F453496

General Info

Members Datasets Scaffolds Average Seq Length
487 203 974 238

Family's Representative Sequence

Representative Sequence 3300048903|Ga0496100_0321517|Ga0496100_0321517_113_916
Length 267
Sequence VYPVLRIVIPPDRQGLRPGGPVAFRAVDQDMMRRGIAEFVGTFTLIFIGGGAGIVSGQDIVAVALANGLAIGIMVTNLGHISGGHFNPAITLGFVATRRIAPALAAVYWAAQLLGAVAAAFILRYLFTQLAVAVFAAPAPHIADGKAVLLEAIMTFFLVWAVWATAVDVRGAFKAIAGLAIGLTITMDVFVGGPVTGAAMNPARAFGPELAGNTWTGWWIYWVGPIAGGLVACLVYEYLYLKPLAPSVVGTPESGVDEPRPGETASS

Samples

Sample ID Description Type Environment
1 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
21 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
27 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
28 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
29 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
30 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
31 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
33 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
34 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
35 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
36 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
38 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
40 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
41 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
42 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
43 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
44 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
45 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
46 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
47 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
48 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
49 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
50 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
51 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
52 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
53 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
54 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
81 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
82 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
83 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
84 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
85 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
86 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
87 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
88 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
89 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
90 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
91 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
92 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
93 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
94 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
95 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
96 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
97 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
98 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
99 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
100 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
101 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
102 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
103 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
104 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
105 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
106 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
107 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
108 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
109 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
110 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
111 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
112 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
113 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
114 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
115 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
116 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
117 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
118 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
119 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
120 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
121 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
122 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
123 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
124 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
125 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
126 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
127 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
128 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
129 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
130 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
131 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
132 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
133 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
134 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
135 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
136 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
137 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
138 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
139 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
140 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
141 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
142 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
143 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
144 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
145 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
146 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
147 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
148 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
149 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
150 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
151 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
152 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
153 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
154 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
155 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
156 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
157 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
158 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
159 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
160 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
161 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
162 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
163 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
164 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
165 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
166 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
167 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
168 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
169 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
170 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
171 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
172 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
173 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
174 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
175 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
176 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
177 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
178 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
179 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
180 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
181 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
182 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
183 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
184 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
185 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
186 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
187 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
188 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
189 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
190 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
192 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
193 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
194 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
195 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
196 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
197 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
198 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
199 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
200 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
201 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
202 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
203 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.97
Metatranscriptomes 1.03
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.21
Nodule 0
Rhizoplane 12.73
Rhizosphere 87.06
Stem 0
Stem Tuber 0
Unclassified 3.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496100_0321517 3300048903 Bacteria 1162
2 Ga0070658_10010792 3300005327 Bacteria 7323
3 Ga0070658_10105178 3300005327 Bacteria 2335
4 Ga0070658_10303493 3300005327 Bacteria 1361
5 Ga0070683_100165715 3300005329 Bacteria 2097
6 Ga0070683_100176122 3300005329 Bacteria 2030
7 Ga0070683_100255862 3300005329 Bacteria 1666
8 Ga0070680_100008021 3300005336 Bacteria 8064
9 Ga0070680_100046353 3300005336 Bacteria 3536
10 Ga0070682_100339738 3300005337 Bacteria 1116
11 Ga0070660_100009146 3300005339 Bacteria 6953
12 Ga0070660_100050245 3300005339 Bacteria 3208
13 Ga0070660_100244036 3300005339 Bacteria 1463
14 Ga0070691_10106712 3300005341 Bacteria 1397
15 Ga0070661_100086971 3300005344 Bacteria 2311
16 Ga0070659_100021109 3300005366 Bacteria 4954
17 Ga0070659_100040246 3300005366 Bacteria 3651
18 Ga0070709_10002809 3300005434 Bacteria 9404
19 Ga0070709_10021675 3300005434 Bacteria 3745
20 Ga0070714_100003527 3300005435 Bacteria 11685
21 Ga0070714_100023668 3300005435 Bacteria 5049
22 Ga0070714_100026013 3300005435 Bacteria 4834
23 Ga0070714_100027041 3300005435 Bacteria 4747
24 Ga0070714_100055596 3300005435 Bacteria 3383
25 Ga0070714_100070339 3300005435 Unclassified 3025
26 Ga0070714_100102655 3300005435 Bacteria 2522
27 Ga0070714_100170214 3300005435 Bacteria 1976
28 Ga0070714_100227358 3300005435 Bacteria 1717
29 Ga0070713_100016962 3300005436 Bacteria 5490
30 Ga0070713_100025105 3300005436 Bacteria 4654
31 Ga0070713_100217958 3300005436 Bacteria 1730
32 Ga0070710_10000749 3300005437 Bacteria 15464
33 Ga0070710_10002519 3300005437 Bacteria 8692
34 Ga0070711_100202882 3300005439 Bacteria 1531
35 Ga0070681_10013001 3300005458 Bacteria 8266
36 Ga0070681_10027893 3300005458 Bacteria 5676
37 Ga0070681_10058465 3300005458 Bacteria 3835
38 Ga0070681_10637818 3300005458 Bacteria 980
39 Ga0070707_100001390 3300005468 Bacteria 23809
40 Ga0070707_100139653 3300005468 Bacteria 2358
41 Ga0070707_100281309 3300005468 Bacteria 1617
42 Ga0070698_100005754 3300005471 Bacteria 13554
43 Ga0070698_100150898 3300005471 Bacteria 2272
44 Ga0070698_100268835 3300005471 Bacteria 1637
45 Ga0070698_100308071 3300005471 Bacteria 1514
46 Ga0070679_100060794 3300005530 Bacteria 3765
47 Ga0070679_100171155 3300005530 Bacteria 2145
48 Ga0070679_100307173 3300005530 Bacteria 1536
49 Ga0070679_100324423 3300005530 Bacteria 1489
50 Ga0070684_100077152 3300005535 Bacteria 2942
51 Ga0070695_100000473 3300005545 Bacteria 20860
52 Ga0070695_100402562 3300005545 Bacteria 1038
53 Ga0070696_100317980 3300005546 Bacteria 1197
54 Ga0068855_100005085 3300005563 Bacteria 16033
55 Ga0068855_100112540 3300005563 Bacteria 3124
56 Ga0068855_100241256 3300005563 Bacteria 2019
57 Ga0070664_100381957 3300005564 Bacteria 1286
58 Ga0068856_100096345 3300005614 Bacteria 2947
59 Ga0068856_100255675 3300005614 Bacteria 1767
60 Ga0068852_100452905 3300005616 Bacteria 1271
61 Ga0070717_10001905 3300006028 Bacteria 14595
62 Ga0070717_10031394 3300006028 Bacteria 4274
63 Ga0070717_10044708 3300006028 Bacteria 3618
64 Ga0070717_10108071 3300006028 Bacteria 2370
65 Ga0070717_10238325 3300006028 Bacteria 1603
66 Ga0075432_10026358 3300006058 Bacteria 1996
67 Ga0070715_10000369 3300006163 Bacteria 11279
68 Ga0070716_100124654 3300006173 Bacteria 1618
69 Ga0070712_100105963 3300006175 Bacteria 2089
70 Ga0097621_100224785 3300006237 Bacteria 1637
71 Ga0075433_10127409 3300006852 Bacteria 2261
72 Ga0075434_100006835 3300006871 Bacteria 10500
73 Ga0075436_100413957 3300006914 Bacteria 978
74 Ga0105240_10004954 3300009093 Bacteria 20027
75 Ga0105240_10011632 3300009093 Bacteria 12237
76 Ga0105240_10553222 3300009093 Bacteria 1273
77 Ga0111539_10151489 3300009094 Bacteria 2714
78 Ga0105245_10119429 3300009098 Bacteria 2461
79 Ga0105245_10171091 3300009098 Bacteria 2069
80 Ga0105245_10492974 3300009098 Unclassified 1240
81 Ga0114129_10257176 3300009147 Bacteria 2342
82 Ga0105241_10745324 3300009174 Bacteria 898
83 Ga0105242_10815126 3300009176 Unclassified 925
84 Ga0105248_10130587 3300009177 Bacteria 2834
85 Ga0105248_10200743 3300009177 Bacteria 2247
86 Ga0105237_10029761 3300009545 Bacteria 5549
87 Ga0105246_10199752 3300011119 Unclassified 1553
88 Ga0157373_10087842 3300013100 Bacteria 2190
89 Ga0157371_10148504 3300013102 Bacteria 1671
90 Ga0157369_10165372 3300013105 Bacteria 2333
91 Ga0157369_10172932 3300013105 Bacteria 2275
92 Ga0157369_10246617 3300013105 Bacteria 1865
93 Ga0157369_10400759 3300013105 Bacteria 1423
94 Ga0163162_10470239 3300013306 Unclassified 1389
95 Ga0157372_10004242 3300013307 Bacteria 15325
96 Ga0157372_10225797 3300013307 Bacteria 2171
97 Ga0157372_10978465 3300013307 Bacteria 980
98 Ga0157372_11079399 3300013307 Bacteria 929
99 Ga0182008_10118530 3300014497 Bacteria 1314
100 Ga0206356_10618342 3300020070 Bacteria 2743
101 Ga0206356_10808595 3300020070 Bacteria 1927
102 Ga0206354_10839725 3300020081 Bacteria 1795
103 Ga0206353_10344104 3300020082 Bacteria 2751
104 Ga0206353_10921672 3300020082 Bacteria 2838
105 Ga0213871_10010382 3300021441 Bacteria 2111
106 Ga0207692_10001782 3300025898 Bacteria 8174
107 Ga0207692_10152315 3300025898 Bacteria 1325
108 Ga0207685_10003611 3300025905 Bacteria 3791
109 Ga0207699_10209064 3300025906 Bacteria 1326
110 Ga0207705_10066723 3300025909 Bacteria 2603
111 Ga0207705_10085996 3300025909 Bacteria 2297
112 Ga0207684_10163105 3300025910 Bacteria 1920
113 Ga0207707_10073852 3300025912 Bacteria 2974
114 Ga0207707_10279464 3300025912 Bacteria 1446
115 Ga0207707_10296634 3300025912 Bacteria 1398
116 Ga0207707_10433045 3300025912 Bacteria 1126
117 Ga0207695_10033668 3300025913 Bacteria 5583
118 Ga0207695_10043477 3300025913 Bacteria 4787
119 Ga0207693_10002770 3300025915 Bacteria 15175
120 Ga0207693_10004412 3300025915 Bacteria 11894
121 Ga0207693_10060470 3300025915 Unclassified 2968
122 Ga0207693_10284524 3300025915 Bacteria 1296
123 Ga0207663_10004334 3300025916 Bacteria 7044
124 Ga0207663_10202703 3300025916 Bacteria 1432
125 Ga0207660_10009208 3300025917 Bacteria 6388
126 Ga0207660_10054335 3300025917 Bacteria 2858
127 Ga0207660_10055534 3300025917 Bacteria 2830
128 Ga0207660_10375132 3300025917 Bacteria 1143
129 Ga0207657_10001500 3300025919 Bacteria 24976
130 Ga0207657_10011280 3300025919 Bacteria 8877
131 Ga0207657_10018943 3300025919 Bacteria 6552
132 Ga0207657_10131452 3300025919 Bacteria 2051
133 Ga0207649_10017821 3300025920 Bacteria 4028
134 Ga0207652_10272579 3300025921 Bacteria 1526
135 Ga0207646_10001697 3300025922 Bacteria 26787
136 Ga0207646_10040548 3300025922 Bacteria 4187
137 Ga0207646_10303347 3300025922 Bacteria 1443
138 Ga0207646_10595411 3300025922 Bacteria 993
139 Ga0207694_10151881 3300025924 Bacteria 1866
140 Ga0207687_10017580 3300025927 Bacteria 4710
141 Ga0207687_10120273 3300025927 Bacteria 1963
142 Ga0207687_10415766 3300025927 Bacteria 1109
143 Ga0207700_10000001 3300025928 Bacteria 1122509
144 Ga0207700_10071824 3300025928 Bacteria 2666
145 Ga0207700_10285954 3300025928 Bacteria 1420
146 Ga0207664_10009229 3300025929 Bacteria 6911
147 Ga0207664_10012781 3300025929 Bacteria 6011
148 Ga0207664_10016583 3300025929 Bacteria 5379
149 Ga0207664_10027542 3300025929 Bacteria 4310
150 Ga0207664_10099409 3300025929 Bacteria 2401
151 Ga0207664_10214574 3300025929 Bacteria 1666
152 Ga0207664_10240926 3300025929 Bacteria 1575
153 Ga0207664_10491924 3300025929 Bacteria 1098
154 Ga0207690_10022448 3300025932 Bacteria 3927
155 Ga0207690_10034422 3300025932 Bacteria 3265
156 Ga0207686_10503178 3300025934 Unclassified 940
157 Ga0207665_10000146 3300025939 Bacteria 47929
158 Ga0207665_10132664 3300025939 Bacteria 1770
159 Ga0207711_10276109 3300025941 Bacteria 1547
160 Ga0207661_10145193 3300025944 Bacteria 2046
161 Ga0207661_10390818 3300025944 Bacteria 1260
162 Ga0207667_10049590 3300025949 Bacteria 4433
163 Ga0207702_10105953 3300026078 Bacteria 2491
164 Ga0207702_10160988 3300026078 Bacteria 2050
165 Ga0207702_10171961 3300026078 Bacteria 1987
166 Ga0207698_10112655 3300026142 Bacteria 2284
167 Ga0207428_10081793 3300027907 Bacteria 2521
168 Ga0265326_10032046 3300028558 Bacteria 1497
169 Ga0265336_10001244 3300028666 Bacteria 12061
170 Ga0265338_10000634 3300028800 Bacteria 60990
171 Ga0265324_10023176 3300029957 Bacteria 2213
172 Ga0265327_10094343 3300031251 Bacteria 1454
173 Ga0373926_0012718 3300035083 Bacteria 2848
174 Ga0373956_0062371 3300035119 Bacteria 1690
175 Ga0373943_0018287 3300035170 Bacteria 3217
176 Ga0373946_0058907 3300035171 Bacteria 1628
177 Ga0373955_0158449 3300035172 Bacteria 1335
178 Ga0373935_0017246 3300035692 Bacteria 4378
179 Ga0373927_0135519 3300035695 Unclassified 1609
180 Ga0373947_0002722 3300035725 Bacteria 10609
181 Ga0373937_0000749 3300036401 Bacteria 28028
182 Ga0373937_0351253 3300036401 Bacteria 1397
183 Ga0373925_0007119 3300037068 Bacteria 8176
184 Ga0395899_0007905 3300037312 Bacteria 8191
185 Ga0395899_0017282 3300037312 Bacteria 5497
186 Ga0395899_0047075 3300037312 Bacteria 3211
187 Ga0395900_0016100 3300037418 Bacteria 7618
188 Ga0395900_0173757 3300037418 Bacteria 2192
189 Ga0395900_0205582 3300037418 Bacteria 1990
190 Ga0395898_0049594 3300037466 Bacteria 4112
191 Ga0395898_0105880 3300037466 Bacteria 2697
192 Ga0395898_0140449 3300037466 Bacteria 2312
193 Ga0395898_0168985 3300037466 Bacteria 2090
194 Ga0395898_0865953 3300037466 Bacteria 842
195 Ga0395905_0037999 3300037471 Bacteria 4516
196 Ga0395905_0101141 3300037471 Bacteria 2706
197 Ga0395901_0024557 3300038443 Bacteria 6189
198 Ga0395901_0335620 3300038443 Bacteria 1562
199 Ga0395901_0388770 3300038443 Bacteria 1435
200 Ga0436360_1186537 3300039438 Bacteria 2224
201 Ga0439461_0001799 3300041410 Bacteria 3367
202 Ga0439466_0019612 3300041411 Bacteria 2420
203 Ga0439448_0058868 3300042005 Bacteria 1268
204 Ga0439446_0010172 3300042156 Bacteria 2530
205 Ga0439434_0020347 3300042435 Bacteria 1992
206 Ga0466969_0056956 3300044656 Bacteria 1907
207 Ga0466972_0065954 3300044658 Bacteria 1731
208 Ga0466965_0100414 3300044683 Bacteria 1479
209 Ga0466966_0047383 3300044684 Bacteria 2741
210 Ga0466966_0100841 3300044684 Bacteria 1786
211 Ga0466966_0121000 3300044684 Bacteria 1608
212 Ga0466961_0005135 3300044693 Bacteria 8241
213 Ga0466961_0051918 3300044693 Bacteria 2617
214 Ga0466961_0055944 3300044693 Bacteria 2514
215 Ga0466961_0097448 3300044693 Bacteria 1854
216 Ga0466961_0141131 3300044693 Bacteria 1508
217 Ga0466961_0175682 3300044693 Bacteria 1331
218 Ga0466963_0000509 3300044694 Bacteria 18145
219 Ga0466963_0002832 3300044694 Bacteria 9778
220 Ga0466963_0002984 3300044694 Bacteria 9562
221 Ga0466963_0003177 3300044694 Bacteria 9336
222 Ga0466963_0004416 3300044694 Bacteria 8170
223 Ga0466963_0009139 3300044694 Bacteria 5960
224 Ga0466963_0015231 3300044694 Bacteria 4757
225 Ga0466963_0027849 3300044694 Bacteria 3623
226 Ga0466963_0405495 3300044694 Bacteria 961
227 Ga0466964_0013415 3300044706 Bacteria 3109
228 Ga0466964_0044291 3300044706 Bacteria 1807
229 Ga0466964_0063037 3300044706 Bacteria 1547
230 Ga0466964_0082157 3300044706 Bacteria 1385
231 Ga0466964_0107876 3300044706 Bacteria 1238
232 Ga0466971_0003402 3300044719 Bacteria 6799
233 Ga0466971_0007730 3300044719 Bacteria 4684
234 Ga0466971_0033390 3300044719 Unclassified 2306
235 Ga0466968_0002701 3300044735 Bacteria 6544
236 Ga0466968_0005662 3300044735 Bacteria 4681
237 Ga0466968_0005954 3300044735 Bacteria 4572
238 Ga0466968_0006897 3300044735 Bacteria 4300
239 Ga0466968_0054237 3300044735 Bacteria 1718
240 Ga0466968_0110481 3300044735 Bacteria 1236
241 Ga0466970_0103951 3300044765 Bacteria 1548
242 Ga0466957_0005648 3300044842 Bacteria 7033
243 Ga0466957_0040250 3300044842 Bacteria 2822
244 Ga0466957_0100686 3300044842 Bacteria 1821
245 Ga0466957_0129489 3300044842 Bacteria 1615
246 Ga0466957_0338875 3300044842 Bacteria 1018
247 Ga0466957_0343104 3300044842 Bacteria 1012
248 Ga0466960_0029581 3300044901 Bacteria 2514
249 Ga0466959_0000954 3300045049 Bacteria 17196
250 Ga0466959_0004218 3300045049 Bacteria 9581
251 Ga0466959_0036320 3300045049 Bacteria 3641
252 Ga0466959_0086580 3300045049 Bacteria 2254
253 Ga0466958_0003774 3300045836 Bacteria 7911
254 Ga0466958_0008219 3300045836 Bacteria 5779
255 Ga0466958_0012994 3300045836 Bacteria 4730
256 Ga0466958_0035555 3300045836 Bacteria 2976
257 Ga0466958_0061792 3300045836 Bacteria 2282
258 Ga0466958_0071491 3300045836 Bacteria 2124
259 Ga0466958_0269909 3300045836 Unclassified 1089
260 Ga0466967_0001619 3300045976 Bacteria 13298
261 Ga0466967_0010328 3300045976 Bacteria 6996
262 Ga0466967_0022778 3300045976 Bacteria 5121
263 Ga0466967_0023068 3300045976 Bacteria 5094
264 Ga0466967_0025556 3300045976 Bacteria 4872
265 Ga0466967_0028152 3300045976 Bacteria 4687
266 Ga0466967_0036162 3300045976 Bacteria 4213
267 Ga0466967_0053333 3300045976 Bacteria 3553
268 Ga0466967_0059527 3300045976 Bacteria 3381
269 Ga0466967_0066435 3300045976 Bacteria 3213
270 Ga0466967_0076873 3300045976 Bacteria 3003
271 Ga0466967_0452057 3300045976 Bacteria 1255
272 Ga0466967_0534813 3300045976 Bacteria 1153
273 Ga0495592_0000728 3300046454 Bacteria 23022
274 Ga0495592_0090876 3300046454 Bacteria 2190
275 Ga0495592_0130941 3300046454 Bacteria 1754
276 Ga0495592_0149811 3300046454 Bacteria 1614
277 Ga0495603_0084331 3300046455 Bacteria 1860
278 Ga0495629_0013827 3300046459 Bacteria 5823
279 Ga0495629_0039564 3300046459 Bacteria 3318
280 Ga0495629_0102088 3300046459 Bacteria 2001
281 Ga0495629_0110757 3300046459 Bacteria 1914
282 Ga0495629_0398226 3300046459 Bacteria 936
283 Ga0495641_0002937 3300046461 Bacteria 13135
284 Ga0495641_0036618 3300046461 Bacteria 2305
285 Ga0495651_0000699 3300046462 Bacteria 26062
286 Ga0495651_0101312 3300046462 Bacteria 2144
287 Ga0495651_0125131 3300046462 Bacteria 1883
288 Ga0495651_0307917 3300046462 Bacteria 1060
289 Ga0495653_0003907 3300046463 Bacteria 12046
290 Ga0495653_0014734 3300046463 Bacteria 6377
291 Ga0495653_0017700 3300046463 Bacteria 5794
292 Ga0495582_0005208 3300046473 Bacteria 7278
293 Ga0495582_0025283 3300046473 Bacteria 3253
294 Ga0495582_0046358 3300046473 Bacteria 2394
295 Ga0495582_0111581 3300046473 Bacteria 1536
296 Ga0495639_0000884 3300046475 Bacteria 13575
297 Ga0495639_0082052 3300046475 Bacteria 1503
298 Ga0495662_0061471 3300046476 Bacteria 1815
299 Ga0495664_0011016 3300046477 Bacteria 5087
300 Ga0495664_0098415 3300046477 Bacteria 1761
301 Ga0495664_0127244 3300046477 Bacteria 1541
302 Ga0495584_0005558 3300046491 Bacteria 6672
303 Ga0495585_0020222 3300046492 Unclassified 3831
304 Ga0495596_0014063 3300046500 Bacteria 3376
305 Ga0495607_0051350 3300046501 Bacteria 2395
306 Ga0495608_0004527 3300046511 Bacteria 9928
307 Ga0495608_0015640 3300046511 Bacteria 5256
308 Ga0495608_0021725 3300046511 Bacteria 4403
309 Ga0495608_0072399 3300046511 Bacteria 2248
310 Ga0495608_0087430 3300046511 Bacteria 2019
311 Ga0495618_0000821 3300046514 Bacteria 21621
312 Ga0495618_0025592 3300046514 Bacteria 3663
313 Ga0495618_0215703 3300046514 Bacteria 1212
314 Ga0495628_0001050 3300046516 Bacteria 25288
315 Ga0495628_0040439 3300046516 Bacteria 3725
316 Ga0495628_0074234 3300046516 Bacteria 2649
317 Ga0495628_0115267 3300046516 Bacteria 2064
318 Ga0495630_0040017 3300046517 Bacteria 3503
319 Ga0495644_0004445 3300046523 Bacteria 5510
320 Ga0495666_0000805 3300046526 Bacteria 14512
321 Ga0495642_0101592 3300046528 Unclassified 1224
322 Ga0495652_0000187 3300046529 Bacteria 70410
323 Ga0495652_0042347 3300046529 Bacteria 3926
324 Ga0495652_0363016 3300046529 Bacteria 1034
325 Ga0495652_0376819 3300046529 Unclassified 1010
326 Ga0495652_0545255 3300046529 Bacteria 798
327 Ga0495665_0000405 3300046531 Bacteria 21950
328 Ga0495640_0006118 3300046533 Bacteria 9537
329 Ga0495640_0018909 3300046533 Bacteria 5096
330 Ga0495640_0172374 3300046533 Bacteria 1382
331 Ga0495640_0215079 3300046533 Bacteria 1214
332 Ga0495586_0013048 3300046535 Bacteria 4403
333 Ga0495587_0000467 3300046536 Bacteria 28207
334 Ga0495587_0015392 3300046536 Bacteria 4778
335 Ga0495587_0070757 3300046536 Bacteria 2030
336 Ga0495587_0138506 3300046536 Bacteria 1390
337 Ga0495645_0000700 3300046543 Bacteria 22971
338 Ga0495645_0133134 3300046543 Bacteria 1740
339 Ga0495667_0062975 3300046559 Bacteria 2429
340 Ga0495667_0108487 3300046559 Bacteria 1793
341 Ga0495667_0137118 3300046559 Bacteria 1577
342 Ga0495667_0282397 3300046559 Bacteria 1054
343 Ga0495667_0389301 3300046559 Bacteria 879
344 Ga0495656_0001006 3300046615 Bacteria 9116
345 Ga0495634_0081804 3300046642 Bacteria 2111
346 Ga0495634_0162857 3300046642 Bacteria 1405
347 Ga0495611_0041905 3300046648 Bacteria 2043
348 Ga0495635_0033547 3300046663 Bacteria 3561
349 Ga0495635_0082515 3300046663 Bacteria 2200
350 Ga0495635_0124649 3300046663 Bacteria 1757
351 Ga0495657_0022627 3300046675 Bacteria 4499
352 Ga0495657_0030174 3300046675 Bacteria 3799
353 Ga0495657_0032144 3300046675 Bacteria 3664
354 Ga0495599_0000333 3300046678 Bacteria 28098
355 Ga0495599_0101465 3300046678 Bacteria 1793
356 Ga0495599_0110972 3300046678 Bacteria 1708
357 Ga0495599_0211265 3300046678 Bacteria 1189
358 Ga0495623_0000045 3300046679 Bacteria 76108
359 Ga0495623_0066260 3300046679 Bacteria 2257
360 Ga0495646_0008728 3300046680 Bacteria 6439
361 Ga0495646_0039572 3300046680 Bacteria 2906
362 Ga0495646_0064986 3300046680 Bacteria 2161
363 Ga0495647_0000812 3300046681 Bacteria 9337
364 Ga0495647_0219666 3300046681 Unclassified 838
365 Ga0495658_0002164 3300046683 Bacteria 9942
366 Ga0495658_0165164 3300046683 Bacteria 1367
367 Ga0495613_0025203 3300046689 Bacteria 4433
368 Ga0495613_0106164 3300046689 Bacteria 2027
369 Ga0495613_0168369 3300046689 Bacteria 1556
370 Ga0495624_0002634 3300046690 Bacteria 13546
371 Ga0495624_0177493 3300046690 Bacteria 1299
372 Ga0495589_0059912 3300046794 Bacteria 1870
373 Ga0495600_0021442 3300046809 Bacteria 4137
374 Ga0495600_0056786 3300046809 Bacteria 2558
375 Ga0495600_0099232 3300046809 Bacteria 1898
376 Ga0495581_0011410 3300047315 Bacteria 5142
377 Ga0495581_0309720 3300047315 Unclassified 923
378 Ga0495604_0000221 3300047317 Bacteria 52090
379 Ga0495604_0047092 3300047317 Bacteria 3360
380 Ga0495604_0051272 3300047317 Bacteria 3200
381 Ga0495674_0041238 3300047319 Bacteria 4125
382 Ga0495674_0082003 3300047319 Bacteria 2765
383 Ga0495674_0158000 3300047319 Bacteria 1898
384 Ga0495674_0248657 3300047319 Bacteria 1464
385 Ga0495676_0008212 3300047321 Bacteria 9573
386 Ga0495680_0019972 3300047322 Bacteria 5647
387 Ga0495680_0050910 3300047322 Bacteria 3237
388 Ga0495680_0066266 3300047322 Bacteria 2764
389 Ga0495675_0000301 3300047444 Bacteria 35499
390 Ga0495675_0188277 3300047444 Bacteria 1261
391 Ga0495677_0027006 3300047445 Bacteria 2083
392 Ga0495684_0002557 3300047471 Bacteria 14477
393 Ga0495684_0190744 3300047471 Bacteria 1515
394 Ga0495593_0000885 3300047673 Bacteria 17391
395 Ga0495593_0123998 3300047673 Bacteria 1314
396 Ga0495602_0000515 3300048088 Bacteria 36065
397 Ga0495602_0021011 3300048088 Bacteria 6435
398 Ga0495602_0239571 3300048088 Bacteria 1358
399 Ga0495614_0002129 3300048089 Bacteria 8761
400 Ga0496100_0030524 3300048903 Bacteria 3344
401 Ga0496100_0157306 3300048903 Bacteria 1626
402 Ga0496100_0233326 3300048903 Bacteria 1355
403 Ga0496100_0604074 3300048903 Unclassified 852
404 Ga0496101_0158572 3300048904 Bacteria 1734
405 Ga0496101_0239736 3300048904 Bacteria 1411
406 Ga0496102_0004845 3300048905 Bacteria 11383
407 Ga0496102_0043856 3300048905 Bacteria 4057
408 Ga0496102_0141945 3300048905 Bacteria 2252
409 Ga0496103_0004250 3300048906 Bacteria 8703
410 Ga0496103_0221410 3300048906 Bacteria 1217
411 Ga0496104_0052566 3300048907 Bacteria 3848
412 Ga0496104_0132089 3300048907 Bacteria 2398
413 Ga0496104_0386649 3300048907 Bacteria 1311
414 Ga0496104_0511285 3300048907 Bacteria 1112
415 Ga0496105_0020837 3300048908 Bacteria 5300
416 Ga0496105_0027306 3300048908 Bacteria 4661
417 Ga0496105_0027402 3300048908 Bacteria 4654
418 Ga0496105_0130781 3300048908 Bacteria 2069
419 Ga0496106_0006189 3300048909 Bacteria 8851
420 Ga0496106_0007431 3300048909 Bacteria 8096
421 Ga0496107_0013110 3300048910 Bacteria 5791
422 Ga0496107_0013191 3300048910 Bacteria 5773
423 Ga0496107_0100618 3300048910 Bacteria 2119
424 Ga0496107_0301768 3300048910 Bacteria 1192
425 Ga0496108_0020497 3300048911 Bacteria 5436
426 Ga0496108_0042298 3300048911 Bacteria 3803
427 Ga0496108_0109438 3300048911 Bacteria 2361
428 Ga0496108_0194226 3300048911 Bacteria 1760
429 Ga0496108_0257195 3300048911 Bacteria 1519
430 Ga0496109_0006259 3300048912 Bacteria 10010
431 Ga0496109_0048867 3300048912 Bacteria 3849
432 Ga0496109_0050778 3300048912 Bacteria 3776
433 Ga0496109_0199391 3300048912 Bacteria 1881
434 Ga0496109_0427886 3300048912 Bacteria 1250
435 Ga0496109_0428331 3300048912 Bacteria 1250
436 Ga0496109_0602042 3300048912 Bacteria 1035
437 Ga0496110_0032321 3300048913 Bacteria 4518
438 Ga0496110_0200499 3300048913 Bacteria 1813
439 Ga0496110_0263020 3300048913 Bacteria 1570
440 Ga0496111_0009210 3300048914 Bacteria 6577
441 Ga0496111_0020271 3300048914 Bacteria 4627
442 Ga0496111_0490328 3300048914 Unclassified 905
443 Ga0496112_0005722 3300048915 Bacteria 10802
444 Ga0496112_0097441 3300048915 Bacteria 2911
445 Ga0496112_0228512 3300048915 Bacteria 1815
446 Ga0496112_0263921 3300048915 Bacteria 1671
447 Ga0496112_0376212 3300048915 Bacteria 1361
448 Ga0496112_0634646 3300048915 Bacteria 999
449 Ga0496113_0017965 3300048916 Bacteria 4918
450 Ga0496113_0172640 3300048916 Bacteria 1712
451 Ga0496113_0275532 3300048916 Bacteria 1345
452 Ga0496113_0282321 3300048916 Unclassified 1328
453 Ga0496113_0500570 3300048916 Bacteria 975
454 Ga0496114_0000875 3300048917 Bacteria 22544
455 Ga0496114_0167741 3300048917 Bacteria 1912
456 Ga0496115_0023125 3300048918 Bacteria 4822
457 Ga0496115_0066764 3300048918 Bacteria 2907
458 Ga0496115_0177306 3300048918 Bacteria 1762
459 Ga0496115_0260957 3300048918 Bacteria 1425
460 Ga0496115_0316317 3300048918 Bacteria 1277
461 Ga0501040_0272813 3300049576 Bacteria 1208
462 Ga0501067_0007599 3300049583 Bacteria 6027
463 Ga0501067_0288572 3300049583 Bacteria 914
464 Ga0501069_0131253 3300049585 Bacteria 1434
465 Ga0501080_0415619 3300049742 Bacteria 1209
466 nmdc:mga05p37_244586_c1 3300050507 Bacteria 2155
467 nmdc:mga0n895_277792_c1 3300050512 Unclassified 1699
468 nmdc:mga08x19_203560_c2 3300050514 Bacteria 988
469 nmdc:mga0a205_202268_c1 3300050515 Bacteria 1876
470 Ga0495601_0000835 3300053077 Bacteria 16726
471 Ga0495601_0039309 3300053077 Bacteria 2962
472 Ga0495601_0050995 3300053077 Bacteria 2611
473 Ga0495612_0012105 3300053078 Bacteria 3475
474 Ga0495612_0049735 3300053078 Bacteria 1720
475 Ga0495612_0057387 3300053078 Bacteria 1607
476 Ga0495595_0001818 3300053084 Bacteria 8308
477 Ga0495595_0021928 3300053084 Bacteria 2797
478 Ga0495595_0027727 3300053084 Bacteria 2525
479 Ga0495619_0002607 3300053085 Bacteria 11776
480 Ga0495619_0009681 3300053085 Bacteria 6077
481 Ga0495619_0087335 3300053085 Bacteria 2108
482 Ga0495619_0441993 3300053085 Bacteria 897
483 Ga0500566_0121140 3300053094 Bacteria 1410
484 Ga0466962_0001475 3300061719 Bacteria 10974
485 Ga0466962_0002758 3300061719 Bacteria 8343
486 Ga0466962_0018080 3300061719 Bacteria 3390
487 Ga0466962_0156098 3300061719 Bacteria 1108
488 Ga0496100_0321517
489 Ga0070658_10010792
490 Ga0070658_10105178
491 Ga0070658_10303493
492 Ga0070683_100165715
493 Ga0070683_100176122
494 Ga0070683_100255862
495 Ga0070680_100008021
496 Ga0070680_100046353
497 Ga0070682_100339738
498 Ga0070660_100009146
499 Ga0070660_100050245
500 Ga0070660_100244036
501 Ga0070691_10106712
502 Ga0070661_100086971
503 Ga0070659_100021109
504 Ga0070659_100040246
505 Ga0070709_10002809
506 Ga0070709_10021675
507 Ga0070714_100003527
508 Ga0070714_100023668
509 Ga0070714_100026013
510 Ga0070714_100027041
511 Ga0070714_100055596
512 Ga0070714_100070339
513 Ga0070714_100102655
514 Ga0070714_100170214
515 Ga0070714_100227358
516 Ga0070713_100016962
517 Ga0070713_100025105
518 Ga0070713_100217958
519 Ga0070710_10000749
520 Ga0070710_10002519
521 Ga0070711_100202882
522 Ga0070681_10013001
523 Ga0070681_10027893
524 Ga0070681_10058465
525 Ga0070681_10637818
526 Ga0070707_100001390
527 Ga0070707_100139653
528 Ga0070707_100281309
529 Ga0070698_100005754
530 Ga0070698_100150898
531 Ga0070698_100268835
532 Ga0070698_100308071
533 Ga0070679_100060794
534 Ga0070679_100171155
535 Ga0070679_100307173
536 Ga0070679_100324423
537 Ga0070684_100077152
538 Ga0070695_100000473
539 Ga0070695_100402562
540 Ga0070696_100317980
541 Ga0068855_100005085
542 Ga0068855_100112540
543 Ga0068855_100241256
544 Ga0070664_100381957
545 Ga0068856_100096345
546 Ga0068856_100255675
547 Ga0068852_100452905
548 Ga0070717_10001905
549 Ga0070717_10031394
550 Ga0070717_10044708
551 Ga0070717_10108071
552 Ga0070717_10238325
553 Ga0075432_10026358
554 Ga0070715_10000369
555 Ga0070716_100124654
556 Ga0070712_100105963
557 Ga0097621_100224785
558 Ga0075433_10127409
559 Ga0075434_100006835
560 Ga0075436_100413957
561 Ga0105240_10004954
562 Ga0105240_10011632
563 Ga0105240_10553222
564 Ga0111539_10151489
565 Ga0105245_10119429
566 Ga0105245_10171091
567 Ga0105245_10492974
568 Ga0114129_10257176
569 Ga0105241_10745324
570 Ga0105242_10815126
571 Ga0105248_10130587
572 Ga0105248_10200743
573 Ga0105237_10029761
574 Ga0105246_10199752
575 Ga0157373_10087842
576 Ga0157371_10148504
577 Ga0157369_10165372
578 Ga0157369_10172932
579 Ga0157369_10246617
580 Ga0157369_10400759
581 Ga0163162_10470239
582 Ga0157372_10004242
583 Ga0157372_10225797
584 Ga0157372_10978465
585 Ga0157372_11079399
586 Ga0182008_10118530
587 Ga0206356_10618342
588 Ga0206356_10808595
589 Ga0206354_10839725
590 Ga0206353_10344104
591 Ga0206353_10921672
592 Ga0213871_10010382
593 Ga0207692_10001782
594 Ga0207692_10152315
595 Ga0207685_10003611
596 Ga0207699_10209064
597 Ga0207705_10066723
598 Ga0207705_10085996
599 Ga0207684_10163105
600 Ga0207707_10073852
601 Ga0207707_10279464
602 Ga0207707_10296634
603 Ga0207707_10433045
604 Ga0207695_10033668
605 Ga0207695_10043477
606 Ga0207693_10002770
607 Ga0207693_10004412
608 Ga0207693_10060470
609 Ga0207693_10284524
610 Ga0207663_10004334
611 Ga0207663_10202703
612 Ga0207660_10009208
613 Ga0207660_10054335
614 Ga0207660_10055534
615 Ga0207660_10375132
616 Ga0207657_10001500
617 Ga0207657_10011280
618 Ga0207657_10018943
619 Ga0207657_10131452
620 Ga0207649_10017821
621 Ga0207652_10272579
622 Ga0207646_10001697
623 Ga0207646_10040548
624 Ga0207646_10303347
625 Ga0207646_10595411
626 Ga0207694_10151881
627 Ga0207687_10017580
628 Ga0207687_10120273
629 Ga0207687_10415766
630 Ga0207700_10000001
631 Ga0207700_10071824
632 Ga0207700_10285954
633 Ga0207664_10009229
634 Ga0207664_10012781
635 Ga0207664_10016583
636 Ga0207664_10027542
637 Ga0207664_10099409
638 Ga0207664_10214574
639 Ga0207664_10240926
640 Ga0207664_10491924
641 Ga0207690_10022448
642 Ga0207690_10034422
643 Ga0207686_10503178
644 Ga0207665_10000146
645 Ga0207665_10132664
646 Ga0207711_10276109
647 Ga0207661_10145193
648 Ga0207661_10390818
649 Ga0207667_10049590
650 Ga0207702_10105953
651 Ga0207702_10160988
652 Ga0207702_10171961
653 Ga0207698_10112655
654 Ga0207428_10081793
655 Ga0265326_10032046
656 Ga0265336_10001244
657 Ga0265338_10000634
658 Ga0265324_10023176
659 Ga0265327_10094343
660 Ga0373926_0012718
661 Ga0373956_0062371
662 Ga0373943_0018287
663 Ga0373946_0058907
664 Ga0373955_0158449
665 Ga0373935_0017246
666 Ga0373927_0135519
667 Ga0373947_0002722
668 Ga0373937_0000749
669 Ga0373937_0351253
670 Ga0373925_0007119
671 Ga0395899_0007905
672 Ga0395899_0017282
673 Ga0395899_0047075
674 Ga0395900_0016100
675 Ga0395900_0173757
676 Ga0395900_0205582
677 Ga0395898_0049594
678 Ga0395898_0105880
679 Ga0395898_0140449
680 Ga0395898_0168985
681 Ga0395898_0865953
682 Ga0395905_0037999
683 Ga0395905_0101141
684 Ga0395901_0024557
685 Ga0395901_0335620
686 Ga0395901_0388770
687 Ga0436360_1186537
688 Ga0439461_0001799
689 Ga0439466_0019612
690 Ga0439448_0058868
691 Ga0439446_0010172
692 Ga0439434_0020347
693 Ga0466969_0056956
694 Ga0466972_0065954
695 Ga0466965_0100414
696 Ga0466966_0047383
697 Ga0466966_0100841
698 Ga0466966_0121000
699 Ga0466961_0005135
700 Ga0466961_0051918
701 Ga0466961_0055944
702 Ga0466961_0097448
703 Ga0466961_0141131
704 Ga0466961_0175682
705 Ga0466963_0000509
706 Ga0466963_0002832
707 Ga0466963_0002984
708 Ga0466963_0003177
709 Ga0466963_0004416
710 Ga0466963_0009139
711 Ga0466963_0015231
712 Ga0466963_0027849
713 Ga0466963_0405495
714 Ga0466964_0013415
715 Ga0466964_0044291
716 Ga0466964_0063037
717 Ga0466964_0082157
718 Ga0466964_0107876
719 Ga0466971_0003402
720 Ga0466971_0007730
721 Ga0466971_0033390
722 Ga0466968_0002701
723 Ga0466968_0005662
724 Ga0466968_0005954
725 Ga0466968_0006897
726 Ga0466968_0054237
727 Ga0466968_0110481
728 Ga0466970_0103951
729 Ga0466957_0005648
730 Ga0466957_0040250
731 Ga0466957_0100686
732 Ga0466957_0129489
733 Ga0466957_0338875
734 Ga0466957_0343104
735 Ga0466960_0029581
736 Ga0466959_0000954
737 Ga0466959_0004218
738 Ga0466959_0036320
739 Ga0466959_0086580
740 Ga0466958_0003774
741 Ga0466958_0008219
742 Ga0466958_0012994
743 Ga0466958_0035555
744 Ga0466958_0061792
745 Ga0466958_0071491
746 Ga0466958_0269909
747 Ga0466967_0001619
748 Ga0466967_0010328
749 Ga0466967_0022778
750 Ga0466967_0023068
751 Ga0466967_0025556
752 Ga0466967_0028152
753 Ga0466967_0036162
754 Ga0466967_0053333
755 Ga0466967_0059527
756 Ga0466967_0066435
757 Ga0466967_0076873
758 Ga0466967_0452057
759 Ga0466967_0534813
760 Ga0495592_0000728
761 Ga0495592_0090876
762 Ga0495592_0130941
763 Ga0495592_0149811
764 Ga0495603_0084331
765 Ga0495629_0013827
766 Ga0495629_0039564
767 Ga0495629_0102088
768 Ga0495629_0110757
769 Ga0495629_0398226
770 Ga0495641_0002937
771 Ga0495641_0036618
772 Ga0495651_0000699
773 Ga0495651_0101312
774 Ga0495651_0125131
775 Ga0495651_0307917
776 Ga0495653_0003907
777 Ga0495653_0014734
778 Ga0495653_0017700
779 Ga0495582_0005208
780 Ga0495582_0025283
781 Ga0495582_0046358
782 Ga0495582_0111581
783 Ga0495639_0000884
784 Ga0495639_0082052
785 Ga0495662_0061471
786 Ga0495664_0011016
787 Ga0495664_0098415
788 Ga0495664_0127244
789 Ga0495584_0005558
790 Ga0495585_0020222
791 Ga0495596_0014063
792 Ga0495607_0051350
793 Ga0495608_0004527
794 Ga0495608_0015640
795 Ga0495608_0021725
796 Ga0495608_0072399
797 Ga0495608_0087430
798 Ga0495618_0000821
799 Ga0495618_0025592
800 Ga0495618_0215703
801 Ga0495628_0001050
802 Ga0495628_0040439
803 Ga0495628_0074234
804 Ga0495628_0115267
805 Ga0495630_0040017
806 Ga0495644_0004445
807 Ga0495666_0000805
808 Ga0495642_0101592
809 Ga0495652_0000187
810 Ga0495652_0042347
811 Ga0495652_0363016
812 Ga0495652_0376819
813 Ga0495652_0545255
814 Ga0495665_0000405
815 Ga0495640_0006118
816 Ga0495640_0018909
817 Ga0495640_0172374
818 Ga0495640_0215079
819 Ga0495586_0013048
820 Ga0495587_0000467
821 Ga0495587_0015392
822 Ga0495587_0070757
823 Ga0495587_0138506
824 Ga0495645_0000700
825 Ga0495645_0133134
826 Ga0495667_0062975
827 Ga0495667_0108487
828 Ga0495667_0137118
829 Ga0495667_0282397
830 Ga0495667_0389301
831 Ga0495656_0001006
832 Ga0495634_0081804
833 Ga0495634_0162857
834 Ga0495611_0041905
835 Ga0495635_0033547
836 Ga0495635_0082515
837 Ga0495635_0124649
838 Ga0495657_0022627
839 Ga0495657_0030174
840 Ga0495657_0032144
841 Ga0495599_0000333
842 Ga0495599_0101465
843 Ga0495599_0110972
844 Ga0495599_0211265
845 Ga0495623_0000045
846 Ga0495623_0066260
847 Ga0495646_0008728
848 Ga0495646_0039572
849 Ga0495646_0064986
850 Ga0495647_0000812
851 Ga0495647_0219666
852 Ga0495658_0002164
853 Ga0495658_0165164
854 Ga0495613_0025203
855 Ga0495613_0106164
856 Ga0495613_0168369
857 Ga0495624_0002634
858 Ga0495624_0177493
859 Ga0495589_0059912
860 Ga0495600_0021442
861 Ga0495600_0056786
862 Ga0495600_0099232
863 Ga0495581_0011410
864 Ga0495581_0309720
865 Ga0495604_0000221
866 Ga0495604_0047092
867 Ga0495604_0051272
868 Ga0495674_0041238
869 Ga0495674_0082003
870 Ga0495674_0158000
871 Ga0495674_0248657
872 Ga0495676_0008212
873 Ga0495680_0019972
874 Ga0495680_0050910
875 Ga0495680_0066266
876 Ga0495675_0000301
877 Ga0495675_0188277
878 Ga0495677_0027006
879 Ga0495684_0002557
880 Ga0495684_0190744
881 Ga0495593_0000885
882 Ga0495593_0123998
883 Ga0495602_0000515
884 Ga0495602_0021011
885 Ga0495602_0239571
886 Ga0495614_0002129
887 Ga0496100_0030524
888 Ga0496100_0157306
889 Ga0496100_0233326
890 Ga0496100_0604074
891 Ga0496101_0158572
892 Ga0496101_0239736
893 Ga0496102_0004845
894 Ga0496102_0043856
895 Ga0496102_0141945
896 Ga0496103_0004250
897 Ga0496103_0221410
898 Ga0496104_0052566
899 Ga0496104_0132089
900 Ga0496104_0386649
901 Ga0496104_0511285
902 Ga0496105_0020837
903 Ga0496105_0027306
904 Ga0496105_0027402
905 Ga0496105_0130781
906 Ga0496106_0006189
907 Ga0496106_0007431
908 Ga0496107_0013110
909 Ga0496107_0013191
910 Ga0496107_0100618
911 Ga0496107_0301768
912 Ga0496108_0020497
913 Ga0496108_0042298
914 Ga0496108_0109438
915 Ga0496108_0194226
916 Ga0496108_0257195
917 Ga0496109_0006259
918 Ga0496109_0048867
919 Ga0496109_0050778
920 Ga0496109_0199391
921 Ga0496109_0427886
922 Ga0496109_0428331
923 Ga0496109_0602042
924 Ga0496110_0032321
925 Ga0496110_0200499
926 Ga0496110_0263020
927 Ga0496111_0009210
928 Ga0496111_0020271
929 Ga0496111_0490328
930 Ga0496112_0005722
931 Ga0496112_0097441
932 Ga0496112_0228512
933 Ga0496112_0263921
934 Ga0496112_0376212
935 Ga0496112_0634646
936 Ga0496113_0017965
937 Ga0496113_0172640
938 Ga0496113_0275532
939 Ga0496113_0282321
940 Ga0496113_0500570
941 Ga0496114_0000875
942 Ga0496114_0167741
943 Ga0496115_0023125
944 Ga0496115_0066764
945 Ga0496115_0177306
946 Ga0496115_0260957
947 Ga0496115_0316317
948 Ga0501040_0272813
949 Ga0501067_0007599
950 Ga0501067_0288572
951 Ga0501069_0131253
952 Ga0501080_0415619
953 nmdc:mga05p37_244586_c1
954 nmdc:mga0n895_277792_c1
955 nmdc:mga08x19_203560_c2
956 nmdc:mga0a205_202268_c1
957 Ga0495601_0000835
958 Ga0495601_0039309
959 Ga0495601_0050995
960 Ga0495612_0012105
961 Ga0495612_0049735
962 Ga0495612_0057387
963 Ga0495595_0001818
964 Ga0495595_0021928
965 Ga0495595_0027727
966 Ga0495619_0002607
967 Ga0495619_0009681
968 Ga0495619_0087335
969 Ga0495619_0441993
970 Ga0500566_0121140
971 Ga0466962_0001475
972 Ga0466962_0002758
973 Ga0466962_0018080
974 Ga0466962_0156098

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00230

MIP

Major intrinsic protein

25

236

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
7cjs-assembly2.cif.gz_E structure of aquaporin 0.9337 2 208
5i32-assembly1.cif.gz_A ammonia permeable aquaporin attip2;1 0.9265 2 210
2evu-assembly1.cif.gz_A crystal structure of aquaporin aqpm at 2.3a resolution 0.9247 2 208
3ne2-assembly1.cif.gz_D archaeoglobus fulgidus aquaporin 0.9174 1 208
4csk-assembly1.cif.gz_A human aquaporin 0.9147 2 208
ID Description Score Start End Superfamily
af_Q84S07_26_278_1.20.1080.10 Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. 0.9442 2 208 1.20.1080.10
af_A0A1D6J0S8_31_279_1.20.1080.10 Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. 0.9369 5 208 1.20.1080.10
af_Q9ATN2_41_273_1.20.1080.10 Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. 0.9337 5 208 1.20.1080.10
3ne2C00 Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. 0.9317 1 208 1.20.1080.10
af_Q8W036_4_264_1.20.1080.10 Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. 0.9304 2 208 1.20.1080.10
ID Description Score Start End GO Terms
AF-A0A537VBU4-F1-model_v4 Aquaporin 0.9554 5 213 GO:0005886
GO:0015250
AF-A0A7C1KF49-F1-model_v4 Aquaporin 0.9536 5 213 GO:0012505
GO:0015250
GO:0016020
AF-A0A6J4VGG8-F1-model_v4 Aquaporin Z 0.9483 2 208 GO:0015267
GO:0016020
AF-A0A6P5HME0-F1-model_v4 Trinucleotide repeat-containing gene 18 protein-like 0.9472 2 208 GO:0015267
GO:0016020
AF-A0A6M3SLC5-F1-model_v4 Major intrinsic family protein 0.9458 5 211 GO:0005886
GO:0015250

Map