F453514

General Info

Members Datasets Scaffolds Average Seq Length
487 278 974 153

Family's Representative Sequence

Representative Sequence 3300053139|Ga0500568_0086177|Ga0500568_0086177_210_773
Length 187
Sequence MLIRSGGTAEQGHDQSWLSGHQGWLKSGPESGGDENMSGETVDAIGIHEILAALPHRYPFLMIDKVIDIRGDEHGIGIKNVTANEPQFLGHFPGTPVMPGVLMLEGMAQTAGVICIRAMPGEIKPTLVYFLTIDKAKFRKPVIPGDRVEYHMTRLKRRKNMWWFRGEAKVDGEVVAEAELGAMIAEA

Samples

Sample ID Description Type Environment
1 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
46 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
47 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
48 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
49 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
50 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
51 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
52 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
53 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
54 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
55 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
56 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
57 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
58 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
90 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
91 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
92 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
93 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
130 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
131 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
134 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
135 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
136 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
137 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
138 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
139 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
140 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
141 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
142 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
143 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
144 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
145 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
146 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
147 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
148 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
149 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
150 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
151 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
152 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
153 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
154 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
155 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
156 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
157 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
158 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
159 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
160 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
161 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
162 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
163 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
164 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
165 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
166 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
167 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
168 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
169 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
170 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
171 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
172 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
173 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
174 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
175 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
176 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
177 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
178 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
179 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
180 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
181 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
182 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
183 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
184 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
185 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
186 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
187 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
188 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
189 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
190 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
191 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
192 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
193 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
194 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
195 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
196 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
197 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
198 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
199 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
200 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
201 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
202 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
203 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
204 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
205 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
206 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
207 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
208 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
209 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
210 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
211 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
212 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
213 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
228 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
229 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
230 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
231 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
232 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
233 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
234 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
235 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
236 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
237 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
238 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
239 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
240 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
241 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
243 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
244 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
245 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
246 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
247 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
248 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
249 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
250 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
251 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
252 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
253 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
254 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
255 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
256 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
257 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
258 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
259 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
260 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
261 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
262 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
263 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
264 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
265 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
266 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
267 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
268 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
269 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
270 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
271 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
272 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
273 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
274 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
275 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
276 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
277 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
278 8002060224 Methylocystis sp. Sn-Cys Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.79
Metatranscriptomes 0
Isolates 0.21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 21.77
Nodule 0
Rhizoplane 5.95
Rhizosphere 69.82
Stem 0
Stem Tuber 0
Unclassified 0.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500568_0086177 3300053139 Bacteria 1188
2 JGI25153J46596_10003942 3300003215 Bacteria 8131
3 JGI25405J52794_10001905 3300003911 Bacteria 3528
4 JGI25405J52794_10002377 3300003911 Bacteria 3234
5 Ga0070676_10862551 3300005328 Bacteria 672
6 Ga0070683_100897893 3300005329 Bacteria 850
7 Ga0070670_100052222 3300005331 Bacteria 3511
8 Ga0070666_10133497 3300005335 Bacteria 1726
9 Ga0070680_100038590 3300005336 Bacteria 3862
10 Ga0068868_100836471 3300005338 Bacteria 833
11 Ga0070660_101074928 3300005339 Bacteria 681
12 Ga0070689_100037800 3300005340 Bacteria 3692
13 Ga0070689_100839093 3300005340 Bacteria 810
14 Ga0070668_101866051 3300005347 Bacteria 553
15 Ga0070669_100370056 3300005353 Bacteria 1167
16 Ga0070669_100417874 3300005353 Bacteria 1100
17 Ga0070675_100171911 3300005354 Bacteria 1869
18 Ga0070675_100990477 3300005354 Bacteria 772
19 Ga0070671_100001737 3300005355 Bacteria 16535
20 Ga0070671_102049114 3300005355 Bacteria 509
21 Ga0070674_100378659 3300005356 Bacteria 1151
22 Ga0070674_100940148 3300005356 Bacteria 755
23 Ga0070674_101046783 3300005356 Bacteria 718
24 Ga0070673_100098561 3300005364 Bacteria 2403
25 Ga0070688_100507132 3300005365 Bacteria 911
26 Ga0070659_100164841 3300005366 Bacteria 1813
27 Ga0070667_100290528 3300005367 Bacteria 1470
28 Ga0070667_101519423 3300005367 Bacteria 629
29 Ga0070709_10121470 3300005434 Bacteria 1771
30 Ga0070714_100013881 3300005435 Bacteria 6460
31 Ga0070714_100103713 3300005435 Bacteria 2509
32 Ga0070714_100148946 3300005435 Bacteria 2107
33 Ga0070714_100513797 3300005435 Bacteria 1143
34 Ga0070713_100104722 3300005436 Bacteria 2457
35 Ga0070713_100226987 3300005436 Bacteria 1696
36 Ga0070713_100231485 3300005436 Bacteria 1680
37 Ga0070710_10024352 3300005437 Bacteria 3192
38 Ga0070711_100313021 3300005439 Bacteria 1252
39 Ga0070700_101121742 3300005441 Bacteria 653
40 Ga0070663_100997477 3300005455 Bacteria 728
41 Ga0070678_101505519 3300005456 Bacteria 630
42 Ga0070681_10107769 3300005458 Bacteria 2726
43 Ga0068867_100898801 3300005459 Bacteria 797
44 Ga0068867_101499054 3300005459 Bacteria 628
45 Ga0070685_10196049 3300005466 Bacteria 1310
46 Ga0070698_100850576 3300005471 Bacteria 857
47 Ga0070679_100092248 3300005530 Bacteria 3016
48 Ga0070684_100141224 3300005535 Bacteria 2178
49 Ga0070684_100863361 3300005535 Bacteria 847
50 Ga0070672_100293026 3300005543 Bacteria 1378
51 Ga0070686_100061553 3300005544 Bacteria 2426
52 Ga0070686_100875610 3300005544 Bacteria 729
53 Ga0070693_100070183 3300005547 Bacteria 2061
54 Ga0070704_100314243 3300005549 Bacteria 1310
55 Ga0070664_100717116 3300005564 Bacteria 932
56 Ga0070664_100765795 3300005564 Bacteria 901
57 Ga0068852_100661194 3300005616 Bacteria 1053
58 Ga0068866_10350563 3300005718 Bacteria 938
59 Ga0068863_100184223 3300005841 Bacteria 2005
60 Ga0068863_100371379 3300005841 Bacteria 1396
61 Ga0068858_100047262 3300005842 Bacteria 3990
62 Ga0068860_101508854 3300005843 Bacteria 694
63 Ga0081455_10012185 3300005937 Bacteria 8587
64 Ga0081538_10005817 3300005981 Bacteria 10991
65 Ga0081540_1012318 3300005983 Bacteria 5644
66 Ga0081540_1045478 3300005983 Bacteria 2229
67 Ga0081540_1322105 3300005983 Bacteria 530
68 Ga0081539_10119402 3300005985 Bacteria 1312
69 Ga0081539_10122477 3300005985 Bacteria 1289
70 Ga0070717_10035410 3300006028 Bacteria 4041
71 Ga0070717_10070509 3300006028 Bacteria 2913
72 Ga0070717_10204923 3300006028 Bacteria 1729
73 Ga0070717_11218366 3300006028 Bacteria 685
74 Ga0075365_10007450 3300006038 Bacteria 6128
75 Ga0075365_10028039 3300006038 Bacteria 3588
76 Ga0075365_10072053 3300006038 Bacteria 2327
77 Ga0075365_10136629 3300006038 Bacteria 1700
78 Ga0075365_10305586 3300006038 Bacteria 1120
79 Ga0075365_10585376 3300006038 Bacteria 789
80 Ga0075368_10018352 3300006042 Bacteria 2628
81 Ga0075368_10023789 3300006042 Bacteria 2343
82 Ga0075368_10101012 3300006042 Bacteria 1184
83 Ga0075368_10188892 3300006042 Bacteria 869
84 Ga0075363_100016679 3300006048 Bacteria 3631
85 Ga0075363_100096978 3300006048 Bacteria 1629
86 Ga0075364_10145949 3300006051 Bacteria 1593
87 Ga0075364_10200643 3300006051 Bacteria 1352
88 Ga0075364_10253374 3300006051 Bacteria 1196
89 Ga0075364_10402368 3300006051 Bacteria 934
90 Ga0075364_10531780 3300006051 Bacteria 804
91 Ga0075364_10757259 3300006051 Bacteria 662
92 Ga0075364_10780775 3300006051 Bacteria 651
93 Ga0075364_11013389 3300006051 Bacteria 564
94 Ga0070712_100101124 3300006175 Bacteria 2132
95 Ga0070712_100662256 3300006175 Bacteria 888
96 Ga0075362_10100733 3300006177 Bacteria 1350
97 Ga0075362_10201544 3300006177 Bacteria 969
98 Ga0075367_10004822 3300006178 Bacteria 6643
99 Ga0075367_10054481 3300006178 Bacteria 2372
100 Ga0075367_10059089 3300006178 Bacteria 2282
101 Ga0075367_10177980 3300006178 Bacteria 1326
102 Ga0075367_10285448 3300006178 Bacteria 1038
103 Ga0075367_10296685 3300006178 Bacteria 1017
104 Ga0075367_10378644 3300006178 Bacteria 894
105 Ga0075369_10017593 3300006186 Bacteria 2900
106 Ga0075369_10243481 3300006186 Bacteria 834
107 Ga0075369_10384591 3300006186 Bacteria 660
108 Ga0075366_10004461 3300006195 Bacteria 7513
109 Ga0075366_10064352 3300006195 Bacteria 2181
110 Ga0075366_10210188 3300006195 Bacteria 1184
111 Ga0097621_100057176 3300006237 Bacteria 3189
112 Ga0075370_10112576 3300006353 Bacteria 1581
113 Ga0075370_10173034 3300006353 Bacteria 1269
114 Ga0075370_10218786 3300006353 Bacteria 1125
115 Ga0075370_10594194 3300006353 Bacteria 670
116 Ga0068871_100137441 3300006358 Bacteria 2076
117 Ga0075428_100064064 3300006844 Bacteria 4025
118 Ga0075430_101293402 3300006846 Bacteria 600
119 Ga0075431_100006493 3300006847 Bacteria 11609
120 Ga0075431_100061525 3300006847 Bacteria 3874
121 Ga0075431_101132184 3300006847 Bacteria 747
122 Ga0075434_100043949 3300006871 Bacteria 4432
123 Ga0075434_100423953 3300006871 Bacteria 1352
124 Ga0075429_100140500 3300006880 Bacteria 2114
125 Ga0075429_100342618 3300006880 Bacteria 1308
126 Ga0075436_100002989 3300006914 Bacteria 11578
127 Ga0075435_100019092 3300007076 Bacteria 5226
128 Ga0099795_10022276 3300007788 Bacteria 2089
129 Ga0111539_10145691 3300009094 Bacteria 2773
130 Ga0111539_10372375 3300009094 Bacteria 1663
131 Ga0105245_10003204 3300009098 Bacteria 14646
132 Ga0105245_12758153 3300009098 Bacteria 544
133 Ga0105247_10250062 3300009101 Bacteria 1211
134 Ga0114129_10004632 3300009147 Bacteria 19409
135 Ga0114129_10017589 3300009147 Bacteria 10176
136 Ga0105243_10152377 3300009148 Bacteria 1984
137 Ga0105243_11989278 3300009148 Bacteria 615
138 Ga0105248_10014309 3300009177 Bacteria 8732
139 Ga0105248_10105565 3300009177 Bacteria 3176
140 Ga0105248_10166717 3300009177 Bacteria 2483
141 Ga0105248_11657943 3300009177 Bacteria 725
142 Ga0105237_10519768 3300009545 Bacteria 1197
143 Ga0105238_10067910 3300009551 Bacteria 3566
144 Ga0105238_10222148 3300009551 Bacteria 1865
145 Ga0105238_10674677 3300009551 Bacteria 1045
146 Ga0105238_10874347 3300009551 Bacteria 916
147 Ga0105249_12460318 3300009553 Bacteria 593
148 Ga0105249_13261993 3300009553 Bacteria 522
149 Ga0099796_10011722 3300010159 Bacteria 2455
150 Ga0105239_10396199 3300010375 Bacteria 1562
151 Ga0105246_10094703 3300011119 Bacteria 2160
152 Ga0105246_11171369 3300011119 Bacteria 706
153 Ga0105246_11175375 3300011119 Bacteria 705
154 Ga0157374_10717350 3300013296 Bacteria 1013
155 Ga0157374_10718169 3300013296 Bacteria 1013
156 Ga0157378_10258176 3300013297 Bacteria 1671
157 Ga0157378_10521615 3300013297 Bacteria 1190
158 Ga0163162_12485092 3300013306 Bacteria 596
159 Ga0157375_10209732 3300013308 Bacteria 2105
160 Ga0163163_10081756 3300014325 Bacteria 3233
161 Ga0163163_10594164 3300014325 Bacteria 1170
162 Ga0163163_11325000 3300014325 Bacteria 782
163 Ga0157380_10077743 3300014326 Bacteria 2705
164 Ga0157380_10893575 3300014326 Bacteria 914
165 Ga0157380_11100406 3300014326 Bacteria 834
166 Ga0157380_11291865 3300014326 Bacteria 777
167 Ga0157379_10347435 3300014968 Bacteria 1357
168 Ga0213874_10028175 3300021377 Bacteria 1603
169 Ga0213876_10052084 3300021384 Bacteria 2163
170 Ga0213876_10605948 3300021384 Bacteria 583
171 Ga0209758_1000566 3300025297 Bacteria 58298
172 Ga0207426_1042763 3300025302 Bacteria 1396
173 Ga0207682_10073323 3300025893 Bacteria 1454
174 Ga0207692_10035465 3300025898 Bacteria 2424
175 Ga0207688_10150765 3300025901 Bacteria 1373
176 Ga0207699_10038696 3300025906 Bacteria 2736
177 Ga0207645_10759888 3300025907 Bacteria 659
178 Ga0207707_11105410 3300025912 Bacteria 646
179 Ga0207693_10051481 3300025915 Bacteria 3231
180 Ga0207663_10111393 3300025916 Bacteria 1858
181 Ga0207652_10014784 3300025921 Bacteria 6327
182 Ga0207681_10130271 3300025923 Bacteria 1859
183 Ga0207681_10321931 3300025923 Bacteria 1230
184 Ga0207694_10013382 3300025924 Bacteria 6179
185 Ga0207694_10182172 3300025924 Bacteria 1704
186 Ga0207694_10956309 3300025924 Bacteria 725
187 Ga0207650_10526411 3300025925 Bacteria 990
188 Ga0207650_10838496 3300025925 Bacteria 780
189 Ga0207700_10122756 3300025928 Bacteria 2109
190 Ga0207700_10178039 3300025928 Bacteria 1779
191 Ga0207700_10292868 3300025928 Bacteria 1403
192 Ga0207664_10030747 3300025929 Bacteria 4103
193 Ga0207664_10185401 3300025929 Bacteria 1789
194 Ga0207664_10288129 3300025929 Bacteria 1442
195 Ga0207664_10308551 3300025929 Bacteria 1394
196 Ga0207664_10377879 3300025929 Bacteria 1257
197 Ga0207664_10953447 3300025929 Bacteria 769
198 Ga0207644_10001641 3300025931 Bacteria 14419
199 Ga0207690_10030872 3300025932 Bacteria 3423
200 Ga0207670_10024621 3300025936 Bacteria 3764
201 Ga0207669_10009542 3300025937 Bacteria 4631
202 Ga0207669_10013062 3300025937 Bacteria 4110
203 Ga0207704_10239375 3300025938 Bacteria 1355
204 Ga0207704_10605126 3300025938 Bacteria 898
205 Ga0207665_10223572 3300025939 Bacteria 1381
206 Ga0207691_10095076 3300025940 Bacteria 2666
207 Ga0207711_10065002 3300025941 Bacteria 3152
208 Ga0207679_10616099 3300025945 Bacteria 979
209 Ga0207651_10223696 3300025960 Bacteria 1523
210 Ga0207712_10342173 3300025961 Bacteria 1241
211 Ga0207712_11822838 3300025961 Bacteria 545
212 Ga0207668_11643105 3300025972 Bacteria 580
213 Ga0207640_10561482 3300025981 Bacteria 961
214 Ga0207658_10174339 3300025986 Bacteria 1775
215 Ga0207677_10348511 3300026023 Bacteria 1240
216 Ga0207703_10034331 3300026035 Bacteria 4025
217 Ga0207639_10432764 3300026041 Bacteria 1191
218 Ga0207678_10428414 3300026067 Bacteria 1148
219 Ga0207641_10187644 3300026088 Bacteria 1898
220 Ga0207641_12045285 3300026088 Bacteria 574
221 Ga0207648_10295801 3300026089 Bacteria 1451
222 Ga0207648_11171475 3300026089 Bacteria 722
223 Ga0207683_11325056 3300026121 Bacteria 666
224 Ga0209179_1046256 3300027512 Bacteria 925
225 Ga0209813_10029087 3300027866 Bacteria 1616
226 Ga0209813_10055095 3300027866 Bacteria 1255
227 Ga0207428_10254132 3300027907 Bacteria 1310
228 Ga0268266_10450585 3300028379 Bacteria 1223
229 Ga0268264_10760907 3300028381 Bacteria 966
230 Ga0265318_10137690 3300028577 Bacteria 897
231 Ga0265332_10090795 3300031238 Bacteria 1292
232 Ga0265328_10007778 3300031239 Bacteria 4455
233 Ga0265328_10089438 3300031239 Bacteria 1137
234 Ga0265325_10000252 3300031241 Bacteria 38198
235 Ga0265340_10021339 3300031247 Bacteria 3322
236 Ga0265340_10040122 3300031247 Bacteria 2307
237 Ga0265340_10180018 3300031247 Bacteria 956
238 Ga0265339_10242521 3300031249 Bacteria 875
239 Ga0265316_10095237 3300031344 Bacteria 2268
240 Ga0307408_100575752 3300031548 Bacteria 997
241 Ga0265313_10165043 3300031595 Bacteria 939
242 Ga0265314_10118492 3300031711 Bacteria 1671
243 Ga0265314_10255434 3300031711 Bacteria 1004
244 Ga0265342_10387926 3300031712 Bacteria 723
245 Ga0316578_10043815 3300031728 Bacteria 2600
246 Ga0307405_10706066 3300031731 Bacteria 836
247 Ga0307406_11862662 3300031901 Bacteria 536
248 Ga0307412_11308782 3300031911 Bacteria 653
249 Ga0307409_101564388 3300031995 Bacteria 687
250 Ga0373936_0027685 3300035113 Bacteria 2224
251 Ga0373936_0287701 3300035113 Bacteria 740
252 Ga0373954_0152302 3300035118 Bacteria 1130
253 Ga0373956_0204262 3300035119 Bacteria 937
254 Ga0373943_0115192 3300035170 Bacteria 1423
255 Ga0373943_0405012 3300035170 Bacteria 788
256 Ga0373955_0212766 3300035172 Bacteria 1153
257 Ga0373955_0268754 3300035172 Bacteria 1025
258 Ga0316574_0002582 3300035398 Bacteria 9125
259 Ga0373924_0314110 3300035410 Bacteria 696
260 Ga0373935_0004047 3300035692 Bacteria 8562
261 Ga0373935_0489724 3300035692 Bacteria 892
262 Ga0373927_0005492 3300035695 Bacteria 8733
263 Ga0373927_0159436 3300035695 Bacteria 1478
264 Ga0373933_0592163 3300035724 Bacteria 728
265 Ga0373933_0623918 3300035724 Bacteria 708
266 Ga0373947_0042019 3300035725 Bacteria 2728
267 Ga0373947_0043512 3300035725 Bacteria 2683
268 Ga0373947_0083264 3300035725 Bacteria 1984
269 Ga0373947_0521546 3300035725 Bacteria 808
270 Ga0373937_0004825 3300036401 Bacteria 11461
271 Ga0373937_0055190 3300036401 Bacteria 3647
272 Ga0373937_0228533 3300036401 Bacteria 1752
273 Ga0373937_0371330 3300036401 Bacteria 1356
274 Ga0373937_1015551 3300036401 Bacteria 778
275 Ga0316584_0006448 3300036712 Bacteria 7943
276 Ga0373925_0017872 3300037068 Bacteria 5146
277 Ga0373925_0091157 3300037068 Bacteria 2331
278 Ga0373925_0139834 3300037068 Bacteria 1894
279 Ga0373925_0155581 3300037068 Bacteria 1798
280 Ga0373925_0288885 3300037068 Bacteria 1322
281 Ga0373925_0633710 3300037068 Bacteria 881
282 Ga0436364_0274334 3300037853 Bacteria 1442
283 Ga0436365_0562508 3300039437 Bacteria 1760
284 Ga0436365_0943670 3300039437 Bacteria 1673
285 Ga0436365_1056251 3300039437 Bacteria 40748
286 Ga0436363_0019959 3300039450 Unclassified 759
287 Ga0436363_0434885 3300039450 Bacteria 624
288 Ga0436363_0561567 3300039450 Bacteria 4117
289 Ga0436362_0817480 3300039453 Bacteria 606
290 Ga0439434_0228048 3300042435 Bacteria 633
291 Ga0466963_0126002 3300044694 Bacteria 1766
292 Ga0466960_0725019 3300044901 Bacteria 598
293 Ga0466959_0384464 3300045049 Bacteria 955
294 Ga0451576_2421910 3300045051 Bacteria 537
295 Ga0466958_0300929 3300045836 Bacteria 1030
296 Ga0466967_0712724 3300045976 Bacteria 994
297 Ga0495592_0169381 3300046454 Bacteria 1497
298 Ga0495629_0249792 3300046459 Bacteria 1221
299 Ga0495638_0391772 3300046460 Bacteria 723
300 Ga0495651_0372951 3300046462 Bacteria 938
301 Ga0495582_0023159 3300046473 Bacteria 3397
302 Ga0495585_0230968 3300046492 Bacteria 930
303 Ga0495628_0130343 3300046516 Bacteria 1924
304 Ga0495630_0056950 3300046517 Bacteria 2929
305 Ga0495630_0155247 3300046517 Bacteria 1742
306 Ga0495654_0257772 3300046530 Bacteria 724
307 Ga0495665_0400421 3300046531 Bacteria 696
308 Ga0495640_0005593 3300046533 Bacteria 9991
309 Ga0495668_0285918 3300046616 Bacteria 904
310 Ga0495634_0035956 3300046642 Bacteria 3389
311 Ga0495659_0100049 3300046664 Bacteria 1122
312 Ga0495657_0130744 3300046675 Bacteria 1573
313 Ga0495647_0047896 3300046681 Bacteria 1651
314 Ga0495658_0165094 3300046683 Bacteria 1367
315 Ga0495613_0127141 3300046689 Bacteria 1827
316 Ga0495624_0125108 3300046690 Bacteria 1578
317 Ga0495604_0518782 3300047317 Bacteria 771
318 Ga0495636_0385706 3300047318 Bacteria 666
319 Ga0495674_0018497 3300047319 Bacteria 6485
320 Ga0495674_0275065 3300047319 Bacteria 1381
321 Ga0495674_0301387 3300047319 Bacteria 1309
322 Ga0495675_0382297 3300047444 Bacteria 823
323 Ga0495593_0064311 3300047673 Bacteria 1915
324 Ga0496100_0100212 3300048903 Bacteria 1995
325 Ga0496100_0579723 3300048903 Bacteria 870
326 Ga0496100_1006439 3300048903 Bacteria 656
327 Ga0496101_0151525 3300048904 Bacteria 1774
328 Ga0496104_0036325 3300048907 Bacteria 4606
329 Ga0496104_0087870 3300048907 Bacteria 2969
330 Ga0496104_0317653 3300048907 Bacteria 1471
331 Ga0496104_0841105 3300048907 Bacteria 823
332 Ga0496104_1569842 3300048907 Bacteria 561
333 Ga0496105_0096037 3300048908 Bacteria 2448
334 Ga0496105_0120943 3300048908 Bacteria 2159
335 Ga0496105_0259979 3300048908 Bacteria 1404
336 Ga0496106_0559698 3300048909 Bacteria 917
337 Ga0496107_0431800 3300048910 Bacteria 979
338 Ga0496108_0833853 3300048911 Bacteria 794
339 Ga0496108_0920366 3300048911 Bacteria 750
340 Ga0496109_0061969 3300048912 Bacteria 3420
341 Ga0496109_0409895 3300048912 Bacteria 1281
342 Ga0496109_0455099 3300048912 Bacteria 1209
343 Ga0496110_0033691 3300048913 Bacteria 4433
344 Ga0496110_0411820 3300048913 Bacteria 1232
345 Ga0496111_0107401 3300048914 Bacteria 2055
346 Ga0496112_0004453 3300048915 Bacteria 11872
347 Ga0496113_0312000 3300048916 Bacteria 1260
348 Ga0496114_0068837 3300048917 Bacteria 2972
349 Ga0496114_0127469 3300048917 Bacteria 2195
350 Ga0496115_0094338 3300048918 Bacteria 2448
351 Ga0496115_0214160 3300048918 Bacteria 1591
352 Ga0496115_0485635 3300048918 Bacteria 994
353 Ga0496124_0541940 3300048927 Bacteria 770
354 Ga0501031_0025236 3300049568 Bacteria 3877
355 Ga0501032_0031320 3300049569 Bacteria 3646
356 Ga0501033_0065572 3300049570 Bacteria 2671
357 Ga0501034_0192201 3300049571 Bacteria 2003
358 Ga0501034_0206814 3300049571 Bacteria 1919
359 Ga0501034_0357575 3300049571 Bacteria 1388
360 Ga0501036_0033826 3300049572 Bacteria 4323
361 Ga0501037_0006319 3300049573 Bacteria 8665
362 Ga0501037_0551554 3300049573 Bacteria 778
363 Ga0501038_0152878 3300049574 Bacteria 1880
364 Ga0501039_0276965 3300049575 Bacteria 1319
365 Ga0501039_0277950 3300049575 Bacteria 1316
366 Ga0501040_0090749 3300049576 Bacteria 2124
367 Ga0501041_0101514 3300049577 Bacteria 1781
368 Ga0501043_0130732 3300049579 Bacteria 1967
369 Ga0501046_0014492 3300049580 Bacteria 6650
370 Ga0501047_0508857 3300049581 Bacteria 1030
371 Ga0501048_0031187 3300049582 Bacteria 3856
372 Ga0501067_0077799 3300049583 Bacteria 1838
373 Ga0501068_0119938 3300049584 Bacteria 1639
374 Ga0501069_0005671 3300049585 Bacteria 6503
375 Ga0501069_0048972 3300049585 Bacteria 2348
376 Ga0501070_0496647 3300049586 Bacteria 980
377 Ga0501071_0136492 3300049587 Bacteria 1825
378 Ga0501071_0402387 3300049587 Bacteria 1045
379 Ga0501071_1102948 3300049587 Bacteria 613
380 Ga0501072_0092737 3300049588 Bacteria 2399
381 Ga0501072_0378119 3300049588 Bacteria 1124
382 Ga0501073_0130013 3300049589 Bacteria 1745
383 Ga0501074_0127553 3300049590 Bacteria 1820
384 Ga0501075_0220396 3300049591 Bacteria 1447
385 Ga0501075_0436207 3300049591 Bacteria 999
386 Ga0501076_0059694 3300049592 Bacteria 3034
387 Ga0501076_0180348 3300049592 Bacteria 1722
388 Ga0501076_0866517 3300049592 Bacteria 745
389 Ga0501076_0961347 3300049592 Bacteria 704
390 Ga0501079_0168708 3300049741 Bacteria 1707
391 Ga0501079_0198121 3300049741 Bacteria 1568
392 Ga0501080_0115448 3300049742 Bacteria 2489
393 Ga0501080_0145231 3300049742 Bacteria 2193
394 Ga0501080_0318251 3300049742 Bacteria 1409
395 Ga0501081_0195769 3300049743 Bacteria 1465
396 Ga0501081_0641049 3300049743 Bacteria 796
397 Ga0501083_0020143 3300049744 Bacteria 4642
398 Ga0501035_0297867 3300049822 Bacteria 1359
399 Ga0501044_0003362 3300049823 Bacteria 18040
400 Ga0501044_0518206 3300049823 Bacteria 1092
401 Ga0501044_1031379 3300049823 Bacteria 693
402 nmdc:mga03683_111257_c1 3300050489 Bacteria 1211
403 nmdc:mga03683_124506_c1 3300050489 Bacteria 1149
404 nmdc:mga03683_162947_c1 3300050489 Bacteria 1011
405 nmdc:mga03683_215136_c1 3300050489 Bacteria 885
406 nmdc:mga03683_277441_c1 3300050489 Bacteria 783
407 nmdc:mga03683_53252_c1 3300050489 Bacteria 1693
408 nmdc:mga03n38_131005_c1 3300050490 Bacteria 1243
409 nmdc:mga03n38_25968_c1 3300050490 Bacteria 2413
410 nmdc:mga03n38_437831_c1 3300050490 Bacteria 725
411 nmdc:mga03n38_94563_c1 3300050490 Bacteria 1429
412 nmdc:mga00v17_135199_c1 3300050491 Bacteria 1578
413 nmdc:mga00v17_226977_c1 3300050491 Bacteria 1210
414 nmdc:mga00v17_335964_c1 3300050491 Bacteria 982
415 nmdc:mga00v17_36040_c1 3300050491 Bacteria 2947
416 nmdc:mga00v17_832341_c1 3300050491 Bacteria 587
417 nmdc:mga0yw44_189816_c1 3300050492 Bacteria 1355
418 nmdc:mga0yw44_2334_c1 3300050492 Bacteria 8032
419 nmdc:mga0yw44_240899_c1 3300050492 Bacteria 1202
420 nmdc:mga0yw44_48718_c1 3300050492 Bacteria 2555
421 nmdc:mga0yw44_6322_c1 3300050492 Bacteria 5714
422 nmdc:mga0k408_35957_c1 3300050493 Bacteria 2035
423 nmdc:mga0k408_36829_c1 3300050493 Bacteria 2808
424 nmdc:mga0k408_49728_c1 3300050493 Bacteria 2427
425 nmdc:mga06z11_157673_c1 3300050494 Bacteria 1295
426 nmdc:mga06z11_316608_c1 3300050494 Bacteria 930
427 nmdc:mga06z11_328864_c1 3300050494 Bacteria 913
428 nmdc:mga06z11_367833_c1 3300050494 Bacteria 862
429 nmdc:mga06z11_389493_c1 3300050494 Bacteria 838
430 nmdc:mga06z11_403727_c1 3300050494 Bacteria 823
431 nmdc:mga06z11_44145_c1 3300050494 Bacteria 2246
432 nmdc:mga06z11_61666_c1 3300050494 Bacteria 1957
433 nmdc:mga06z11_62269_c1 3300050494 Bacteria 1948
434 nmdc:mga06z11_7673_c1 3300050494 Bacteria 4454
435 nmdc:mga04h51_17356_c1 3300050495 Bacteria 2104
436 nmdc:mga04h51_98426_c1 3300050495 Bacteria 1063
437 nmdc:mga04h51_99957_c1 3300050495 Bacteria 1056
438 nmdc:mga07m45_128189_c2 3300050496 Bacteria 653
439 nmdc:mga07m45_130956_c1 3300050496 Bacteria 1451
440 nmdc:mga07m45_49400_c1 3300050496 Bacteria 2368
441 nmdc:mga07m45_83506_c1 3300050496 Bacteria 1826
442 nmdc:mga07m45_86935_c1 3300050496 Bacteria 1788
443 nmdc:mga05p37_4309_c1 3300050507 Bacteria 16618
444 nmdc:mga05p37_76782_c1 3300050507 Bacteria 4112
445 nmdc:mga09592_374968_c1 3300050508 Bacteria 1231
446 nmdc:mga09592_454312_c1 3300050508 Bacteria 1105
447 nmdc:mga0qj67_51778_c1 3300050509 Bacteria 3247
448 nmdc:mga0qj67_64130_c1 3300050509 Bacteria 2922
449 nmdc:mga08y16_96519_c1 3300050511 Bacteria 3078
450 nmdc:mga0n895_35547_c1 3300050512 Bacteria 4804
451 nmdc:mga0n895_403721_c1 3300050512 Bacteria 1382
452 nmdc:mga0n895_500042_c1 3300050512 Bacteria 1225
453 nmdc:mga08x19_453485_c1 3300050514 Bacteria 903
454 nmdc:mga08x19_8406_c1 3300050514 Bacteria 6150
455 nmdc:mga0sz30_101135_c1 3300050516 Bacteria 1259
456 nmdc:mga0sz30_166019_c1 3300050516 Bacteria 978
457 nmdc:mga0sz30_383291_c1 3300050516 Bacteria 629
458 Ga0495601_0116139 3300053077 Bacteria 1735
459 Ga0495595_0006484 3300053084 Bacteria 4775
460 Ga0495595_0105411 3300053084 Bacteria 1363
461 Ga0495619_0043164 3300053085 Bacteria 2955
462 Ga0495619_0053262 3300053085 Bacteria 2676
463 Ga0495619_0162181 3300053085 Bacteria 1544
464 Ga0500644_0195927 3300053088 Bacteria 834
465 Ga0500566_0257758 3300053094 Bacteria 844
466 Ga0500641_0002639 3300053096 Bacteria 6331
467 Ga0500641_0003993 3300053096 Bacteria 5213
468 Ga0500556_0000324 3300053104 Bacteria 35900
469 Ga0500556_0345939 3300053104 Bacteria 576
470 Ga0500562_061944 3300053108 Bacteria 1005
471 Ga0500593_005672 3300053117 Bacteria 4942
472 Ga0500595_024724 3300053119 Bacteria 2093
473 Ga0500595_027930 3300053119 Bacteria 1927
474 Ga0500642_0055826 3300053130 Bacteria 1758
475 Ga0500652_000002 3300053131 Bacteria 273315
476 Ga0500658_0163005 3300053134 Bacteria 1010
477 Ga0500577_0317309 3300053142 Bacteria 681
478 Ga0500616_0068631 3300053153 Bacteria 1815
479 Ga0500627_0002799 3300053158 Bacteria 5252
480 Ga0500636_0005827 3300053177 Bacteria 7054
481 Ga0501084_0132567 3300054114 Bacteria 2098
482 Ga0501084_0603726 3300054114 Bacteria 927
483 Ga0501082_0309513 3300060353 Bacteria 1376
484 Ga0501082_0323967 3300060353 Bacteria 1343
485 Ga0501082_1610995 3300060353 Bacteria 567
486 Ga0530510_0249843 3300061734 Bacteria 1322
487 8002063749 8002060224 Bacteria 4026565
488 Ga0500568_0086177
489 JGI25153J46596_10003942
490 JGI25405J52794_10001905
491 JGI25405J52794_10002377
492 Ga0070676_10862551
493 Ga0070683_100897893
494 Ga0070670_100052222
495 Ga0070666_10133497
496 Ga0070680_100038590
497 Ga0068868_100836471
498 Ga0070660_101074928
499 Ga0070689_100037800
500 Ga0070689_100839093
501 Ga0070668_101866051
502 Ga0070669_100370056
503 Ga0070669_100417874
504 Ga0070675_100171911
505 Ga0070675_100990477
506 Ga0070671_100001737
507 Ga0070671_102049114
508 Ga0070674_100378659
509 Ga0070674_100940148
510 Ga0070674_101046783
511 Ga0070673_100098561
512 Ga0070688_100507132
513 Ga0070659_100164841
514 Ga0070667_100290528
515 Ga0070667_101519423
516 Ga0070709_10121470
517 Ga0070714_100013881
518 Ga0070714_100103713
519 Ga0070714_100148946
520 Ga0070714_100513797
521 Ga0070713_100104722
522 Ga0070713_100226987
523 Ga0070713_100231485
524 Ga0070710_10024352
525 Ga0070711_100313021
526 Ga0070700_101121742
527 Ga0070663_100997477
528 Ga0070678_101505519
529 Ga0070681_10107769
530 Ga0068867_100898801
531 Ga0068867_101499054
532 Ga0070685_10196049
533 Ga0070698_100850576
534 Ga0070679_100092248
535 Ga0070684_100141224
536 Ga0070684_100863361
537 Ga0070672_100293026
538 Ga0070686_100061553
539 Ga0070686_100875610
540 Ga0070693_100070183
541 Ga0070704_100314243
542 Ga0070664_100717116
543 Ga0070664_100765795
544 Ga0068852_100661194
545 Ga0068866_10350563
546 Ga0068863_100184223
547 Ga0068863_100371379
548 Ga0068858_100047262
549 Ga0068860_101508854
550 Ga0081455_10012185
551 Ga0081538_10005817
552 Ga0081540_1012318
553 Ga0081540_1045478
554 Ga0081540_1322105
555 Ga0081539_10119402
556 Ga0081539_10122477
557 Ga0070717_10035410
558 Ga0070717_10070509
559 Ga0070717_10204923
560 Ga0070717_11218366
561 Ga0075365_10007450
562 Ga0075365_10028039
563 Ga0075365_10072053
564 Ga0075365_10136629
565 Ga0075365_10305586
566 Ga0075365_10585376
567 Ga0075368_10018352
568 Ga0075368_10023789
569 Ga0075368_10101012
570 Ga0075368_10188892
571 Ga0075363_100016679
572 Ga0075363_100096978
573 Ga0075364_10145949
574 Ga0075364_10200643
575 Ga0075364_10253374
576 Ga0075364_10402368
577 Ga0075364_10531780
578 Ga0075364_10757259
579 Ga0075364_10780775
580 Ga0075364_11013389
581 Ga0070712_100101124
582 Ga0070712_100662256
583 Ga0075362_10100733
584 Ga0075362_10201544
585 Ga0075367_10004822
586 Ga0075367_10054481
587 Ga0075367_10059089
588 Ga0075367_10177980
589 Ga0075367_10285448
590 Ga0075367_10296685
591 Ga0075367_10378644
592 Ga0075369_10017593
593 Ga0075369_10243481
594 Ga0075369_10384591
595 Ga0075366_10004461
596 Ga0075366_10064352
597 Ga0075366_10210188
598 Ga0097621_100057176
599 Ga0075370_10112576
600 Ga0075370_10173034
601 Ga0075370_10218786
602 Ga0075370_10594194
603 Ga0068871_100137441
604 Ga0075428_100064064
605 Ga0075430_101293402
606 Ga0075431_100006493
607 Ga0075431_100061525
608 Ga0075431_101132184
609 Ga0075434_100043949
610 Ga0075434_100423953
611 Ga0075429_100140500
612 Ga0075429_100342618
613 Ga0075436_100002989
614 Ga0075435_100019092
615 Ga0099795_10022276
616 Ga0111539_10145691
617 Ga0111539_10372375
618 Ga0105245_10003204
619 Ga0105245_12758153
620 Ga0105247_10250062
621 Ga0114129_10004632
622 Ga0114129_10017589
623 Ga0105243_10152377
624 Ga0105243_11989278
625 Ga0105248_10014309
626 Ga0105248_10105565
627 Ga0105248_10166717
628 Ga0105248_11657943
629 Ga0105237_10519768
630 Ga0105238_10067910
631 Ga0105238_10222148
632 Ga0105238_10674677
633 Ga0105238_10874347
634 Ga0105249_12460318
635 Ga0105249_13261993
636 Ga0099796_10011722
637 Ga0105239_10396199
638 Ga0105246_10094703
639 Ga0105246_11171369
640 Ga0105246_11175375
641 Ga0157374_10717350
642 Ga0157374_10718169
643 Ga0157378_10258176
644 Ga0157378_10521615
645 Ga0163162_12485092
646 Ga0157375_10209732
647 Ga0163163_10081756
648 Ga0163163_10594164
649 Ga0163163_11325000
650 Ga0157380_10077743
651 Ga0157380_10893575
652 Ga0157380_11100406
653 Ga0157380_11291865
654 Ga0157379_10347435
655 Ga0213874_10028175
656 Ga0213876_10052084
657 Ga0213876_10605948
658 Ga0209758_1000566
659 Ga0207426_1042763
660 Ga0207682_10073323
661 Ga0207692_10035465
662 Ga0207688_10150765
663 Ga0207699_10038696
664 Ga0207645_10759888
665 Ga0207707_11105410
666 Ga0207693_10051481
667 Ga0207663_10111393
668 Ga0207652_10014784
669 Ga0207681_10130271
670 Ga0207681_10321931
671 Ga0207694_10013382
672 Ga0207694_10182172
673 Ga0207694_10956309
674 Ga0207650_10526411
675 Ga0207650_10838496
676 Ga0207700_10122756
677 Ga0207700_10178039
678 Ga0207700_10292868
679 Ga0207664_10030747
680 Ga0207664_10185401
681 Ga0207664_10288129
682 Ga0207664_10308551
683 Ga0207664_10377879
684 Ga0207664_10953447
685 Ga0207644_10001641
686 Ga0207690_10030872
687 Ga0207670_10024621
688 Ga0207669_10009542
689 Ga0207669_10013062
690 Ga0207704_10239375
691 Ga0207704_10605126
692 Ga0207665_10223572
693 Ga0207691_10095076
694 Ga0207711_10065002
695 Ga0207679_10616099
696 Ga0207651_10223696
697 Ga0207712_10342173
698 Ga0207712_11822838
699 Ga0207668_11643105
700 Ga0207640_10561482
701 Ga0207658_10174339
702 Ga0207677_10348511
703 Ga0207703_10034331
704 Ga0207639_10432764
705 Ga0207678_10428414
706 Ga0207641_10187644
707 Ga0207641_12045285
708 Ga0207648_10295801
709 Ga0207648_11171475
710 Ga0207683_11325056
711 Ga0209179_1046256
712 Ga0209813_10029087
713 Ga0209813_10055095
714 Ga0207428_10254132
715 Ga0268266_10450585
716 Ga0268264_10760907
717 Ga0265318_10137690
718 Ga0265332_10090795
719 Ga0265328_10007778
720 Ga0265328_10089438
721 Ga0265325_10000252
722 Ga0265340_10021339
723 Ga0265340_10040122
724 Ga0265340_10180018
725 Ga0265339_10242521
726 Ga0265316_10095237
727 Ga0307408_100575752
728 Ga0265313_10165043
729 Ga0265314_10118492
730 Ga0265314_10255434
731 Ga0265342_10387926
732 Ga0316578_10043815
733 Ga0307405_10706066
734 Ga0307406_11862662
735 Ga0307412_11308782
736 Ga0307409_101564388
737 Ga0373936_0027685
738 Ga0373936_0287701
739 Ga0373954_0152302
740 Ga0373956_0204262
741 Ga0373943_0115192
742 Ga0373943_0405012
743 Ga0373955_0212766
744 Ga0373955_0268754
745 Ga0316574_0002582
746 Ga0373924_0314110
747 Ga0373935_0004047
748 Ga0373935_0489724
749 Ga0373927_0005492
750 Ga0373927_0159436
751 Ga0373933_0592163
752 Ga0373933_0623918
753 Ga0373947_0042019
754 Ga0373947_0043512
755 Ga0373947_0083264
756 Ga0373947_0521546
757 Ga0373937_0004825
758 Ga0373937_0055190
759 Ga0373937_0228533
760 Ga0373937_0371330
761 Ga0373937_1015551
762 Ga0316584_0006448
763 Ga0373925_0017872
764 Ga0373925_0091157
765 Ga0373925_0139834
766 Ga0373925_0155581
767 Ga0373925_0288885
768 Ga0373925_0633710
769 Ga0436364_0274334
770 Ga0436365_0562508
771 Ga0436365_0943670
772 Ga0436365_1056251
773 Ga0436363_0019959
774 Ga0436363_0434885
775 Ga0436363_0561567
776 Ga0436362_0817480
777 Ga0439434_0228048
778 Ga0466963_0126002
779 Ga0466960_0725019
780 Ga0466959_0384464
781 Ga0451576_2421910
782 Ga0466958_0300929
783 Ga0466967_0712724
784 Ga0495592_0169381
785 Ga0495629_0249792
786 Ga0495638_0391772
787 Ga0495651_0372951
788 Ga0495582_0023159
789 Ga0495585_0230968
790 Ga0495628_0130343
791 Ga0495630_0056950
792 Ga0495630_0155247
793 Ga0495654_0257772
794 Ga0495665_0400421
795 Ga0495640_0005593
796 Ga0495668_0285918
797 Ga0495634_0035956
798 Ga0495659_0100049
799 Ga0495657_0130744
800 Ga0495647_0047896
801 Ga0495658_0165094
802 Ga0495613_0127141
803 Ga0495624_0125108
804 Ga0495604_0518782
805 Ga0495636_0385706
806 Ga0495674_0018497
807 Ga0495674_0275065
808 Ga0495674_0301387
809 Ga0495675_0382297
810 Ga0495593_0064311
811 Ga0496100_0100212
812 Ga0496100_0579723
813 Ga0496100_1006439
814 Ga0496101_0151525
815 Ga0496104_0036325
816 Ga0496104_0087870
817 Ga0496104_0317653
818 Ga0496104_0841105
819 Ga0496104_1569842
820 Ga0496105_0096037
821 Ga0496105_0120943
822 Ga0496105_0259979
823 Ga0496106_0559698
824 Ga0496107_0431800
825 Ga0496108_0833853
826 Ga0496108_0920366
827 Ga0496109_0061969
828 Ga0496109_0409895
829 Ga0496109_0455099
830 Ga0496110_0033691
831 Ga0496110_0411820
832 Ga0496111_0107401
833 Ga0496112_0004453
834 Ga0496113_0312000
835 Ga0496114_0068837
836 Ga0496114_0127469
837 Ga0496115_0094338
838 Ga0496115_0214160
839 Ga0496115_0485635
840 Ga0496124_0541940
841 Ga0501031_0025236
842 Ga0501032_0031320
843 Ga0501033_0065572
844 Ga0501034_0192201
845 Ga0501034_0206814
846 Ga0501034_0357575
847 Ga0501036_0033826
848 Ga0501037_0006319
849 Ga0501037_0551554
850 Ga0501038_0152878
851 Ga0501039_0276965
852 Ga0501039_0277950
853 Ga0501040_0090749
854 Ga0501041_0101514
855 Ga0501043_0130732
856 Ga0501046_0014492
857 Ga0501047_0508857
858 Ga0501048_0031187
859 Ga0501067_0077799
860 Ga0501068_0119938
861 Ga0501069_0005671
862 Ga0501069_0048972
863 Ga0501070_0496647
864 Ga0501071_0136492
865 Ga0501071_0402387
866 Ga0501071_1102948
867 Ga0501072_0092737
868 Ga0501072_0378119
869 Ga0501073_0130013
870 Ga0501074_0127553
871 Ga0501075_0220396
872 Ga0501075_0436207
873 Ga0501076_0059694
874 Ga0501076_0180348
875 Ga0501076_0866517
876 Ga0501076_0961347
877 Ga0501079_0168708
878 Ga0501079_0198121
879 Ga0501080_0115448
880 Ga0501080_0145231
881 Ga0501080_0318251
882 Ga0501081_0195769
883 Ga0501081_0641049
884 Ga0501083_0020143
885 Ga0501035_0297867
886 Ga0501044_0003362
887 Ga0501044_0518206
888 Ga0501044_1031379
889 nmdc:mga03683_111257_c1
890 nmdc:mga03683_124506_c1
891 nmdc:mga03683_162947_c1
892 nmdc:mga03683_215136_c1
893 nmdc:mga03683_277441_c1
894 nmdc:mga03683_53252_c1
895 nmdc:mga03n38_131005_c1
896 nmdc:mga03n38_25968_c1
897 nmdc:mga03n38_437831_c1
898 nmdc:mga03n38_94563_c1
899 nmdc:mga00v17_135199_c1
900 nmdc:mga00v17_226977_c1
901 nmdc:mga00v17_335964_c1
902 nmdc:mga00v17_36040_c1
903 nmdc:mga00v17_832341_c1
904 nmdc:mga0yw44_189816_c1
905 nmdc:mga0yw44_2334_c1
906 nmdc:mga0yw44_240899_c1
907 nmdc:mga0yw44_48718_c1
908 nmdc:mga0yw44_6322_c1
909 nmdc:mga0k408_35957_c1
910 nmdc:mga0k408_36829_c1
911 nmdc:mga0k408_49728_c1
912 nmdc:mga06z11_157673_c1
913 nmdc:mga06z11_316608_c1
914 nmdc:mga06z11_328864_c1
915 nmdc:mga06z11_367833_c1
916 nmdc:mga06z11_389493_c1
917 nmdc:mga06z11_403727_c1
918 nmdc:mga06z11_44145_c1
919 nmdc:mga06z11_61666_c1
920 nmdc:mga06z11_62269_c1
921 nmdc:mga06z11_7673_c1
922 nmdc:mga04h51_17356_c1
923 nmdc:mga04h51_98426_c1
924 nmdc:mga04h51_99957_c1
925 nmdc:mga07m45_128189_c2
926 nmdc:mga07m45_130956_c1
927 nmdc:mga07m45_49400_c1
928 nmdc:mga07m45_83506_c1
929 nmdc:mga07m45_86935_c1
930 nmdc:mga05p37_4309_c1
931 nmdc:mga05p37_76782_c1
932 nmdc:mga09592_374968_c1
933 nmdc:mga09592_454312_c1
934 nmdc:mga0qj67_51778_c1
935 nmdc:mga0qj67_64130_c1
936 nmdc:mga08y16_96519_c1
937 nmdc:mga0n895_35547_c1
938 nmdc:mga0n895_403721_c1
939 nmdc:mga0n895_500042_c1
940 nmdc:mga08x19_453485_c1
941 nmdc:mga08x19_8406_c1
942 nmdc:mga0sz30_101135_c1
943 nmdc:mga0sz30_166019_c1
944 nmdc:mga0sz30_383291_c1
945 Ga0495601_0116139
946 Ga0495595_0006484
947 Ga0495595_0105411
948 Ga0495619_0043164
949 Ga0495619_0053262
950 Ga0495619_0162181
951 Ga0500644_0195927
952 Ga0500566_0257758
953 Ga0500641_0002639
954 Ga0500641_0003993
955 Ga0500556_0000324
956 Ga0500556_0345939
957 Ga0500562_061944
958 Ga0500593_005672
959 Ga0500595_024724
960 Ga0500595_027930
961 Ga0500642_0055826
962 Ga0500652_000002
963 Ga0500658_0163005
964 Ga0500577_0317309
965 Ga0500616_0068631
966 Ga0500627_0002799
967 Ga0500636_0005827
968 Ga0501084_0132567
969 Ga0501084_0603726
970 Ga0501082_0309513
971 Ga0501082_0323967
972 Ga0501082_1610995
973 Ga0530510_0249843
974 8002063749

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07977

FabA

FabA-like domain

54

179

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3d6x-assembly1.cif.gz_A crystal structure of campylobacter jejuni fabz 0.9277 9 149
3d6x-assembly1.cif.gz_D crystal structure of campylobacter jejuni fabz 0.9227 9 149
5m6k-assembly1.cif.gz_A crystal structure of nitrophorin 7 e27v mutant from rhodnius prolixus with imidazole 0.9216 112 147
3d6x-assembly1.cif.gz_B crystal structure of campylobacter jejuni fabz 0.9206 9 148
3d6x-assembly1.cif.gz_C crystal structure of campylobacter jejuni fabz 0.9198 9 148
ID Description Score Start End Superfamily
4h4gA00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9058 9 147 3.10.129.10
5buyF00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9055 7 147 3.10.129.10
2gllA00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9041 6 150 3.10.129.10
3d6xF00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8969 6 149 3.10.129.10
5buyF00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8928 7 147 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A656Z5U0-F1-model_v4 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ (EC 4.2.1.59) ((3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase) (Beta-hydroxyacyl-ACP dehydratase) 0.9416 25 151 GO:0005737
GO:0006633
GO:0009245
GO:0016020
GO:0019171
AF-A0A2V7TV28-F1-model_v4 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ 0.9362 9 151 GO:0016829
AF-A0A812V0Z3-F1-model_v4 deleted 0.9345 6 150
AF-A0A532DUR5-F1-model_v4 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ (EC 4.2.1.59) ((3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase) ((3R)-hydroxymyristoyl-ACP dehydrase) (Beta-hydroxyacyl-ACP dehydratase) 0.9304 6 149 GO:0005737
GO:0006633
GO:0009245
GO:0016020
GO:0019171
AF-A0A2E7FXR6-F1-model_v4 deleted 0.9295 9 151

Map