F453537

General Info

Members Datasets Scaffolds Average Seq Length
488 336 403 246

Family's Representative Sequence

Representative Sequence 3300003316|rootH1_10022060|rootH1_100220604
Length 262
Sequence MSSRNRYFVRSTQMGRLTGKVVLVTGGNSGIGLASAKRFVEEGAFVFVTGRRQSELDKAVASIGHNVRALQGDVSKLDDLDRIFAAVQAEKGHLDVLFANAGLGSLAPLGAITEEQFDLTFDVNVKGTLFTVQKALPLMSAGASIILTGSTTGSKGTPAFSVYSATKAAIRNFARSWALDLKDSGIRVNVLSPGATATPGLMESLVSGAQLDALIGALKVQTPLGRIADPDETAAVALFLASDESSFMTGSEVFVDGGLAQV

Samples

Sample ID Description Type Environment
1 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
2 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
3 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
4 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
5 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
6 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
7 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
8 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
9 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
10 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
11 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
12 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
13 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
14 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
15 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
16 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
17 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
18 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
19 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
20 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
21 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
22 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
23 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
24 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
25 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
26 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
27 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
28 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
29 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
30 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
31 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
32 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
33 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
34 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
35 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
36 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
37 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
38 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
39 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
40 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
41 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
42 2849560528 Caulobacter zeae 410 Isolate Unclassified
43 2851153111 Caulobacter radicis 736 Isolate Unclassified
44 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
45 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
46 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
47 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
48 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
49 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
50 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
51 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
52 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
53 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
54 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
55 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
56 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
57 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
58 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
59 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
60 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
61 2935625433 Kosakonia sp. 1610 Isolate Rhizosphere
62 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
63 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
64 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
65 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
66 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
67 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
68 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
69 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
70 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
71 2939617950 Kosakonia cowanii 2056 Isolate Rhizosphere
72 2974435778 Kosakonia cowanii SORGH_AS 304 Isolate Unclassified
73 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
74 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
75 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
76 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
77 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
78 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
79 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
80 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
81 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
82 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
83 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
84 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
85 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
86 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
87 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
88 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
89 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
90 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
91 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
92 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
93 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
94 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
95 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
96 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
97 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
98 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
99 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
100 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
101 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
102 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
103 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
104 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
105 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
106 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
107 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
108 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
109 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
110 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
111 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
112 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
113 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
114 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
115 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
116 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
117 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
118 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
119 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
120 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
121 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
122 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
123 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
124 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
125 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
126 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
127 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
128 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
129 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
130 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
131 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
132 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
133 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
134 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
135 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
136 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
137 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
138 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
139 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
140 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
141 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
142 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
143 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
144 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
145 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
146 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
147 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
148 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
149 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
150 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
151 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
152 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
153 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
154 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
155 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
156 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
157 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
158 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
159 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
160 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
161 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
162 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
163 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
164 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
165 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
166 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
167 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
168 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
169 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
170 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
171 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
172 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
173 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
174 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
175 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
176 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
177 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
178 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
179 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
180 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
217 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
218 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
219 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
220 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
224 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
225 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
226 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
227 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
228 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
229 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
230 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
231 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
232 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
233 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
234 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
235 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
236 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
237 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
238 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
239 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
240 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
241 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
242 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
243 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
244 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
245 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
246 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
247 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
248 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
249 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
250 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
251 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
252 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
253 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
254 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
255 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
256 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
257 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
258 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
259 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
260 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
261 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
262 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
263 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
264 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
265 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
266 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
267 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
268 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
269 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
270 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
271 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
272 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
273 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
274 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
275 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
276 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
277 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
278 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
279 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
280 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
281 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
282 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
283 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
284 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
285 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
286 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
287 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
288 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
289 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
290 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
291 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
292 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
293 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
294 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
295 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
296 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
297 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
298 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
299 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
300 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
301 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
302 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
303 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
304 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
305 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
306 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
307 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
308 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
309 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
310 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
311 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
312 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
313 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
314 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
315 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
316 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
317 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
318 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
319 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
320 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
321 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
322 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
323 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
324 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
325 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
326 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
327 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
328 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
329 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
330 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
331 8019504834 Atlantibacter hermannii 1903 Isolate Rhizosphere
332 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
333 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
334 8054002106 Azospirillum lipoferum 59b Isolate Unclassified
335 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
336 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 82.58
Metatranscriptomes 0
Isolates 17.42

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 21.11
Nodule 8.61
Rhizoplane 4.1
Rhizosphere 44.26
Stem 0
Stem Tuber 0
Unclassified 21.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10009555 3300001979 Bacteria 3790
2 JGI25155J39150_1000004 3300002704 Bacteria 269098
3 JGI25156J39149_1000014 3300002705 Bacteria 189257
4 JGI25154J39366_1000096 3300002738 Bacteria 79168
5 JGI25157J39369_1000005 3300002741 Bacteria 269089
6 JGI25152J39213_1000226 3300002773 Bacteria 38240
7 JGI25151J46595_10048406 3300003187 Bacteria 1469
8 JGI25153J46596_10000112 3300003215 Bacteria 92578
9 JGI25153J46596_10000865 3300003215 Bacteria 18448
10 rootH1_10022060 3300003316 Bacteria 4897
11 rootH2_10188379 3300003320 Bacteria 4876
12 rootL2_10031680 3300003322 Bacteria 10086
13 rootH1_10096888 3300003323 Bacteria 9689
14 JGI25160J50197_1000036 3300003354 Bacteria 166820
15 JGI25160J50197_1000678 3300003354 Bacteria 18870
16 JGI25160J50197_1007982 3300003354 Bacteria 4074
17 Ga0055531_10037065 3300003794 Bacteria 1490
18 Ga0058692_1000675 3300003856 Bacteria 14050
19 Ga0058692_1005971 3300003856 Bacteria 3402
20 Ga0055543_1007336 3300004625 Bacteria 2562
21 Ga0065165_1000374 3300005262 Bacteria 72947
22 Ga0065165_1001685 3300005262 Bacteria 22303
23 Ga0065165_1027049 3300005262 Bacteria 1876
24 Ga0070658_10003338 3300005327 Bacteria 13246
25 Ga0070658_10528540 3300005327 Bacteria 1020
26 Ga0070670_100000186 3300005331 Bacteria 56675
27 Ga0070670_100004214 3300005331 Bacteria 12041
28 Ga0068869_100192283 3300005334 Bacteria 1605
29 Ga0070660_100083950 3300005339 Bacteria 2503
30 Ga0070660_100324701 3300005339 Bacteria 1265
31 Ga0070661_100109537 3300005344 Bacteria 2061
32 Ga0070668_100006094 3300005347 Bacteria 8943
33 Ga0070671_100436925 3300005355 Bacteria 1122
34 Ga0070671_100558120 3300005355 Bacteria 988
35 Ga0070674_100001650 3300005356 Bacteria 12034
36 Ga0070673_100183779 3300005364 Bacteria 1791
37 Ga0070659_100052238 3300005366 Bacteria 3214
38 Ga0070667_100002674 3300005367 Bacteria 15432
39 Ga0070708_100023730 3300005445 Bacteria 5219
40 Ga0070663_100139310 3300005455 Bacteria 1850
41 Ga0070663_100183606 3300005455 Bacteria 1624
42 Ga0070678_100000022 3300005456 Bacteria 49544
43 Ga0070662_100082833 3300005457 Bacteria 2393
44 Ga0068867_100017372 3300005459 Bacteria 5111
45 Ga0070707_100073274 3300005468 Bacteria 3301
46 Ga0070698_100152085 3300005471 Bacteria 2262
47 Ga0070699_100080109 3300005518 Bacteria 2846
48 Ga0070697_100195533 3300005536 Bacteria 1717
49 Ga0068853_100124891 3300005539 Bacteria 2298
50 Ga0070665_100013988 3300005548 Bacteria 8070
51 Ga0070665_100019272 3300005548 Bacteria 6845
52 Ga0070665_100055240 3300005548 Bacteria 3982
53 Ga0070665_100204114 3300005548 Bacteria 1977
54 Ga0070665_100264172 3300005548 Bacteria 1722
55 Ga0070665_100456799 3300005548 Bacteria 1287
56 Ga0068855_100050386 3300005563 Bacteria 4907
57 Ga0068855_100154969 3300005563 Bacteria 2603
58 Ga0068854_100092288 3300005578 Bacteria 2255
59 Ga0068856_100143021 3300005614 Bacteria 2399
60 Ga0068856_100145750 3300005614 Bacteria 2375
61 Ga0068852_100056624 3300005616 Bacteria 3389
62 Ga0068852_100147303 3300005616 Bacteria 2185
63 Ga0068859_100054032 3300005617 Bacteria 4039
64 Ga0068864_100004050 3300005618 Bacteria 12042
65 Ga0068861_100107167 3300005719 Bacteria 2234
66 Ga0068861_100290303 3300005719 Bacteria 1412
67 Ga0068851_10018172 3300005834 Bacteria 3386
68 Ga0068863_100001676 3300005841 Bacteria 21929
69 Ga0068863_100232006 3300005841 Bacteria 1780
70 Ga0068858_100005830 3300005842 Bacteria 12032
71 Ga0068860_100012551 3300005843 Bacteria 8341
72 Ga0068860_100464214 3300005843 Bacteria 1260
73 Ga0068862_100010271 3300005844 Bacteria 7724
74 Ga0075368_10028265 3300006042 Bacteria 2166
75 Ga0075363_100007015 3300006048 Bacteria 5151
76 Ga0075363_100215876 3300006048 Bacteria 1099
77 Ga0075364_10330845 3300006051 Bacteria 1038
78 Ga0075364_10446316 3300006051 Bacteria 884
79 Ga0075362_10144434 3300006177 Bacteria 1138
80 Ga0075367_10022372 3300006178 Bacteria 3545
81 Ga0075367_10220128 3300006178 Bacteria 1188
82 Ga0075369_10046656 3300006186 Bacteria 1866
83 Ga0075369_10099709 3300006186 Bacteria 1302
84 Ga0075366_10009763 3300006195 Bacteria 5366
85 Ga0075370_10281680 3300006353 Bacteria 987
86 Ga0068871_100003935 3300006358 Bacteria 10250
87 Ga0097620_100054030 3300006931 Bacteria 4039
88 Ga0099824_1008099 3300006942 Bacteria 13567
89 Ga0105251_10086183 3300009011 Bacteria 1447
90 Ga0105240_10257895 3300009093 Bacteria 2013
91 Ga0105240_10297118 3300009093 Bacteria 1849
92 Ga0105247_10024463 3300009101 Bacteria 3640
93 Ga0105243_10000223 3300009148 Bacteria 65335
94 Ga0105243_10155160 3300009148 Bacteria 1968
95 Ga0105241_10011419 3300009174 Bacteria 6511
96 Ga0105248_10032259 3300009177 Bacteria 5856
97 Ga0105237_10369241 3300009545 Bacteria 1440
98 Ga0105238_10012926 3300009551 Bacteria 8424
99 Ga0105238_10106027 3300009551 Bacteria 2792
100 Ga0105238_10526269 3300009551 Bacteria 1185
101 Ga0105249_10005246 3300009553 Bacteria 11187
102 Ga0099796_10003026 3300010159 Bacteria 3819
103 Ga0099796_10119748 3300010159 Bacteria 1010
104 Ga0105239_10023543 3300010375 Bacteria 6783
105 Ga0105239_10102590 3300010375 Bacteria 3166
106 Ga0105239_10148774 3300010375 Bacteria 2613
107 Ga0105246_10050809 3300011119 Bacteria 2845
108 Ga0157373_10023060 3300013100 Bacteria 4513
109 Ga0157371_10000029 3300013102 Bacteria 252131
110 Ga0157371_10068686 3300013102 Bacteria 2508
111 Ga0157370_10126983 3300013104 Bacteria 2380
112 Ga0157369_10002958 3300013105 Bacteria 20314
113 Ga0157369_10046890 3300013105 Bacteria 4694
114 Ga0163162_10074102 3300013306 Bacteria 3462
115 Ga0163162_10117567 3300013306 Bacteria 2760
116 Ga0157372_10000543 3300013307 Bacteria 41555
117 Ga0157372_10299890 3300013307 Bacteria 1869
118 Ga0163163_10305369 3300014325 Bacteria 1644
119 Ga0163163_11013189 3300014325 Bacteria 894
120 Ga0157379_10017035 3300014968 Bacteria 6397
121 Ga0157376_10008238 3300014969 Bacteria 7507
122 Ga0214544_1000003 3300021320 Bacteria 643752
123 Ga0214544_1023028 3300021320 Bacteria 3585
124 Ga0214542_1000022 3300021321 Bacteria 193578
125 Ga0214545_1000010 3300021324 Bacteria 193578
126 Ga0214545_1015611 3300021324 Bacteria 8219
127 Ga0214545_1021510 3300021324 Bacteria 4801
128 Ga0214543_1000035 3300021327 Bacteria 183100
129 Ga0209435_100009 3300025206 Bacteria 476614
130 Ga0209435_102130 3300025206 Bacteria 2361
131 Ga0207425_1005796 3300025245 Bacteria 3471
132 Ga0209646_1000018 3300025246 Bacteria 476716
133 Ga0209026_1000043 3300025250 Bacteria 269142
134 Ga0209677_103195 3300025253 Bacteria 5494
135 Ga0209759_1000007 3300025256 Bacteria 476614
136 Ga0209129_1000077 3300025258 Bacteria 193474
137 Ga0209233_1011229 3300025261 Bacteria 2646
138 Ga0209233_1011518 3300025261 Bacteria 2603
139 Ga0209673_1038497 3300025273 Bacteria 1392
140 Ga0209130_1010090 3300025284 Bacteria 2626
141 Ga0209025_1000180 3300025294 Bacteria 157372
142 Ga0209564_1001948 3300025295 Bacteria 18261
143 Ga0209758_1000023 3300025297 Bacteria 612453
144 Ga0209758_1000106 3300025297 Bacteria 218450
145 Ga0209758_1006168 3300025297 Bacteria 8775
146 Ga0209758_1011783 3300025297 Bacteria 5008
147 Ga0209758_1064513 3300025297 Bacteria 1187
148 Ga0209256_1003353 3300025299 Bacteria 11355
149 Ga0209256_1016943 3300025299 Bacteria 2451
150 Ga0207426_1000014 3300025302 Bacteria 649413
151 Ga0207426_1000819 3300025302 Bacteria 33379
152 Ga0207426_1024874 3300025302 Bacteria 2025
153 Ga0207426_1058710 3300025302 Bacteria 1115
154 Ga0207426_1061152 3300025302 Bacteria 1083
155 Ga0209257_1000819 3300025304 Bacteria 45046
156 Ga0207656_10089482 3300025321 Bacteria 1395
157 Ga0207680_10009375 3300025903 Bacteria 4854
158 Ga0207647_10189603 3300025904 Bacteria 1192
159 Ga0207705_10000255 3300025909 Bacteria 51846
160 Ga0207705_10484470 3300025909 Bacteria 960
161 Ga0207654_10013858 3300025911 Bacteria 4154
162 Ga0207695_10200901 3300025913 Bacteria 1908
163 Ga0207695_10250604 3300025913 Bacteria 1670
164 Ga0207671_10169107 3300025914 Bacteria 1697
165 Ga0207657_10095853 3300025919 Bacteria 2468
166 Ga0207657_10439474 3300025919 Bacteria 1024
167 Ga0207649_10079393 3300025920 Bacteria 2120
168 Ga0207646_10072838 3300025922 Bacteria 3068
169 Ga0207694_10005275 3300025924 Bacteria 9958
170 Ga0207694_10039046 3300025924 Bacteria 3652
171 Ga0207650_10000136 3300025925 Bacteria 89925
172 Ga0207650_10001166 3300025925 Bacteria 19321
173 Ga0207659_10071870 3300025926 Bacteria 2528
174 Ga0207644_10324283 3300025931 Bacteria 1246
175 Ga0207644_10505734 3300025931 Bacteria 997
176 Ga0207690_10000659 3300025932 Bacteria 22104
177 Ga0207706_10018194 3300025933 Bacteria 6322
178 Ga0207709_10000078 3300025935 Bacteria 169141
179 Ga0207669_10000238 3300025937 Bacteria 24974
180 Ga0207665_10023687 3300025939 Bacteria 4043
181 Ga0207689_10207616 3300025942 Bacteria 1618
182 Ga0207667_10000002 3300025949 Bacteria 895662
183 Ga0207667_10144638 3300025949 Bacteria 2448
184 Ga0207651_10055720 3300025960 Bacteria 2717
185 Ga0207668_10015391 3300025972 Bacteria 4752
186 Ga0207668_10031436 3300025972 Bacteria 3496
187 Ga0207640_10068517 3300025981 Bacteria 2378
188 Ga0207658_10001595 3300025986 Bacteria 17495
189 Ga0207703_10002620 3300026035 Bacteria 15521
190 Ga0207639_10006060 3300026041 Bacteria 8206
191 Ga0207678_10177225 3300026067 Bacteria 1820
192 Ga0207702_10038034 3300026078 Bacteria 4030
193 Ga0207702_10128307 3300026078 Bacteria 2279
194 Ga0207641_10001287 3300026088 Bacteria 24937
195 Ga0207641_10038641 3300026088 Bacteria 3990
196 Ga0207648_10083626 3300026089 Bacteria 2783
197 Ga0207676_10003033 3300026095 Bacteria 11983
198 Ga0207674_10079782 3300026116 Bacteria 3276
199 Ga0207675_100192135 3300026118 Bacteria 1958
200 Ga0207683_10000156 3300026121 Bacteria 57349
201 Ga0207698_10001183 3300026142 Bacteria 15223
202 Ga0207698_10083425 3300026142 Bacteria 2586
203 Ga0209389_1000027 3300027296 Bacteria 146917
204 Ga0209371_1000015 3300027312 Bacteria 659640
205 Ga0209371_1014175 3300027312 Bacteria 2196
206 Ga0209589_1000031 3300027357 Bacteria 147054
207 Ga0209489_100057 3300027361 Bacteria 147398
208 Ga0268266_10007475 3300028379 Bacteria 9852
209 Ga0268266_10023648 3300028379 Bacteria 5229
210 Ga0268266_10169048 3300028379 Bacteria 1983
211 Ga0268266_10182372 3300028379 Bacteria 1912
212 Ga0268265_10002514 3300028380 Bacteria 13733
213 Ga0268264_10002490 3300028381 Bacteria 16193
214 Ga0268264_10105632 3300028381 Bacteria 2456
215 Ga0307517_10104391 3300028786 Bacteria 2208
216 Ga0307515_10143070 3300028794 Bacteria 2552
217 Ga0268256_1000324 3300030500 Bacteria 47280
218 Ga0268256_1005993 3300030500 Bacteria 4635
219 Ga0307513_10001504 3300031456 Bacteria 33537
220 Ga0307509_10000086 3300031507 Bacteria 128783
221 Ga0307414_10193845 3300032004 Bacteria 1646
222 Ga0395899_0000003 3300037312 Bacteria 1232684
223 Ga0439465_0043022 3300041413 Bacteria 1465
224 Ga0451835_0893032 3300041492 Bacteria 1160
225 Ga0439431_0058626 3300041997 Bacteria 1009
226 Ga0439445_0036415 3300042004 Bacteria 1295
227 Ga0439448_0008067 3300042005 Bacteria 3073
228 Ga0439452_000022 3300042010 Bacteria 267565
229 Ga0439455_0005332 3300042012 Bacteria 2605
230 Ga0466972_0161740 3300044658 Bacteria 1052
231 Ga0466965_0037124 3300044683 Bacteria 2392
232 Ga0466959_0061201 3300045049 Bacteria 2738
233 Ga0495590_0120159 3300046457 Bacteria 941
234 Ga0495629_0006093 3300046459 Bacteria 8962
235 Ga0495638_0000888 3300046460 Bacteria 30663
236 Ga0495638_0001078 3300046460 Bacteria 26592
237 Ga0495650_0002165 3300046471 Bacteria 16634
238 Ga0495580_0001394 3300046472 Bacteria 21196
239 Ga0495584_0171698 3300046491 Bacteria 1102
240 Ga0495585_0001335 3300046492 Bacteria 19595
241 Ga0495607_0011065 3300046501 Bacteria 6023
242 Ga0495583_0004259 3300046506 Bacteria 10376
243 Ga0495583_0015723 3300046506 Bacteria 4100
244 Ga0495606_0000092 3300046507 Bacteria 152369
245 Ga0495606_0085315 3300046507 Bacteria 1953
246 Ga0495610_0000155 3300046512 Bacteria 76519
247 Ga0495620_0020011 3300046515 Bacteria 3277
248 Ga0495631_0031786 3300046518 Bacteria 2383
249 Ga0495631_0039854 3300046518 Bacteria 2082
250 Ga0495631_0182963 3300046518 Bacteria 898
251 Ga0495632_0062760 3300046519 Bacteria 1801
252 Ga0495643_0002763 3300046522 Bacteria 13425
253 Ga0495643_0004598 3300046522 Bacteria 9604
254 Ga0495643_0110308 3300046522 Bacteria 1399
255 Ga0495648_0000097 3300046524 Bacteria 109887
256 Ga0495648_0026847 3300046524 Bacteria 3867
257 Ga0495633_0008874 3300046558 Bacteria 5609
258 Ga0495668_0000056 3300046616 Bacteria 197862
259 Ga0495668_0341319 3300046616 Bacteria 822
260 Ga0495625_0000233 3300046660 Bacteria 86941
261 Ga0495625_0006280 3300046660 Bacteria 10628
262 Ga0495669_0000011 3300046684 Bacteria 158720
263 Ga0495670_0000225 3300046691 Bacteria 25665
264 Ga0495670_0237578 3300046691 Bacteria 970
265 Ga0495671_0191597 3300046692 Bacteria 993
266 Ga0495649_0000819 3300046694 Bacteria 25046
267 Ga0495660_0122964 3300046810 Bacteria 1311
268 Ga0495660_0135987 3300046810 Bacteria 1228
269 Ga0495660_0190640 3300046810 Bacteria 985
270 Ga0495672_0001583 3300047320 Bacteria 22217
271 Ga0495672_0037596 3300047320 Bacteria 2960
272 Ga0495683_0005225 3300047323 Bacteria 7219
273 Ga0495683_0024776 3300047323 Bacteria 3078
274 Ga0495687_000077 3300047443 Bacteria 148889
275 Ga0495687_000225 3300047443 Bacteria 79469
276 Ga0495687_009349 3300047443 Bacteria 5488
277 Ga0495677_0052993 3300047445 Bacteria 1495
278 Ga0495679_004315 3300047446 Bacteria 6593
279 Ga0495673_0029563 3300047469 Bacteria 2585
280 Ga0495681_0000976 3300047470 Bacteria 21853
281 Ga0495681_0001630 3300047470 Bacteria 16673
282 Ga0495681_0054065 3300047470 Bacteria 1878
283 Ga0496100_0000233 3300048903 Bacteria 29397
284 Ga0496101_0000128 3300048904 Bacteria 70627
285 Ga0496102_0000057 3300048905 Bacteria 171634
286 Ga0496102_0165406 3300048905 Bacteria 2081
287 Ga0496102_0306937 3300048905 Bacteria 1495
288 Ga0496103_0001004 3300048906 Bacteria 19748
289 Ga0496104_0007719 3300048907 Bacteria 9528
290 Ga0496106_0040019 3300048909 Bacteria 3510
291 Ga0496107_0043361 3300048910 Bacteria 3232
292 Ga0496107_0068788 3300048910 Bacteria 2570
293 Ga0496110_0439466 3300048913 Bacteria 1189
294 Ga0496111_0001636 3300048914 Bacteria 12984
295 Ga0496111_0337325 3300048914 Bacteria 1116
296 Ga0496112_0121414 3300048915 Bacteria 2583
297 Ga0496114_0448206 3300048917 Bacteria 1143
298 Ga0496115_0180243 3300048918 Bacteria 1747
299 Ga0496115_0319563 3300048918 Bacteria 1270
300 Ga0496116_0003712 3300048919 Bacteria 14931
301 Ga0496116_0030489 3300048919 Bacteria 3873
302 Ga0496116_0034552 3300048919 Bacteria 3565
303 Ga0496117_0000118 3300048920 Bacteria 173803
304 Ga0496117_0000625 3300048920 Bacteria 57268
305 Ga0496117_0001973 3300048920 Bacteria 27282
306 Ga0496117_0103967 3300048920 Bacteria 1789
307 Ga0496117_0123803 3300048920 Bacteria 1582
308 Ga0496118_0000068 3300048921 Bacteria 204242
309 Ga0496118_0015560 3300048921 Bacteria 7035
310 Ga0496118_0045389 3300048921 Bacteria 3431
311 Ga0496118_0134940 3300048921 Bacteria 1577
312 Ga0496118_0212605 3300048921 Bacteria 1133
313 Ga0496119_0000658 3300048922 Bacteria 46352
314 Ga0496119_0001511 3300048922 Bacteria 27813
315 Ga0496119_0017500 3300048922 Bacteria 5387
316 Ga0496119_0226137 3300048922 Bacteria 955
317 Ga0496119_0257834 3300048922 Bacteria 876
318 Ga0496120_0002375 3300048923 Bacteria 19212
319 Ga0496120_0050812 3300048923 Bacteria 2371
320 Ga0496121_0000138 3300048924 Bacteria 163543
321 Ga0496121_0000489 3300048924 Bacteria 76115
322 Ga0496121_0000820 3300048924 Bacteria 56712
323 Ga0496121_0005045 3300048924 Bacteria 17248
324 Ga0496121_0150701 3300048924 Bacteria 1711
325 Ga0496121_0319216 3300048924 Bacteria 1046
326 Ga0496122_0004562 3300048925 Bacteria 17076
327 Ga0496122_0005903 3300048925 Bacteria 14340
328 Ga0496122_0041020 3300048925 Bacteria 3669
329 Ga0496122_0065271 3300048925 Bacteria 2641
330 Ga0496122_0086561 3300048925 Bacteria 2156
331 Ga0496122_0100719 3300048925 Bacteria 1932
332 Ga0496123_0000517 3300048926 Bacteria 67322
333 Ga0496123_0002042 3300048926 Bacteria 26076
334 Ga0496123_0005810 3300048926 Bacteria 12244
335 Ga0496123_0027455 3300048926 Bacteria 4239
336 Ga0496123_0177984 3300048926 Bacteria 1114
337 Ga0496124_0000045 3300048927 Bacteria 287396
338 Ga0496124_0001655 3300048927 Bacteria 31821
339 Ga0496124_0054395 3300048927 Bacteria 3388
340 Ga0496125_0015514 3300048928 Bacteria 7363
341 Ga0496125_0048968 3300048928 Bacteria 3517
342 Ga0496125_0049087 3300048928 Bacteria 3510
343 Ga0496125_0088040 3300048928 Bacteria 2342
344 Ga0496125_0196745 3300048928 Bacteria 1325
345 Ga0496126_0004101 3300048929 Bacteria 17637
346 Ga0496126_0009551 3300048929 Bacteria 10291
347 nmdc:mga03683_111208_c1 3300050489 Bacteria 1211
348 nmdc:mga03683_292386_c1 3300050489 Bacteria 763
349 nmdc:mga00v17_66577_c1 3300050491 Bacteria 2224
350 nmdc:mga0k408_46717_c1 3300050493 Bacteria 2501
351 nmdc:mga06z11_42377_c1 3300050494 Bacteria 2283
352 nmdc:mga06z11_455433_c1 3300050494 Bacteria 773
353 nmdc:mga07m45_154248_c1 3300050496 Bacteria 1332
354 nmdc:mga07m45_249830_c1 3300050496 Bacteria 1032
355 nmdc:mga07m45_6404_c1 3300050496 Bacteria 5947
356 nmdc:mga0sz30_25132_c1 3300050516 Bacteria 2435
357 Ga0500610_0000166 3300053079 Bacteria 19624
358 Ga0500643_000180 3300053087 Bacteria 61907
359 Ga0500643_029527 3300053087 Bacteria 1686
360 Ga0500646_0019087 3300053090 Bacteria 1811
361 Ga0500646_0089359 3300053090 Bacteria 951
362 Ga0500583_0023597 3300053092 Bacteria 2595
363 Ga0500583_0112872 3300053092 Bacteria 1340
364 Ga0500566_0003442 3300053094 Bacteria 9438
365 Ga0500566_0175678 3300053094 Bacteria 1103
366 Ga0500641_0019231 3300053096 Bacteria 2580
367 Ga0500641_0101554 3300053096 Bacteria 1234
368 Ga0500555_010674 3300053103 Bacteria 2636
369 Ga0500556_0000039 3300053104 Bacteria 138158
370 Ga0500556_0006117 3300053104 Bacteria 3413
371 Ga0500562_000414 3300053108 Bacteria 10377
372 Ga0500562_007708 3300053108 Bacteria 2715
373 Ga0500562_016484 3300053108 Bacteria 1901
374 Ga0500562_016912 3300053108 Bacteria 1876
375 Ga0500562_043920 3300053108 Bacteria 1190
376 Ga0500572_017672 3300053111 Bacteria 1835
377 Ga0500608_084760 3300053122 Bacteria 1490
378 Ga0500608_135754 3300053122 Bacteria 1097
379 Ga0500618_000247 3300053125 Bacteria 43001
380 Ga0500642_0012491 3300053130 Bacteria 3083
381 Ga0500642_0077072 3300053130 Bacteria 1525
382 Ga0500652_054376 3300053131 Bacteria 1639
383 Ga0500652_061895 3300053131 Bacteria 1542
384 Ga0500559_0002289 3300053136 Bacteria 10071
385 Ga0500568_0001422 3300053139 Bacteria 15533
386 Ga0500568_0020378 3300053139 Bacteria 2869
387 Ga0500568_0031146 3300053139 Bacteria 2203
388 Ga0500573_0021206 3300053140 Bacteria 3722
389 Ga0500590_144951 3300053148 Bacteria 1079
390 Ga0500616_0137148 3300053153 Bacteria 1148
391 Ga0500622_0011248 3300053156 Bacteria 4882
392 Ga0500622_0061148 3300053156 Bacteria 1920
393 Ga0500627_0164319 3300053158 Bacteria 1001
394 Ga0500633_0012743 3300053160 Bacteria 2333
395 Ga0500636_0001537 3300053177 Bacteria 12565
396 Ga0500636_0005096 3300053177 Bacteria 7460
397 Ga0500636_0005308 3300053177 Bacteria 7346
398 Ga0500637_0151032 3300053178 Bacteria 1342
399 Ga0500625_013951 3300053729 Bacteria 3704
400 Ga0500645_055703 3300053730 Bacteria 1148
401 Ga0500645_069808 3300053730 Bacteria 1009
402 Ga0500601_000170 3300053737 Bacteria 13475
403 Ga0500661_003202 3300055283 Bacteria 3080

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048918 Ga0496115_0319563 Ga0496115_0319563_90_800 204
2 3300053140 Ga0500573_0021206 Ga0500573_0021206_170_904 218
3 3300053087 Ga0500643_029527 Ga0500643_029527_903_1652 222
4 3300025206 Ga0209435_102130 Ga0209435_1021302 223
5 3300048918 Ga0496115_0180243 Ga0496115_0180243_496_1248 228
6 3300048924 Ga0496121_0000489 Ga0496121_0000489_10435_11187 228
7 3300048929 Ga0496126_0004101 Ga0496126_0004101_10483_11235 228
8 3300046810 Ga0495660_0122964 Ga0495660_0122964_584_1291 235
9 3300050489 nmdc:mga03683_292386_c1 nmdc:mga03683_292386_c1_27_734 235
10 iso_pu_bacteria 2599185236 2599722861 239
11 iso_pu_bacteria 2896384573 2896390951 239
12 iso_pu_bacteria 8054460903 8054465499 239
13 iso_pu_bacteria 8054563764 8054566113 239
14 iso_pu_bacteria 2511231028 2511395717 240
15 iso_pu_bacteria 2513237092 2513627533 240
16 iso_pu_bacteria 2513237094 2513643147 240
17 iso_pu_bacteria 2513237102 2513704019 240
18 iso_pu_bacteria 2513237139 2513874348 240
19 iso_pu_bacteria 2513237144 2513913366 240
20 iso_pu_bacteria 2513237161 2514016840 240
21 iso_pu_bacteria 2513237166 2514053565 240
22 iso_pu_bacteria 2517093001 2517104499 240
23 iso_pu_bacteria 2599185156 2599334420 240
24 iso_pu_bacteria 2599185210 2599605241 240
25 iso_pu_bacteria 2617270735 2617353113 240
26 iso_pu_bacteria 2617270741 2617374556 240
27 iso_pu_bacteria 2643221605 2644038279 240
28 iso_pu_bacteria 2738541317 2738947714 240
29 iso_pu_bacteria 2791355048 2792461756 240
30 iso_pu_bacteria 2791355196 2793059485 240
31 iso_pu_bacteria 2802429603 2805920946 240
32 iso_pu_bacteria 2824600985 2824604508 240
33 iso_pu_bacteria 2824609381 2824614951 240
34 iso_pu_bacteria 2824617872 2824625873 240
35 iso_pu_bacteria 2824626560 2824633018 240
36 iso_pu_bacteria 2824635225 2824642418 240
37 iso_pu_bacteria 2824644064 2824649939 240
38 iso_pu_bacteria 2824653114 2824657525 240
39 iso_pu_bacteria 2824679649 2824687083 240
40 iso_pu_bacteria 2824696289 2824701386 240
41 iso_pu_bacteria 2824704595 2824710137 240
42 iso_pu_bacteria 2824714736 2824719809 240
43 iso_pu_bacteria 2824723954 2824730202 240
44 iso_pu_bacteria 2824732956 2824736041 240
45 iso_pu_bacteria 2824746037 2824750669 240
46 iso_pu_bacteria 2824753945 2824761590 240
47 iso_pu_bacteria 2824763712 2824772100 240
48 iso_pu_bacteria 2824773399 2824778340 240
49 iso_pu_bacteria 2842038055 2842041863 240
50 iso_pu_bacteria 2842045827 2842049906 240
51 iso_pu_bacteria 2843744320 2843745882 240
52 iso_pu_bacteria 2847939898 2847943395 240
53 iso_pu_bacteria 2849076700 2849077116 240
54 iso_pu_bacteria 2849560528 2849562206 240
55 iso_pu_bacteria 2851153111 2851156933 240
56 iso_pu_bacteria 2857509624 2857514588 240
57 iso_pu_bacteria 2874612657 2874614920 240
58 iso_pu_bacteria 2874628541 2874630410 240
59 iso_pu_bacteria 2881364244 2881367524 240
60 iso_pu_bacteria 2881665667 2881669236 240
61 iso_pu_bacteria 2885366525 2885374589 240
62 iso_pu_bacteria 2888419890 2888426763 240
63 iso_pu_bacteria 2898329390 2898330308 240
64 iso_pu_bacteria 2904711408 2904713827 240
65 iso_pu_bacteria 2908775508 2908777034 240
66 iso_pu_bacteria 2913308742 2913311632 240
67 iso_pu_bacteria 2919450847 2919452758 240
68 iso_pu_bacteria 2921643360 2921652897 240
69 iso_pu_bacteria 2922393267 2922393431 240
70 iso_pu_bacteria 2929138655 2929143622 240
71 iso_pu_bacteria 2935608549 2935613333 240
72 iso_pu_bacteria 2935625433 2935626023 240
73 iso_pu_bacteria 2935819856 2935824813 240
74 iso_pu_bacteria 2935847175 2935852033 240
75 iso_pu_bacteria 2939617950 2939618227 240
76 iso_pu_bacteria 2974435778 2974439011 240
77 iso_pu_bacteria 3005483717 3005485892 240
78 iso_pu_bacteria 3005506211 3005506757 240
79 iso_pu_bacteria 3005587118 3005588878 240
80 iso_pu_bacteria 8001845381 8001846889 240
81 iso_pu_bacteria 8005484373 8005486775 240
82 iso_pu_bacteria 8019504834 8019505436 240
83 iso_pu_bacteria 8019648815 8019653513 240
84 iso_pu_bacteria 8054002106 8054005453 240
85 3300045049 Ga0466959_0061201 Ga0466959_0061201_1141_1866 241
86 3300046519 Ga0495632_0062760 Ga0495632_0062760_827_1591 242
87 3300002704 JGI25155J39150_1000004 JGI25155J39150_100000436 243
88 3300002705 JGI25156J39149_1000014 JGI25156J39149_1000014144 243
89 3300002738 JGI25154J39366_1000096 JGI25154J39366_100009646 243
90 3300002741 JGI25157J39369_1000005 JGI25157J39369_1000005227 243
91 3300003187 JGI25151J46595_10048406 JGI25151J46595_100484062 243
92 3300005331 Ga0070670_100000186 Ga0070670_10000018616 243
93 3300005334 Ga0068869_100192283 Ga0068869_1001922832 243
94 3300005563 Ga0068855_100050386 Ga0068855_1000503862 243
95 3300005719 Ga0068861_100107167 Ga0068861_1001071673 243
96 3300005719 Ga0068861_100290303 Ga0068861_1002903031 243
97 3300005841 Ga0068863_100001676 Ga0068863_10000167614 243
98 3300005843 Ga0068860_100464214 Ga0068860_1004642141 243
99 3300006042 Ga0075368_10028265 Ga0075368_100282653 243
100 3300006048 Ga0075363_100007015 Ga0075363_1000070154 243
101 3300006186 Ga0075369_10046656 Ga0075369_100466561 243
102 3300009551 Ga0105238_10012926 Ga0105238_100129266 243
103 3300010375 Ga0105239_10102590 Ga0105239_101025904 243
104 3300025206 Ga0209435_100009 Ga0209435_100009223 243
105 3300025246 Ga0209646_1000018 Ga0209646_1000018223 243
106 3300025250 Ga0209026_1000043 Ga0209026_1000043223 243
107 3300025256 Ga0209759_1000007 Ga0209759_1000007223 243
108 3300025294 Ga0209025_1000180 Ga0209025_1000180134 243
109 3300025297 Ga0209758_1006168 Ga0209758_10061681 243
110 3300025924 Ga0207694_10005275 Ga0207694_100052753 243
111 3300025925 Ga0207650_10001166 Ga0207650_1000116615 243
112 3300025942 Ga0207689_10207616 Ga0207689_102076162 243
113 3300025949 Ga0207667_10144638 Ga0207667_101446382 243
114 3300026088 Ga0207641_10001287 Ga0207641_1000128713 243
115 3300026118 Ga0207675_100192135 Ga0207675_1001921352 243
116 3300028381 Ga0268264_10105632 Ga0268264_101056324 243
117 3300031507 Ga0307509_10000086 Ga0307509_1000008666 243
118 3300041492 Ga0451835_0893032 Ga0451835_0893032_370_1116 243
119 3300046471 Ga0495650_0002165 Ga0495650_0002165_1469_2260 243
120 3300046512 Ga0495610_0000155 Ga0495610_0000155_75374_76147 243
121 3300046515 Ga0495620_0020011 Ga0495620_0020011_1679_2452 243
122 3300046691 Ga0495670_0000225 Ga0495670_0000225_15161_15919 243
123 3300047320 Ga0495672_0001583 Ga0495672_0001583_17441_18193 243
124 3300047323 Ga0495683_0024776 Ga0495683_0024776_2143_2916 243
125 3300047470 Ga0495681_0001630 Ga0495681_0001630_14397_15188 243
126 3300048913 Ga0496110_0439466 Ga0496110_0439466_357_1136 243
127 3300048914 Ga0496111_0001636 Ga0496111_0001636_402_1181 243
128 3300048925 Ga0496122_0004562 Ga0496122_0004562_14401_15147 243
129 3300048925 Ga0496122_0100719 Ga0496122_0100719_525_1298 243
130 3300048926 Ga0496123_0002042 Ga0496123_0002042_16015_16761 243
131 3300048926 Ga0496123_0005810 Ga0496123_0005810_147_926 243
132 3300048927 Ga0496124_0054395 Ga0496124_0054395_984_1763 243
133 3300050491 nmdc:mga00v17_66577_c1 nmdc:mga00v17_66577_c1_1417_2163 243
134 3300050496 nmdc:mga07m45_6404_c1 nmdc:mga07m45_6404_c1_3728_4474 243
135 3300050516 nmdc:mga0sz30_25132_c1 nmdc:mga0sz30_25132_c1_1034_1780 243
136 3300053090 Ga0500646_0019087 Ga0500646_0019087_988_1734 243
137 3300053177 Ga0500636_0001537 Ga0500636_0001537_4017_4763 243
138 iso_pu_bacteria 3005416602 3005420267 243
139 iso_pu_bacteria 8005314921 8005317218 243
140 3300001979 JGI24740J21852_10009555 JGI24740J21852_100095555 244
141 3300002773 JGI25152J39213_1000226 JGI25152J39213_100022634 244
142 3300003215 JGI25153J46596_10000112 JGI25153J46596_1000011273 244
143 3300003215 JGI25153J46596_10000865 JGI25153J46596_1000086522 244
144 3300003316 rootH1_10022060 rootH1_100220604 244
145 3300003320 rootH2_10188379 rootH2_101883794 244
146 3300003322 rootL2_10031680 rootL2_100316804 244
147 3300003323 rootH1_10096888 rootH1_100968888 244
148 3300003354 JGI25160J50197_1000036 JGI25160J50197_100003634 244
149 3300003354 JGI25160J50197_1000678 JGI25160J50197_10006782 244
150 3300003354 JGI25160J50197_1007982 JGI25160J50197_10079825 244
151 3300003794 Ga0055531_10037065 Ga0055531_100370651 244
152 3300003856 Ga0058692_1000675 Ga0058692_10006753 244
153 3300003856 Ga0058692_1005971 Ga0058692_10059712 244
154 3300004625 Ga0055543_1007336 Ga0055543_10073361 244
155 3300005262 Ga0065165_1000374 Ga0065165_100037412 244
156 3300005262 Ga0065165_1001685 Ga0065165_100168526 244
157 3300005262 Ga0065165_1027049 Ga0065165_10270493 244
158 3300005327 Ga0070658_10003338 Ga0070658_100033385 244
159 3300005327 Ga0070658_10528540 Ga0070658_105285401 244
160 3300005331 Ga0070670_100004214 Ga0070670_1000042147 244
161 3300005339 Ga0070660_100083950 Ga0070660_1000839502 244
162 3300005339 Ga0070660_100324701 Ga0070660_1003247012 244
163 3300005344 Ga0070661_100109537 Ga0070661_1001095373 244
164 3300005347 Ga0070668_100006094 Ga0070668_1000060948 244
165 3300005355 Ga0070671_100436925 Ga0070671_1004369252 244
166 3300005355 Ga0070671_100558120 Ga0070671_1005581201 244
167 3300005356 Ga0070674_100001650 Ga0070674_1000016508 244
168 3300005364 Ga0070673_100183779 Ga0070673_1001837792 244
169 3300005366 Ga0070659_100052238 Ga0070659_1000522385 244
170 3300005367 Ga0070667_100002674 Ga0070667_10000267413 244
171 3300005445 Ga0070708_100023730 Ga0070708_1000237304 244
172 3300005455 Ga0070663_100139310 Ga0070663_1001393102 244
173 3300005455 Ga0070663_100183606 Ga0070663_1001836061 244
174 3300005456 Ga0070678_100000022 Ga0070678_10000002211 244
175 3300005457 Ga0070662_100082833 Ga0070662_1000828333 244
176 3300005459 Ga0068867_100017372 Ga0068867_1000173722 244
177 3300005468 Ga0070707_100073274 Ga0070707_1000732742 244
178 3300005471 Ga0070698_100152085 Ga0070698_1001520853 244
179 3300005518 Ga0070699_100080109 Ga0070699_1000801091 244
180 3300005536 Ga0070697_100195533 Ga0070697_1001955333 244
181 3300005539 Ga0068853_100124891 Ga0068853_1001248912 244
182 3300005548 Ga0070665_100013988 Ga0070665_1000139884 244
183 3300005548 Ga0070665_100019272 Ga0070665_1000192724 244
184 3300005548 Ga0070665_100055240 Ga0070665_1000552406 244
185 3300005548 Ga0070665_100204114 Ga0070665_1002041142 244
186 3300005548 Ga0070665_100264172 Ga0070665_1002641722 244
187 3300005548 Ga0070665_100456799 Ga0070665_1004567991 244
188 3300005563 Ga0068855_100154969 Ga0068855_1001549693 244
189 3300005578 Ga0068854_100092288 Ga0068854_1000922883 244
190 3300005614 Ga0068856_100143021 Ga0068856_1001430213 244
191 3300005614 Ga0068856_100145750 Ga0068856_1001457502 244
192 3300005616 Ga0068852_100056624 Ga0068852_1000566244 244
193 3300005616 Ga0068852_100147303 Ga0068852_1001473033 244
194 3300005617 Ga0068859_100054032 Ga0068859_1000540322 244
195 3300005618 Ga0068864_100004050 Ga0068864_1000040507 244
196 3300005834 Ga0068851_10018172 Ga0068851_100181724 244
197 3300005841 Ga0068863_100232006 Ga0068863_1002320061 244
198 3300005842 Ga0068858_100005830 Ga0068858_1000058307 244
199 3300005843 Ga0068860_100012551 Ga0068860_1000125518 244
200 3300005844 Ga0068862_100010271 Ga0068862_1000102718 244
201 3300006048 Ga0075363_100215876 Ga0075363_1002158762 244
202 3300006051 Ga0075364_10330845 Ga0075364_103308452 244
203 3300006051 Ga0075364_10446316 Ga0075364_104463161 244
204 3300006177 Ga0075362_10144434 Ga0075362_101444342 244
205 3300006178 Ga0075367_10022372 Ga0075367_100223722 244
206 3300006178 Ga0075367_10220128 Ga0075367_102201281 244
207 3300006186 Ga0075369_10099709 Ga0075369_100997091 244
208 3300006195 Ga0075366_10009763 Ga0075366_100097631 244
209 3300006353 Ga0075370_10281680 Ga0075370_102816802 244
210 3300006358 Ga0068871_100003935 Ga0068871_1000039352 244
211 3300006931 Ga0097620_100054030 Ga0097620_1000540302 244
212 3300006942 Ga0099824_1008099 Ga0099824_10080992 244
213 3300009011 Ga0105251_10086183 Ga0105251_100861831 244
214 3300009093 Ga0105240_10257895 Ga0105240_102578953 244
215 3300009093 Ga0105240_10297118 Ga0105240_102971182 244
216 3300009101 Ga0105247_10024463 Ga0105247_100244631 244
217 3300009148 Ga0105243_10000223 Ga0105243_1000022329 244
218 3300009148 Ga0105243_10155160 Ga0105243_101551603 244
219 3300009174 Ga0105241_10011419 Ga0105241_100114194 244
220 3300009177 Ga0105248_10032259 Ga0105248_100322594 244
221 3300009545 Ga0105237_10369241 Ga0105237_103692413 244
222 3300009551 Ga0105238_10106027 Ga0105238_101060274 244
223 3300009551 Ga0105238_10526269 Ga0105238_105262691 244
224 3300009553 Ga0105249_10005246 Ga0105249_100052466 244
225 3300010159 Ga0099796_10003026 Ga0099796_100030263 244
226 3300010159 Ga0099796_10119748 Ga0099796_101197481 244
227 3300010375 Ga0105239_10023543 Ga0105239_100235435 244
228 3300010375 Ga0105239_10148774 Ga0105239_101487742 244
229 3300011119 Ga0105246_10050809 Ga0105246_100508092 244
230 3300013100 Ga0157373_10023060 Ga0157373_100230605 244
231 3300013102 Ga0157371_10000029 Ga0157371_10000029200 244
232 3300013102 Ga0157371_10068686 Ga0157371_100686862 244
233 3300013104 Ga0157370_10126983 Ga0157370_101269834 244
234 3300013105 Ga0157369_10002958 Ga0157369_100029584 244
235 3300013105 Ga0157369_10046890 Ga0157369_100468905 244
236 3300013306 Ga0163162_10074102 Ga0163162_100741023 244
237 3300013306 Ga0163162_10117567 Ga0163162_101175673 244
238 3300013307 Ga0157372_10000543 Ga0157372_1000054326 244
239 3300013307 Ga0157372_10299890 Ga0157372_102998902 244
240 3300014325 Ga0163163_10305369 Ga0163163_103053692 244
241 3300014325 Ga0163163_11013189 Ga0163163_110131891 244
242 3300014968 Ga0157379_10017035 Ga0157379_100170354 244
243 3300014969 Ga0157376_10008238 Ga0157376_100082384 244
244 3300021320 Ga0214544_1000003 Ga0214544_1000003555 244
245 3300021320 Ga0214544_1023028 Ga0214544_10230281 244
246 3300021321 Ga0214542_1000022 Ga0214542_1000022125 244
247 3300021324 Ga0214545_1000010 Ga0214545_100001058 244
248 3300021324 Ga0214545_1015611 Ga0214545_101561113 244
249 3300021324 Ga0214545_1021510 Ga0214545_10215101 244
250 3300021327 Ga0214543_1000035 Ga0214543_1000035125 244
251 3300025245 Ga0207425_1005796 Ga0207425_10057962 244
252 3300025253 Ga0209677_103195 Ga0209677_1031952 244
253 3300025258 Ga0209129_1000077 Ga0209129_1000077128 244
254 3300025261 Ga0209233_1011229 Ga0209233_10112292 244
255 3300025261 Ga0209233_1011518 Ga0209233_10115182 244
256 3300025273 Ga0209673_1038497 Ga0209673_10384972 244
257 3300025284 Ga0209130_1010090 Ga0209130_10100901 244
258 3300025295 Ga0209564_1001948 Ga0209564_100194816 244
259 3300025297 Ga0209758_1000023 Ga0209758_1000023353 244
260 3300025297 Ga0209758_1000106 Ga0209758_100010647 244
261 3300025297 Ga0209758_1011783 Ga0209758_10117831 244
262 3300025297 Ga0209758_1064513 Ga0209758_10645132 244
263 3300025299 Ga0209256_1003353 Ga0209256_10033532 244
264 3300025299 Ga0209256_1016943 Ga0209256_10169433 244
265 3300025302 Ga0207426_1000014 Ga0207426_1000014313 244
266 3300025302 Ga0207426_1000819 Ga0207426_100081925 244
267 3300025302 Ga0207426_1024874 Ga0207426_10248743 244
268 3300025302 Ga0207426_1058710 Ga0207426_10587102 244
269 3300025302 Ga0207426_1061152 Ga0207426_10611521 244
270 3300025304 Ga0209257_1000819 Ga0209257_100081940 244
271 3300025321 Ga0207656_10089482 Ga0207656_100894823 244
272 3300025903 Ga0207680_10009375 Ga0207680_100093752 244
273 3300025904 Ga0207647_10189603 Ga0207647_101896032 244
274 3300025909 Ga0207705_10000255 Ga0207705_1000025512 244
275 3300025909 Ga0207705_10484470 Ga0207705_104844701 244
276 3300025911 Ga0207654_10013858 Ga0207654_100138584 244
277 3300025913 Ga0207695_10200901 Ga0207695_102009013 244
278 3300025913 Ga0207695_10250604 Ga0207695_102506043 244
279 3300025914 Ga0207671_10169107 Ga0207671_101691073 244
280 3300025919 Ga0207657_10095853 Ga0207657_100958532 244
281 3300025919 Ga0207657_10439474 Ga0207657_104394741 244
282 3300025920 Ga0207649_10079393 Ga0207649_100793933 244
283 3300025922 Ga0207646_10072838 Ga0207646_100728382 244
284 3300025924 Ga0207694_10039046 Ga0207694_100390463 244
285 3300025925 Ga0207650_10000136 Ga0207650_1000013689 244
286 3300025926 Ga0207659_10071870 Ga0207659_100718702 244
287 3300025931 Ga0207644_10324283 Ga0207644_103242832 244
288 3300025931 Ga0207644_10505734 Ga0207644_105057341 244
289 3300025932 Ga0207690_10000659 Ga0207690_1000065925 244
290 3300025933 Ga0207706_10018194 Ga0207706_100181944 244
291 3300025935 Ga0207709_10000078 Ga0207709_1000007829 244
292 3300025937 Ga0207669_10000238 Ga0207669_1000023819 244
293 3300025939 Ga0207665_10023687 Ga0207665_100236874 244
294 3300025949 Ga0207667_10000002 Ga0207667_10000002691 244
295 3300025960 Ga0207651_10055720 Ga0207651_100557202 244
296 3300025972 Ga0207668_10015391 Ga0207668_100153914 244
297 3300025972 Ga0207668_10031436 Ga0207668_100314361 244
298 3300025981 Ga0207640_10068517 Ga0207640_100685174 244
299 3300025986 Ga0207658_10001595 Ga0207658_100015955 244
300 3300026035 Ga0207703_10002620 Ga0207703_1000262011 244
301 3300026041 Ga0207639_10006060 Ga0207639_100060607 244
302 3300026067 Ga0207678_10177225 Ga0207678_101772253 244
303 3300026078 Ga0207702_10038034 Ga0207702_100380344 244
304 3300026078 Ga0207702_10128307 Ga0207702_101283073 244
305 3300026088 Ga0207641_10038641 Ga0207641_100386414 244
306 3300026089 Ga0207648_10083626 Ga0207648_100836264 244
307 3300026095 Ga0207676_10003033 Ga0207676_100030338 244
308 3300026116 Ga0207674_10079782 Ga0207674_100797825 244
309 3300026121 Ga0207683_10000156 Ga0207683_1000015650 244
310 3300026142 Ga0207698_10001183 Ga0207698_1000118315 244
311 3300026142 Ga0207698_10083425 Ga0207698_100834254 244
312 3300027296 Ga0209389_1000027 Ga0209389_10000272 244
313 3300027312 Ga0209371_1000015 Ga0209371_100001538 244
314 3300027312 Ga0209371_1014175 Ga0209371_10141751 244
315 3300027357 Ga0209589_1000031 Ga0209589_100003114 244
316 3300027361 Ga0209489_100057 Ga0209489_100057133 244
317 3300028379 Ga0268266_10007475 Ga0268266_100074757 244
318 3300028379 Ga0268266_10023648 Ga0268266_100236486 244
319 3300028379 Ga0268266_10169048 Ga0268266_101690482 244
320 3300028379 Ga0268266_10182372 Ga0268266_101823722 244
321 3300028380 Ga0268265_10002514 Ga0268265_100025148 244
322 3300028381 Ga0268264_10002490 Ga0268264_1000249015 244
323 3300028786 Ga0307517_10104391 Ga0307517_101043913 244
324 3300028794 Ga0307515_10143070 Ga0307515_101430703 244
325 3300030500 Ga0268256_1000324 Ga0268256_100032413 244
326 3300030500 Ga0268256_1005993 Ga0268256_10059935 244
327 3300031456 Ga0307513_10001504 Ga0307513_1000150420 244
328 3300032004 Ga0307414_10193845 Ga0307414_101938452 244
329 3300037312 Ga0395899_0000003 Ga0395899_0000003_784177_784911 244
330 3300041413 Ga0439465_0043022 Ga0439465_0043022_181_930 244
331 3300041997 Ga0439431_0058626 Ga0439431_0058626_25_774 244
332 3300042004 Ga0439445_0036415 Ga0439445_0036415_517_1266 244
333 3300042005 Ga0439448_0008067 Ga0439448_0008067_1027_1761 244
334 3300042010 Ga0439452_000022 Ga0439452_000022_12609_13358 244
335 3300042012 Ga0439455_0005332 Ga0439455_0005332_1155_1889 244
336 3300044658 Ga0466972_0161740 Ga0466972_0161740_29_778 244
337 3300044683 Ga0466965_0037124 Ga0466965_0037124_237_986 244
338 3300046457 Ga0495590_0120159 Ga0495590_0120159_143_892 244
339 3300046459 Ga0495629_0006093 Ga0495629_0006093_2146_2895 244
340 3300046460 Ga0495638_0000888 Ga0495638_0000888_18858_19607 244
341 3300046460 Ga0495638_0001078 Ga0495638_0001078_19766_20515 244
342 3300046472 Ga0495580_0001394 Ga0495580_0001394_1259_2008 244
343 3300046491 Ga0495584_0171698 Ga0495584_0171698_10_759 244
344 3300046492 Ga0495585_0001335 Ga0495585_0001335_13254_13988 244
345 3300046501 Ga0495607_0011065 Ga0495607_0011065_683_1441 244
346 3300046506 Ga0495583_0004259 Ga0495583_0004259_6730_7479 244
347 3300046506 Ga0495583_0015723 Ga0495583_0015723_2466_3200 244
348 3300046507 Ga0495606_0000092 Ga0495606_0000092_20412_21146 244
349 3300046507 Ga0495606_0085315 Ga0495606_0085315_950_1684 244
350 3300046518 Ga0495631_0031786 Ga0495631_0031786_864_1598 244
351 3300046518 Ga0495631_0039854 Ga0495631_0039854_394_1128 244
352 3300046518 Ga0495631_0182963 Ga0495631_0182963_44_793 244
353 3300046522 Ga0495643_0002763 Ga0495643_0002763_8533_9267 244
354 3300046522 Ga0495643_0004598 Ga0495643_0004598_4199_4933 244
355 3300046522 Ga0495643_0110308 Ga0495643_0110308_371_1105 244
356 3300046524 Ga0495648_0000097 Ga0495648_0000097_19464_20198 244
357 3300046524 Ga0495648_0026847 Ga0495648_0026847_2598_3347 244
358 3300046558 Ga0495633_0008874 Ga0495633_0008874_3025_3759 244
359 3300046616 Ga0495668_0000056 Ga0495668_0000056_40713_41447 244
360 3300046616 Ga0495668_0341319 Ga0495668_0341319_66_800 244
361 3300046660 Ga0495625_0000233 Ga0495625_0000233_28729_29478 244
362 3300046660 Ga0495625_0006280 Ga0495625_0006280_403_1137 244
363 3300046684 Ga0495669_0000011 Ga0495669_0000011_26190_26924 244
364 3300046691 Ga0495670_0237578 Ga0495670_0237578_109_843 244
365 3300046692 Ga0495671_0191597 Ga0495671_0191597_52_786 244
366 3300046694 Ga0495649_0000819 Ga0495649_0000819_24131_24892 244
367 3300046810 Ga0495660_0135987 Ga0495660_0135987_288_1037 244
368 3300046810 Ga0495660_0190640 Ga0495660_0190640_166_915 244
369 3300047320 Ga0495672_0037596 Ga0495672_0037596_1106_1855 244
370 3300047323 Ga0495683_0005225 Ga0495683_0005225_4861_5619 244
371 3300047443 Ga0495687_000077 Ga0495687_000077_62638_63372 244
372 3300047443 Ga0495687_000225 Ga0495687_000225_35659_36393 244
373 3300047443 Ga0495687_009349 Ga0495687_009349_2615_3364 244
374 3300047445 Ga0495677_0052993 Ga0495677_0052993_642_1376 244
375 3300047446 Ga0495679_004315 Ga0495679_004315_1640_2374 244
376 3300047469 Ga0495673_0029563 Ga0495673_0029563_101_850 244
377 3300047470 Ga0495681_0000976 Ga0495681_0000976_19403_20152 244
378 3300047470 Ga0495681_0054065 Ga0495681_0054065_529_1263 244
379 3300048903 Ga0496100_0000233 Ga0496100_0000233_902_1651 244
380 3300048904 Ga0496101_0000128 Ga0496101_0000128_23811_24560 244
381 3300048905 Ga0496102_0000057 Ga0496102_0000057_119731_120480 244
382 3300048905 Ga0496102_0165406 Ga0496102_0165406_12_746 244
383 3300048905 Ga0496102_0306937 Ga0496102_0306937_664_1413 244
384 3300048906 Ga0496103_0001004 Ga0496103_0001004_803_1552 244
385 3300048907 Ga0496104_0007719 Ga0496104_0007719_7868_8617 244
386 3300048909 Ga0496106_0040019 Ga0496106_0040019_1731_2480 244
387 3300048910 Ga0496107_0043361 Ga0496107_0043361_2240_2989 244
388 3300048910 Ga0496107_0068788 Ga0496107_0068788_1168_1917 244
389 3300048914 Ga0496111_0337325 Ga0496111_0337325_111_860 244
390 3300048915 Ga0496112_0121414 Ga0496112_0121414_1554_2303 244
391 3300048917 Ga0496114_0448206 Ga0496114_0448206_213_962 244
392 3300048919 Ga0496116_0003712 Ga0496116_0003712_3855_4604 244
393 3300048919 Ga0496116_0030489 Ga0496116_0030489_2835_3584 244
394 3300048919 Ga0496116_0034552 Ga0496116_0034552_530_1279 244
395 3300048920 Ga0496117_0000118 Ga0496117_0000118_120240_120989 244
396 3300048920 Ga0496117_0000625 Ga0496117_0000625_26720_27469 244
397 3300048920 Ga0496117_0001973 Ga0496117_0001973_5506_6240 244
398 3300048920 Ga0496117_0103967 Ga0496117_0103967_310_1059 244
399 3300048920 Ga0496117_0123803 Ga0496117_0123803_668_1417 244
400 3300048921 Ga0496118_0000068 Ga0496118_0000068_119712_120461 244
401 3300048921 Ga0496118_0015560 Ga0496118_0015560_536_1288 244
402 3300048921 Ga0496118_0045389 Ga0496118_0045389_193_927 244
403 3300048921 Ga0496118_0134940 Ga0496118_0134940_407_1156 244
404 3300048921 Ga0496118_0212605 Ga0496118_0212605_158_907 244
405 3300048922 Ga0496119_0000658 Ga0496119_0000658_7620_8369 244
406 3300048922 Ga0496119_0001511 Ga0496119_0001511_6441_7190 244
407 3300048922 Ga0496119_0017500 Ga0496119_0017500_4602_5351 244
408 3300048922 Ga0496119_0226137 Ga0496119_0226137_88_837 244
409 3300048922 Ga0496119_0257834 Ga0496119_0257834_113_862 244
410 3300048923 Ga0496120_0002375 Ga0496120_0002375_1710_2444 244
411 3300048923 Ga0496120_0050812 Ga0496120_0050812_1276_2025 244
412 3300048924 Ga0496121_0000138 Ga0496121_0000138_85708_86466 244
413 3300048924 Ga0496121_0000820 Ga0496121_0000820_24260_25009 244
414 3300048924 Ga0496121_0005045 Ga0496121_0005045_4459_5208 244
415 3300048924 Ga0496121_0150701 Ga0496121_0150701_661_1410 244
416 3300048924 Ga0496121_0319216 Ga0496121_0319216_188_937 244
417 3300048925 Ga0496122_0005903 Ga0496122_0005903_4347_5096 244
418 3300048925 Ga0496122_0041020 Ga0496122_0041020_2535_3284 244
419 3300048925 Ga0496122_0065271 Ga0496122_0065271_1451_2200 244
420 3300048925 Ga0496122_0086561 Ga0496122_0086561_312_1046 244
421 3300048926 Ga0496123_0000517 Ga0496123_0000517_10200_10949 244
422 3300048926 Ga0496123_0027455 Ga0496123_0027455_2778_3527 244
423 3300048926 Ga0496123_0177984 Ga0496123_0177984_168_917 244
424 3300048927 Ga0496124_0000045 Ga0496124_0000045_260408_261157 244
425 3300048927 Ga0496124_0001655 Ga0496124_0001655_17878_18627 244
426 3300048928 Ga0496125_0015514 Ga0496125_0015514_401_1150 244
427 3300048928 Ga0496125_0048968 Ga0496125_0048968_152_901 244
428 3300048928 Ga0496125_0049087 Ga0496125_0049087_160_909 244
429 3300048928 Ga0496125_0088040 Ga0496125_0088040_612_1370 244
430 3300048928 Ga0496125_0196745 Ga0496125_0196745_230_964 244
431 3300048929 Ga0496126_0009551 Ga0496126_0009551_4975_5724 244
432 3300050489 nmdc:mga03683_111208_c1 nmdc:mga03683_111208_c1_212_964 244
433 3300050493 nmdc:mga0k408_46717_c1 nmdc:mga0k408_46717_c1_1620_2369 244
434 3300050494 nmdc:mga06z11_42377_c1 nmdc:mga06z11_42377_c1_442_1191 244
435 3300050494 nmdc:mga06z11_455433_c1 nmdc:mga06z11_455433_c1_14_748 244
436 3300050496 nmdc:mga07m45_154248_c1 nmdc:mga07m45_154248_c1_14_763 244
437 3300050496 nmdc:mga07m45_249830_c1 nmdc:mga07m45_249830_c1_59_808 244
438 3300053079 Ga0500610_0000166 Ga0500610_0000166_4539_5273 244
439 3300053087 Ga0500643_000180 Ga0500643_000180_40916_41665 244
440 3300053090 Ga0500646_0089359 Ga0500646_0089359_101_835 244
441 3300053092 Ga0500583_0023597 Ga0500583_0023597_1753_2502 244
442 3300053092 Ga0500583_0112872 Ga0500583_0112872_571_1305 244
443 3300053094 Ga0500566_0003442 Ga0500566_0003442_7427_8176 244
444 3300053094 Ga0500566_0175678 Ga0500566_0175678_333_1067 244
445 3300053096 Ga0500641_0019231 Ga0500641_0019231_262_996 244
446 3300053096 Ga0500641_0101554 Ga0500641_0101554_101_850 244
447 3300053103 Ga0500555_010674 Ga0500555_010674_1833_2582 244
448 3300053104 Ga0500556_0000039 Ga0500556_0000039_73408_74157 244
449 3300053104 Ga0500556_0006117 Ga0500556_0006117_1567_2316 244
450 3300053108 Ga0500562_000414 Ga0500562_000414_8123_8872 244
451 3300053108 Ga0500562_007708 Ga0500562_007708_1481_2230 244
452 3300053108 Ga0500562_016484 Ga0500562_016484_907_1641 244
453 3300053108 Ga0500562_016912 Ga0500562_016912_1020_1754 244
454 3300053108 Ga0500562_043920 Ga0500562_043920_366_1100 244
455 3300053111 Ga0500572_017672 Ga0500572_017672_1032_1781 244
456 3300053122 Ga0500608_084760 Ga0500608_084760_381_1130 244
457 3300053122 Ga0500608_135754 Ga0500608_135754_37_786 244
458 3300053125 Ga0500618_000247 Ga0500618_000247_18451_19185 244
459 3300053130 Ga0500642_0012491 Ga0500642_0012491_1049_1798 244
460 3300053130 Ga0500642_0077072 Ga0500642_0077072_523_1272 244
461 3300053131 Ga0500652_054376 Ga0500652_054376_181_930 244
462 3300053131 Ga0500652_061895 Ga0500652_061895_93_842 244
463 3300053136 Ga0500559_0002289 Ga0500559_0002289_7862_8611 244
464 3300053139 Ga0500568_0001422 Ga0500568_0001422_2528_3277 244
465 3300053139 Ga0500568_0020378 Ga0500568_0020378_1412_2146 244
466 3300053139 Ga0500568_0031146 Ga0500568_0031146_730_1479 244
467 3300053148 Ga0500590_144951 Ga0500590_144951_173_922 244
468 3300053153 Ga0500616_0137148 Ga0500616_0137148_175_924 244
469 3300053156 Ga0500622_0011248 Ga0500622_0011248_2339_3088 244
470 3300053156 Ga0500622_0061148 Ga0500622_0061148_181_930 244
471 3300053158 Ga0500627_0164319 Ga0500627_0164319_12_761 244
472 3300053160 Ga0500633_0012743 Ga0500633_0012743_1272_2021 244
473 3300053177 Ga0500636_0005096 Ga0500636_0005096_668_1402 244
474 3300053177 Ga0500636_0005308 Ga0500636_0005308_636_1385 244
475 3300053178 Ga0500637_0151032 Ga0500637_0151032_571_1320 244
476 3300053729 Ga0500625_013951 Ga0500625_013951_2107_2856 244
477 3300053730 Ga0500645_055703 Ga0500645_055703_131_880 244
478 3300053730 Ga0500645_069808 Ga0500645_069808_92_841 244
479 3300053737 Ga0500601_000170 Ga0500601_000170_5799_6548 244
480 3300055283 Ga0500661_003202 Ga0500661_003202_317_1051 244
481 iso_pu_bacteria 2935908558 2935911380 244
482 iso_pu_bacteria 2935916978 2935920913 244
483 iso_pu_bacteria 2935926038 2935928409 244
484 iso_pu_bacteria 2935934488 2935938054 244
485 iso_pu_bacteria 2935942939 2935945336 244
486 iso_pu_bacteria 2935951376 2935954158 244
487 iso_pu_bacteria 2935967501 2935971574 244
488 iso_pu_bacteria 8019687851 8019695146 244

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

20

206

0.98

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

19

260

0.94

PF08659

KR

KR domain

20

194

0.9

PF23441

14

262

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
4i5d-assembly1.cif.gz_A crystal structure of ralstonia sp. alcohol dehydrogenase in its apo form 0.9831 1 244
4i5f-assembly1.cif.gz_A crystal structure of ralstonia sp. alcohol dehydrogenase mutant n15g, g37d, r38v, r39s 0.9824 1 244
4fgs-assembly1.cif.gz_B crystal structure of a probable dehydrogenase protein 0.9819 1 244
4bmn-assembly1.cif.gz_D apo structure of short-chain alcohol dehydrogenase from ralstonia sp. dsm 6428 0.9816 1 244
6ihi-assembly1.cif.gz_D crystal structure of rasadh 3b3/i91v from ralstonia.sp in complex with nadph and a6o 0.9799 1 244
ID Description Score Start End Superfamily
4bmnA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9701 1 244 3.40.50.720
af_Q6PKH6_18_219_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9655 2 179 3.40.50.720
5itvA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9624 1 241 3.40.50.720
af_A0A0P0Y501_3_211_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9593 4 190 3.40.50.720
af_Q0JBH4_12_100_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9572 7 84 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A4R2TJT2-F1-model_v4 NAD(P)-dependent dehydrogenase (Short-subunit alcohol dehydrogenase family) 0.9913 1 244 GO:0050664
AF-A0A2R7KXK9-F1-model_v4 deleted 0.9912 1 168
AF-A0A559M2Z8-F1-model_v4 Putative oxidoreductase 0.9879 3 151 GO:0016491
AF-A0A2V6STH1-F1-model_v4 Oxidoreductase 0.9867 1 182 GO:0016491
AF-A0A2R7KXK9-F1-model_v4 deleted 0.9854 1 168

Feature Viewer

pLDDT pTM Quality
94.06 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map