3300032004 Bacteria 1160
230 Ga0373944_0010300 3300035089 Bacteria 2547
231 Ga0373936_0020326 3300035113 Bacteria 2579
232 Ga0373945_0005067 3300035116 Bacteria 4200
233 Ga0373943_0003996 3300035170 Bacteria 6710
234 Ga0373946_0016659 3300035171 Bacteria 2803
235 Ga0373935_0042164 3300035692 Bacteria 2869
236 Ga0373947_0018193 3300035725 Bacteria 4043
237 Ga0373947_0028746 3300035725 Bacteria 3261
238 Ga0373925_0006784 3300037068 Bacteria 8390
239 Ga0395899_0108940 3300037312 Bacteria 1993
240 Ga0395899_0190130 3300037312 Bacteria 1437
241 Ga0395900_0051099 3300037418 Bacteria 4258
242 Ga0395900_0051657 3300037418 Bacteria 4234
243 Ga0395900_0055060 3300037418 Bacteria 4095
244 Ga0395900_0062886 3300037418 Bacteria 3815
245 Ga0395900_0352152 3300037418 Bacteria 1446
246 Ga0395898_0005600 3300037466 Bacteria 13544
247 Ga0395898_0025653 3300037466 Bacteria 5937
248 Ga0395898_0029787 3300037466 Bacteria 5463
249 Ga0395898_0040929 3300037466 Bacteria 4579
250 Ga0395898_0188394 3300037466 Bacteria 1971
251 Ga0395898_0224920 3300037466 Unclassified 1790
252 Ga0395898_0319502 3300037466 Bacteria 1481
253 Ga0395898_0402732 3300037466 Bacteria 1305
254 Ga0395898_0631031 3300037466 Bacteria 1014
255 Ga0395905_0053133 3300037471 Bacteria 3792
256 Ga0395905_0170334 3300037471 Bacteria 2045
257 Ga0395901_0005241 3300038443 Bacteria 13087
258 Ga0395901_0022791 3300038443 Bacteria 6421
259 Ga0395901_0042205 3300038443 Bacteria 4729
260 Ga0395901_0092741 3300038443 Bacteria 3161
261 Ga0395901_0126607 3300038443 Bacteria 2684
262 Ga0395901_0177411 3300038443 Bacteria 2234
263 Ga0395901_0268341 3300038443 Bacteria 1775
264 Ga0436360_0699854 3300039438 Bacteria 3203
265 Ga0439461_0013364 3300041410 Bacteria 1549
266 Ga0439433_0010778 3300041999 Bacteria 1998
267 Ga0439446_0018332 3300042156 Bacteria 1961
268 Ga0466966_0094464 3300044684 Bacteria 1853
269 Ga0466966_0140963 3300044684 Bacteria 1473
270 Ga0466963_0005565 3300044694 Bacteria 7383
271 Ga0466963_0011001 3300044694 Bacteria 5502
272 Ga0466963_0046115 3300044694 Bacteria 2873
273 Ga0466963_0162142 3300044694 Bacteria 1556
274 Ga0466960_0209655 3300044901 Bacteria 1068
275 Ga0466959_0129553 3300045049 Bacteria 1788
276 Ga0466958_0038718 3300045836 Bacteria 2861
277 Ga0466958_0041415 3300045836 Bacteria 2770
278 Ga0466967_0000616 3300045976 Bacteria 17718
279 Ga0466967_0076835 3300045976 Bacteria 3004
280 Ga0466967_0181753 3300045976 Bacteria 1984
281 Ga0466967_0182048 3300045976 Bacteria 1982
282 Ga0466967_0233667 3300045976 Bacteria 1751
283 Ga0466967_0293552 3300045976 Bacteria 1562
284 Ga0466967_0927241 3300045976 Unclassified 866
285 Ga0495592_0114174 3300046454 Bacteria 1908
286 Ga0495603_0016327 3300046455 Bacteria 4491
287 Ga0495629_0134253 3300046459 Bacteria 1723
288 Ga0495641_0027400 3300046461 Bacteria 2771
289 Ga0495651_0113693 3300046462 Bacteria 1998
290 Ga0495653_0149973 3300046463 Bacteria 1630
291 Ga0495582_0104852 3300046473 Bacteria 1585
292 Ga0495582_0178439 3300046473 Bacteria 1210
293 Ga0495639_0092012 3300046475 Bacteria 1424
294 Ga0495662_0145516 3300046476 Bacteria 1167
295 Ga0495584_0132361 3300046491 Unclassified 1265
296 Ga0495584_0162043 3300046491 Bacteria 1137
297 Ga0495585_0090286 3300046492 Bacteria 1651
298 Ga0495585_0097148 3300046492 Bacteria 1580
299 Ga0495616_0128068 3300046513 Bacteria 1166
300 Ga0495628_0093604 3300046516 Bacteria 2324
301 Ga0495628_0307685 3300046516 Bacteria 1172
302 Ga0495630_0008285 3300046517 Bacteria 7465
303 Ga0495642_0112285 3300046528 Unclassified 1166
304 Ga0495652_0113765 3300046529 Bacteria 2172
305 Ga0495652_0212274 3300046529 Bacteria 1460
306 Ga0495665_0150537 3300046531 Bacteria 1215
307 Ga0495640_0015372 3300046533 Bacteria 5762
308 Ga0495667_0209512 3300046559 Bacteria 1246
309 Ga0495656_0052866 3300046615 Unclassified 1743
310 Ga0495659_0069177 3300046664 Unclassified 1320
311 Ga0495599_0084392 3300046678 Bacteria 1984
312 Ga0495623_0250770 3300046679 Bacteria 995
313 Ga0495658_0005871 3300046683 Bacteria 6027
314 Ga0495613_0090367 3300046689 Bacteria 2218
315 Ga0495581_0063922 3300047315 Bacteria 2126
316 Ga0495604_0181215 3300047317 Bacteria 1473
317 Ga0495674_0000901 3300047319 Bacteria 28391
318 Ga0495676_0038998 3300047321 Bacteria 3940
319 Ga0495676_0289033 3300047321 Bacteria 1108
320 Ga0495680_0008073 3300047322 Bacteria 9596
321 Ga0496100_0069219 3300048903 Bacteria 2349
322 Ga0496100_0085686 3300048903 Bacteria 2138
323 Ga0496100_0477387 3300048903 Bacteria 959
324 Ga0496101_0001291 3300048904 Bacteria 14958
325 Ga0496101_0003351 3300048904 Bacteria 9982
326 Ga0496101_0004466 3300048904 Bacteria 8818
327 Ga0496101_0026293 3300048904 Bacteria 4046
328 Ga0496102_0036720 3300048905 Bacteria 4415
329 Ga0496102_0076997 3300048905 Bacteria 3069
330 Ga0496103_0039247 3300048906 Bacteria 2909
331 Ga0496103_0130683 3300048906 Bacteria 1603
332 Ga0496103_0156914 3300048906 Bacteria 1459
333 Ga0496104_0000407 3300048907 Bacteria 37689
334 Ga0496104_0007547 3300048907 Bacteria 9618
335 Ga0496104_0040178 3300048907 Bacteria 4384
336 Ga0496104_0252480 3300048907 Bacteria 1676
337 Ga0496105_0000185 3300048908 Bacteria 41781
338 Ga0496105_0040484 3300048908 Bacteria 3842
339 Ga0496105_0053982 3300048908 Bacteria 3319
340 Ga0496105_0110496 3300048908 Bacteria 2269
341 Ga0496105_0130522 3300048908 Bacteria 2072
342 Ga0496105_0161017 3300048908 Bacteria 1842
343 Ga0496106_0001672 3300048909 Bacteria 16622
344 Ga0496106_0068720 3300048909 Bacteria 2703
345 Ga0496107_0013822 3300048910 Bacteria 5642
346 Ga0496107_0079829 3300048910 Bacteria 2385
347 Ga0496107_0111586 3300048910 Bacteria 2010
348 Ga0496107_0133371 3300048910 Bacteria 1834
349 Ga0496108_0007479 3300048911 Bacteria 8853
350 Ga0496108_0078107 3300048911 Bacteria 2801
351 Ga0496108_0207144 3300048911 Unclassified 1702
352 Ga0496108_0220822 3300048911 Bacteria 1647
353 Ga0496108_0420897 3300048911 Bacteria 1167
354 Ga0496108_0463769 3300048911 Bacteria 1107
355 Ga0496109_0002285 3300048912 Bacteria 15933
356 Ga0496109_0006590 3300048912 Bacteria 9777
357 Ga0496109_0013037 3300048912 Bacteria 7189
358 Ga0496109_0082470 3300048912 Bacteria 2963
359 Ga0496109_0185333 3300048912 Bacteria 1956
360 Ga0496110_0042598 3300048913 Bacteria 3963
361 Ga0496110_0059374 3300048913 Bacteria 3371
362 Ga0496110_0061467 3300048913 Bacteria 3315
363 Ga0496110_0081130 3300048913 Bacteria 2891
364 Ga0496110_0115650 3300048913 Bacteria 2414
365 Ga0496110_0183688 3300048913 Bacteria 1899
366 Ga0496111_0000540 3300048914 Bacteria 19592
367 Ga0496111_0038437 3300048914 Bacteria 3429
368 Ga0496111_0072190 3300048914 Bacteria 2512
369 Ga0496111_0101734 3300048914 Bacteria 2111
370 Ga0496111_0331618 3300048914 Unclassified 1127
371 Ga0496112_0026984 3300048915 Bacteria 5536
372 Ga0496112_0176198 3300048915 Bacteria 2103
373 Ga0496112_0341641 3300048915 Bacteria 1440
374 Ga0496114_0003212 3300048917 Bacteria 12535
375 Ga0496114_0003554 3300048917 Bacteria 11967
376 Ga0496114_0039012 3300048917 Bacteria 3931
377 Ga0496114_0052668 3300048917 Bacteria 3391
378 Ga0496114_0154453 3300048917 Bacteria 1992
379 Ga0496114_0323059 3300048917 Bacteria 1364
380 Ga0496115_0020470 3300048918 Bacteria 5104
381 Ga0496115_0025768 3300048918 Bacteria 4583
382 Ga0496115_0090815 3300048918 Bacteria 2495
383 Ga0496115_0108087 3300048918 Bacteria 2284
384 Ga0501031_0000298 3300049568 Bacteria 28364
385 Ga0501031_0004173 3300049568 Bacteria 9333
386 Ga0501032_0037908 3300049569 Bacteria 3285
387 Ga0501033_0209570 3300049570 Bacteria 1390
388 Ga0501036_0000550 3300049572 Bacteria 26891
389 Ga0501036_0003339 3300049572 Bacteria 12820
390 Ga0501036_0410700 3300049572 Bacteria 1129
391 Ga0501037_0120997 3300049573 Bacteria 1882
392 Ga0501038_0028058 3300049574 Bacteria 5001
393 Ga0501038_0135915 3300049574 Bacteria 2014
394 Ga0501039_0035807 3300049575 Bacteria 3831
395 Ga0501039_0304241 3300049575 Bacteria 1253
396 Ga0501040_0006869 3300049576 Bacteria 7376
397 Ga0501040_0019254 3300049576 Bacteria 4540
398 Ga0501040_0331281 3300049576 Bacteria 1089
399 Ga0501040_0332479 3300049576 Bacteria 1087
400 Ga0501041_0000252 3300049577 Bacteria 25154
401 Ga0501041_0010940 3300049577 Bacteria 5355
402 Ga0501041_0121697 3300049577 Bacteria 1622
403 Ga0501041_0279525 3300049577 Bacteria 1050
404 Ga0501042_0003461 3300049578 Bacteria 9910
405 Ga0501042_0017808 3300049578 Bacteria 4906
406 Ga0501042_0033533 3300049578 Bacteria 3640
407 Ga0501043_0081543 3300049579 Bacteria 2542
408 Ga0501046_0000781 3300049580 Bacteria 30770
409 Ga0501046_0018358 3300049580 Bacteria 5821
410 Ga0501046_0074325 3300049580 Bacteria 2637
411 Ga0501047_0027063 3300049581 Bacteria 5523
412 Ga0501048_0006598 3300049582 Bacteria 8822
413 Ga0501048_0099458 3300049582 Bacteria 2052
414 Ga0501067_0002082 3300049583 Bacteria 11018
415 Ga0501067_0007504 3300049583 Bacteria 6059
416 Ga0501067_0068053 3300049583 Bacteria 1971
417 Ga0501067_0106155 3300049583 Bacteria 1561
418 Ga0501068_0013224 3300049584 Bacteria 4692
419 Ga0501068_0021328 3300049584 Bacteria 3782
420 Ga0501068_0030794 3300049584 Bacteria 3185
421 Ga0501069_0016250 3300049585 Bacteria 3995
422 Ga0501069_0028032 3300049585 Bacteria 3087
423 Ga0501069_0056639 3300049585 Bacteria 2184
424 Ga0501069_0108196 3300049585 Bacteria 1582
425 Ga0501069_0166539 3300049585 Bacteria 1270
426 Ga0501070_0014218 3300049586 Bacteria 6698
427 Ga0501070_0231576 3300049586 Bacteria 1513
428 Ga0501071_0000887 3300049587 Bacteria 16185
429 Ga0501071_0002017 3300049587 Bacteria 12147
430 Ga0501072_0000223 3300049588 Bacteria 41720
431 Ga0501072_0001965 3300049588 Bacteria 15320
432 Ga0501072_0093065 3300049588 Bacteria 2394
433 Ga0501072_0189713 3300049588 Bacteria 1639
434 Ga0501073_0127192 3300049589 Bacteria 1766
435 Ga0501074_0002480 3300049590 Bacteria 12871
436 Ga0501074_0002764 3300049590 Bacteria 12277
437 Ga0501074_0036639 3300049590 Bacteria 3553
438 Ga0501074_0057974 3300049590 Bacteria 2790
439 Ga0501074_0187939 3300049590 Bacteria 1473
440 Ga0501075_0000656 3300049591 Bacteria 21247
441 Ga0501075_0553197 3300049591 Bacteria 878
442 Ga0501076_0007865 3300049592 Bacteria 7771
443 Ga0501076_0134979 3300049592 Bacteria 2003
444 Ga0501077_0002514 3300049593 Bacteria 10980
445 Ga0501077_0016704 3300049593 Bacteria 4627
446 Ga0501077_0023956 3300049593 Bacteria 3872
447 Ga0501077_0094784 3300049593 Bacteria 1892
448 Ga0501079_0000345 3300049741 Bacteria 29504
449 Ga0501079_0145815 3300049741 Bacteria 1844
450 Ga0501080_0010439 3300049742 Bacteria 8500
451 Ga0501080_0039012 3300049742 Bacteria 4432
452 Ga0501080_0074840 3300049742 Bacteria 3150
453 Ga0501081_0004070 3300049743 Bacteria 9367
454 Ga0501083_0031398 3300049744 Bacteria 3646
455 Ga0501035_0005944 3300049822 Bacteria 11490
456 Ga0501035_0050499 3300049822 Bacteria 3727
457 Ga0501045_0000373 3300049824 Bacteria 26939
458 Ga0501045_0016234 3300049824 Bacteria 5285
459 Ga0501045_0116692 3300049824 Bacteria 1981
460 nmdc:mga0yw44_168936_c1 3300050492 Bacteria 1435
461 nmdc:mga05p37_253828_c1 3300050507 Unclassified 2108
462 nmdc:mga05p37_31783_c1 3300050507 Bacteria 6450
463 nmdc:mga09592_526908_c1 3300050508 Bacteria 1016
464 nmdc:mga0qj67_536620_c1 3300050509 Bacteria 939
465 nmdc:mga08y16_153827_c1 3300050511 Bacteria 2030
466 nmdc:mga08y16_155440_c1 3300050511 Bacteria 2377
467 nmdc:mga0n895_171669_c1 3300050512 Bacteria 2200
468 nmdc:mga0n895_253127_c1 3300050512 Bacteria 1787
469 nmdc:mga0n895_343089_c1 3300050512 Bacteria 1513
470 nmdc:mga0rr50_88563_c1 3300050513 Bacteria 2405
471 nmdc:mga08x19_121162_c1 3300050514 Bacteria 1754
472 nmdc:mga08x19_73049_c1 3300050514 Bacteria 2238
473 nmdc:mga0a205_23742_c1 3300050515 Bacteria 5818
474 Ga0495612_0105012 3300053078 Bacteria 1205
475 Ga0495619_0145290 3300053085 Bacteria 1635
476 Ga0495619_0330851 3300053085 Bacteria 1054
477 Ga0501084_0001287 3300054114 Bacteria 19758
478 Ga0501084_0004246 3300054114 Bacteria 11664
479 Ga0501084_0031057 3300054114 Bacteria 4467
480 Ga0501084_0039525 3300054114 Bacteria 3946
481 Ga0501084_0211955 3300054114 Bacteria 1634
482 Ga0501082_0000925 3300060353 Bacteria 25898
483 Ga0501082_0716715 3300060353 Bacteria 876
484 Ga0530510_0006529 3300061734 Bacteria 8125
485 Ga0530510_0046799 3300061734 Bacteria 3125
486 Ga0530510_0063102 3300061734 Bacteria 2682
487 Ga0530510_0269711 3300061734 Bacteria 1270
488 Ga0530510_0347314 3300061734 Bacteria 1114
489 Ga0081455_10019525
490 Ga0070658_10005872
491 Ga0070658_10026784
492 Ga0070683_100015350
493 Ga0070683_100016818
494 Ga0070683_100094891
495 Ga0070683_100616224
496 Ga0070670_100028691
497 Ga0070670_100031578
498 Ga0070680_100028128
499 Ga0070682_100022489
500 Ga0070682_100034693
501 Ga0070682_100273654
502 Ga0068868_100055994
503 Ga0068868_100062998
504 Ga0068868_100678489
505 Ga0070660_100001675
506 Ga0070660_100079706
507 Ga0070660_100241932
508 Ga0070660_100266856
509 Ga0070689_100170629
510 Ga0070661_100063590
511 Ga0070661_100212863
512 Ga0070668_100382161
513 Ga0070669_100383824
514 Ga0070675_100266304
515 Ga0070671_100041154
516 Ga0070671_100056793
517 Ga0070674_100008814
518 Ga0070674_100244461
519 Ga0070673_100061633
520 Ga0070673_100285875
521 Ga0070688_100002013
522 Ga0070667_100295047
523 Ga0070713_100147329
524 Ga0070710_10205063
525 Ga0070701_10204267
526 Ga0070711_100034831
527 Ga0070711_100113734
528 Ga0070711_100330509
529 Ga0070700_100070445
530 Ga0070694_100173862
531 Ga0070678_100010950
532 Ga0070678_100112417
533 Ga0070681_10003063
534 Ga0070681_10010270
535 Ga0070681_10023052
536 Ga0070681_10585842
537 Ga0068867_100264066
538 Ga0070685_10044499
539 Ga0070706_100168490
540 Ga0070679_100002341
541 Ga0070679_100028112
542 Ga0070679_100090439
543 Ga0070684_100035608
544 Ga0070684_100385615
545 Ga0068853_100380080
546 Ga0070672_100056123
547 Ga0070686_100013259
548 Ga0070686_100320113
549 Ga0070696_100114259
550 Ga0070696_100138605
551 Ga0070693_100040470
552 Ga0070693_100057784
553 Ga0070693_100427271
554 Ga0070665_100100955
555 Ga0068855_100023498
556 Ga0070664_100260696
557 Ga0068857_100022129
558 Ga0068854_100350503
559 Ga0068856_100011070
560 Ga0068856_100150932
561 Ga0068856_100248994
562 Ga0070702_100009005
563 Ga0068859_100217485
564 Ga0068864_100052313
565 Ga0068866_10009991
566 Ga0068861_100280510
567 Ga0068870_10004635
568 Ga0068858_100380906
569 Ga0068862_100231383
570 Ga0081455_10027501
571 Ga0081455_10136560
572 Ga0075365_10131679
573 Ga0070712_100029827
574 Ga0070712_100106276
575 Ga0068871_100111911
576 Ga0075431_100705146
577 Ga0075433_10078505
578 Ga0075433_10583357
579 Ga0075434_100296319
580 Ga0075434_100494464
581 Ga0068865_100012338
582 Ga0068865_100051470
583 Ga0068865_100099763
584 Ga0068865_100312161
585 Ga0075436_100126291
586 Ga0097620_100217489
587 Ga0075435_100067610
588 Ga0075435_100291199
589 Ga0105240_10108289
590 Ga0105240_10122551
591 Ga0105240_10637676
592 Ga0105240_10789582
593 Ga0111539_10082761
594 Ga0111539_10154840
595 Ga0105245_10006343
596 Ga0105245_10359402
597 Ga0105245_10545763
598 Ga0114129_10071837
599 Ga0114129_10247503
600 Ga0114129_10338229
601 Ga0114129_10463774
602 Ga0114129_11044052
603 Ga0105243_10071162
604 Ga0105243_10090678
605 Ga0105243_10213393
606 Ga0105241_10469692
607 Ga0105242_10066714
608 Ga0105242_10071349
609 Ga0105242_10157426
610 Ga0105248_10142256
611 Ga0105237_10023350
612 Ga0105238_10388532
613 Ga0105249_10632094
614 Ga0105239_10285644
615 Ga0105246_10070366
616 Ga0105246_10141755
617 Ga0105246_10177750
618 Ga0105246_10706588
619 Ga0157374_10207047
620 Ga0157374_10277473
621 Ga0157378_10068092
622 Ga0163162_10170121
623 Ga0157372_11128061
624 Ga0157375_10087917
625 Ga0157375_10982677
626 Ga0163163_10110503
627 Ga0163163_10120357
628 Ga0163163_10193518
629 Ga0163163_10426796
630 Ga0157380_10081344
631 Ga0157377_10012160
632 Ga0163161_10280837
633 Ga0206353_11185693
634 Ga0207688_10004350
635 Ga0207643_10005394
636 Ga0207705_10037710
637 Ga0207684_10154522
638 Ga0207654_10461884
639 Ga0207707_10002791
640 Ga0207707_10012832
641 Ga0207707_10125053
642 Ga0207695_10107851
643 Ga0207693_10015750
644 Ga0207693_10045689
645 Ga0207663_10024897
646 Ga0207660_10060332
647 Ga0207660_10152522
648 Ga0207657_10000640
649 Ga0207657_10003576
650 Ga0207657_10213650
651 Ga0207649_10096943
652 Ga0207652_10005903
653 Ga0207652_10023852
654 Ga0207652_10041350
655 Ga0207650_10042915
656 Ga0207659_10416819
657 Ga0207659_10658654
658 Ga0207687_10000517
659 Ga0207664_10256020
660 Ga0207644_10029794
661 Ga0207690_10078970
662 Ga0207690_10090336
663 Ga0207690_10226346
664 Ga0207686_10028765
665 Ga0207686_10037783
666 Ga0207686_10077413
667 Ga0207686_10157519
668 Ga0207709_10024494
669 Ga0207709_10112367
670 Ga0207709_10133375
671 Ga0207670_10101297
672 Ga0207669_10006413
673 Ga0207669_10042957
674 Ga0207704_10008254
675 Ga0207704_10134602
676 Ga0207665_10037999
677 Ga0207691_10061398
678 Ga0207691_10180602
679 Ga0207691_10735250
680 Ga0207689_10045530
681 Ga0207661_10000797
682 Ga0207661_10171401
683 Ga0207667_10128103
684 Ga0207651_10320802
685 Ga0207712_10386537
686 Ga0207677_10014684
687 Ga0207677_10365684
688 Ga0207678_10041396
689 Ga0207678_10565923
690 Ga0207708_10004962
691 Ga0207702_10009941
692 Ga0207702_10050968
693 Ga0207702_10119802
694 Ga0207648_10008067
695 Ga0207648_10191057
696 Ga0207648_10549479
697 Ga0207674_10042268
698 Ga0207674_10722494
699 Ga0207675_100156262
700 Ga0207675_100239794
701 Ga0207675_100459647
702 Ga0207683_10028106
703 Ga0207698_10069756
704 Ga0207428_10106197
705 Ga0268266_10221351
706 Ga0268266_10367088
707 Ga0268265_10077579
708 Ga0268264_10434773
709 Ga0265319_1008237
710 Ga0265318_10038718
711 Ga0265338_10067651
712 Ga0265320_10043334
713 Ga0265325_10063335
714 Ga0265340_10101401
715 Ga0307409_100095823
716 Ga0307416_101010122
717 Ga0307414_10424922
718 Ga0373944_0010300
719 Ga0373936_0020326
720 Ga0373945_0005067
721 Ga0373943_0003996
722 Ga0373946_0016659
723 Ga0373935_0042164
724 Ga0373947_0018193
725 Ga0373947_0028746
726 Ga0373925_0006784
727 Ga0395899_0108940
728 Ga0395899_0190130
729 Ga0395900_0051099
730 Ga0395900_0051657
731 Ga0395900_0055060
732 Ga0395900_0062886
733 Ga0395900_0352152
734 Ga0395898_0005600
735 Ga0395898_0025653
736 Ga0395898_0029787
737 Ga0395898_0040929
738 Ga0395898_0188394
739 Ga0395898_0224920
740 Ga0395898_0319502
741 Ga0395898_0402732
742 Ga0395898_0631031
743 Ga0395905_0053133
744 Ga0395905_0170334
745 Ga0395901_0005241
746 Ga0395901_0022791
747 Ga0395901_0042205
748 Ga0395901_0092741
749 Ga0395901_0126607
750 Ga0395901_0177411
751 Ga0395901_0268341
752 Ga0436360_0699854
753 Ga0439461_0013364
754 Ga0439433_0010778
755 Ga0439446_0018332
756 Ga0466966_0094464
757 Ga0466966_0140963
758 Ga0466963_0005565
759 Ga0466963_0011001
760 Ga0466963_0046115
761 Ga0466963_0162142
762 Ga0466960_0209655
763 Ga0466959_0129553
764 Ga0466958_0038718
765 Ga0466958_0041415
766 Ga0466967_0000616
767 Ga0466967_0076835
768 Ga0466967_0181753
769 Ga0466967_0182048
770 Ga0466967_0233667
771 Ga0466967_0293552
772 Ga0466967_0927241
773 Ga0495592_0114174
774 Ga0495603_0016327
775 Ga0495629_0134253
776 Ga0495641_0027400
777 Ga0495651_0113693
778 Ga0495653_0149973
779 Ga0495582_0104852
780 Ga0495582_0178439
781 Ga0495639_0092012
782 Ga0495662_0145516
783 Ga0495584_0132361
784 Ga0495584_0162043
785 Ga0495585_0090286
786 Ga0495585_0097148
787 Ga0495616_0128068
788 Ga0495628_0093604
789 Ga0495628_0307685
790 Ga0495630_0008285
791 Ga0495642_0112285
792 Ga0495652_0113765
793 Ga0495652_0212274
794 Ga0495665_0150537
795 Ga0495640_0015372
796 Ga0495667_0209512
797 Ga0495656_0052866
798 Ga0495659_0069177
799 Ga0495599_0084392
800 Ga0495623_0250770
801 Ga0495658_0005871
802 Ga0495613_0090367
803 Ga0495581_0063922
804 Ga0495604_0181215
805 Ga0495674_0000901
806 Ga0495676_0038998
807 Ga0495676_0289033
808 Ga0495680_0008073
809 Ga0496100_0069219
810 Ga0496100_0085686
811 Ga0496100_0477387
812 Ga0496101_0001291
813 Ga0496101_0003351
814 Ga0496101_0004466
815 Ga0496101_0026293
816 Ga0496102_0036720
817 Ga0496102_0076997
818 Ga0496103_0039247
819 Ga0496103_0130683
820 Ga0496103_0156914
821 Ga0496104_0000407
822 Ga0496104_0007547
823 Ga0496104_0040178
824 Ga0496104_0252480
825 Ga0496105_0000185
826 Ga0496105_0040484
827 Ga0496105_0053982
828 Ga0496105_0110496
829 Ga0496105_0130522
830 Ga0496105_0161017
831 Ga0496106_0001672
832 Ga0496106_0068720
833 Ga0496107_0013822
834 Ga0496107_0079829
835 Ga0496107_0111586
836 Ga0496107_0133371
837 Ga0496108_0007479
838 Ga0496108_0078107
839 Ga0496108_0207144
840 Ga0496108_0220822
841 Ga0496108_0420897
842 Ga0496108_0463769
843 Ga0496109_0002285
844 Ga0496109_0006590
845 Ga0496109_0013037
846 Ga0496109_0082470
847 Ga0496109_0185333
848 Ga0496110_0042598
849 Ga0496110_0059374
850 Ga0496110_0061467
851 Ga0496110_0081130
852 Ga0496110_0115650
853 Ga0496110_0183688
854 Ga0496111_0000540
855 Ga0496111_0038437
856 Ga0496111_0072190
857 Ga0496111_0101734
858 Ga0496111_0331618
859 Ga0496112_0026984
860 Ga0496112_0176198
861 Ga0496112_0341641
862 Ga0496114_0003212
863 Ga0496114_0003554
864 Ga0496114_0039012
865 Ga0496114_0052668
866 Ga0496114_0154453
867 Ga0496114_0323059
868 Ga0496115_0020470
869 Ga0496115_0025768
870 Ga0496115_0090815
871 Ga0496115_0108087
872 Ga0501031_0000298
873 Ga0501031_0004173
874 Ga0501032_0037908
875 Ga0501033_0209570
876 Ga0501036_0000550
877 Ga0501036_0003339
878 Ga0501036_0410700
879 Ga0501037_0120997
880 Ga0501038_0028058
881 Ga0501038_0135915
882 Ga0501039_0035807
883 Ga0501039_0304241
884 Ga0501040_0006869
885 Ga0501040_0019254
886 Ga0501040_0331281
887 Ga0501040_0332479
888 Ga0501041_0000252
889 Ga0501041_0010940
890 Ga0501041_0121697
891 Ga0501041_0279525
892 Ga0501042_0003461
893 Ga0501042_0017808
894 Ga0501042_0033533
895 Ga0501043_0081543
896 Ga0501046_0000781
897 Ga0501046_0018358
898 Ga0501046_0074325
899 Ga0501047_0027063
900 Ga0501048_0006598
901 Ga0501048_0099458
902 Ga0501067_0002082
903 Ga0501067_0007504
904 Ga0501067_0068053
905 Ga0501067_0106155
906 Ga0501068_0013224
907 Ga0501068_0021328
908 Ga0501068_0030794
909 Ga0501069_0016250
910 Ga0501069_0028032
911 Ga0501069_0056639
912 Ga0501069_0108196
913 Ga0501069_0166539
914 Ga0501070_0014218
915 Ga0501070_0231576
916 Ga0501071_0000887
917 Ga0501071_0002017
918 Ga0501072_0000223
919 Ga0501072_0001965
920 Ga0501072_0093065
921 Ga0501072_0189713
922 Ga0501073_0127192
923 Ga0501074_0002480
924 Ga0501074_0002764
925 Ga0501074_0036639
926 Ga0501074_0057974
927 Ga0501074_0187939
928 Ga0501075_0000656
929 Ga0501075_0553197
930 Ga0501076_0007865
931 Ga0501076_0134979
932 Ga0501077_0002514
933 Ga0501077_0016704
934 Ga0501077_0023956
935 Ga0501077_0094784
936 Ga0501079_0000345
937 Ga0501079_0145815
938 Ga0501080_0010439
939 Ga0501080_0039012
940 Ga0501080_0074840
941 Ga0501081_0004070
942 Ga0501083_0031398
943 Ga0501035_0005944
944 Ga0501035_0050499
945 Ga0501045_0000373
946 Ga0501045_0016234
947 Ga0501045_0116692
948 nmdc:mga0yw44_168936_c1
949 nmdc:mga05p37_253828_c1
950 nmdc:mga05p37_31783_c1
951 nmdc:mga09592_526908_c1
952 nmdc:mga0qj67_536620_c1
953 nmdc:mga08y16_153827_c1
954 nmdc:mga08y16_155440_c1
955 nmdc:mga0n895_171669_c1
956 nmdc:mga0n895_253127_c1
957 nmdc:mga0n895_343089_c1
958 nmdc:mga0rr50_88563_c1
959 nmdc:mga08x19_121162_c1
960 nmdc:mga08x19_73049_c1
961 nmdc:mga0a205_23742_c1
962 Ga0495612_0105012
963 Ga0495619_0145290
964 Ga0495619_0330851
965 Ga0501084_0001287
966 Ga0501084_0004246
967 Ga0501084_0031057
968 Ga0501084_0039525
969 Ga0501084_0211955
970 Ga0501082_0000925
971 Ga0501082_0716715
972 Ga0530510_0006529
973 Ga0530510_0046799
974 Ga0530510_0063102
975 Ga0530510_0269711
976 Ga0530510_0347314

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02616

SMC_ScpA

Segregation and condensation protein ScpA

21

143

0.78

Map