F453417

General Info

Members Datasets Scaffolds Average Seq Length
487 184 974 171

Family's Representative Sequence

Representative Sequence 3300005618|Ga0068864_100009758|Ga0068864_1000097587
Length 192
Sequence MCRHLVSRILSVARIAREEMRPIVITGFMGCGKSKVARALARRLDVPVIDLDDVITARQGRTPAQLITEEGEPAFRTIESNTLRETLESISAGVIALGGGAWIEETNRDLIDQRGCLSVWLDVPFEVCWGRIKTSEEDRPLGRTREQALRLYKRRKPIYQLAAIHAQRMADDKLEDFISRIEHKIVSHRFHR

Samples

Sample ID Description Type Environment
1 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
7 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
11 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
24 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
25 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
34 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
64 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
65 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
71 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
75 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
76 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
77 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
78 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
79 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
92 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
93 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
96 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
97 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
98 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
99 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
100 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
101 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
102 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
103 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
104 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
105 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
106 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
107 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
108 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
109 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
150 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
154 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
155 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
156 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
157 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
158 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
159 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
160 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
161 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
162 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
163 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
164 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
165 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
166 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
167 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
168 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
169 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
170 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
171 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
172 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
173 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
174 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
175 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
176 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
177 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
178 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
179 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
180 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
181 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
182 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
183 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
184 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.44
Rhizosphere 98.15
Stem 0
Stem Tuber 0
Unclassified 26.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068864_100009758 3300005618 Bacteria 7918
2 SwRhRL2b_contig_719158 2162886007 Bacteria 1901
3 MRS1b_contig_4784088 2162886011 Unclassified 2037
4 MBSR1b_contig_13912214 2162886012 Bacteria 1208
5 JGI24737J22298_10079992 3300001990 Unclassified 973
6 JGI24751J29686_10000122 3300002459 Bacteria 39084
7 JGI25406J46586_10042841 3300003203 Unclassified 1581
8 rootL2_10082220 3300003322 Unclassified 1389
9 rootL2_10247141 3300003322 Unclassified 2366
10 Ga0065714_10064481 3300005288 Bacteria 54282
11 Ga0065704_10004948 3300005289 Bacteria 4066
12 Ga0065712_10000143 3300005290 Bacteria 54339
13 Ga0065712_10018212 3300005290 Bacteria 2322
14 Ga0065712_10343784 3300005290 Bacteria 797
15 Ga0065712_10457170 3300005290 Bacteria 681
16 Ga0065715_10012945 3300005293 Bacteria 2561
17 Ga0065715_10089930 3300005293 Bacteria 8098
18 Ga0065715_10090500 3300005293 Bacteria 6901
19 Ga0065715_10103281 3300005293 Bacteria 3038
20 Ga0065715_10195392 3300005293 Bacteria 1391
21 Ga0065715_10297577 3300005293 Bacteria 1049
22 Ga0065715_10420474 3300005293 Viruses 858
23 Ga0065707_10003314 3300005295 Bacteria 4596
24 Ga0065707_10880420 3300005295 Unclassified 573
25 Ga0070676_10585180 3300005328 Bacteria 803
26 Ga0070690_100032014 3300005330 Unclassified 3280
27 Ga0070690_100603062 3300005330 Unclassified 834
28 Ga0070670_100000741 3300005331 Bacteria 25354
29 Ga0070670_100027782 3300005331 Bacteria 4868
30 Ga0070670_100098350 3300005331 Bacteria 2518
31 Ga0068869_100016022 3300005334 Bacteria 5045
32 Ga0068869_100062558 3300005334 Bacteria 2732
33 Ga0068869_100302352 3300005334 Bacteria 1292
34 Ga0068869_100518329 3300005334 Bacteria 997
35 Ga0068869_100974217 3300005334 Unclassified 737
36 Ga0070666_10125629 3300005335 Bacteria 1781
37 Ga0070666_10346558 3300005335 Bacteria 1062
38 Ga0070680_100910771 3300005336 Unclassified 759
39 Ga0070682_100003344 3300005337 Bacteria 8889
40 Ga0070682_100169854 3300005337 Bacteria 1514
41 Ga0068868_100618164 3300005338 Bacteria 962
42 Ga0070689_100000613 3300005340 Bacteria 21607
43 Ga0070689_100511060 3300005340 Unclassified 1030
44 Ga0070691_10375439 3300005341 Unclassified 795
45 Ga0070687_100086226 3300005343 Bacteria 1725
46 Ga0070692_10283135 3300005345 Bacteria 1005
47 Ga0070692_10488944 3300005345 Bacteria 795
48 Ga0070669_100127608 3300005353 Bacteria 1948
49 Ga0070675_100330375 3300005354 Bacteria 1348
50 Ga0070675_100425189 3300005354 Bacteria 1188
51 Ga0070675_100477848 3300005354 Bacteria 1120
52 Ga0070675_100594794 3300005354 Bacteria 1003
53 Ga0070671_100020820 3300005355 Bacteria 5350
54 Ga0070671_100033216 3300005355 Unclassified 4266
55 Ga0070671_100061248 3300005355 Unclassified 3134
56 Ga0070673_100016373 3300005364 Bacteria 5240
57 Ga0070673_100182754 3300005364 Bacteria 1796
58 Ga0070673_100431272 3300005364 Unclassified 1183
59 Ga0070673_100760332 3300005364 Unclassified 893
60 Ga0070673_100915420 3300005364 Unclassified 814
61 Ga0070688_100167815 3300005365 Bacteria 1512
62 Ga0070688_100507646 3300005365 Bacteria 910
63 Ga0070659_100002144 3300005366 Bacteria 14057
64 Ga0070659_100028014 3300005366 Bacteria 4346
65 Ga0070667_100269930 3300005367 Bacteria 1525
66 Ga0070703_10108892 3300005406 Bacteria 988
67 Ga0070701_10116611 3300005438 Bacteria 1499
68 Ga0070701_10135744 3300005438 Bacteria 1402
69 Ga0070701_10231238 3300005438 Bacteria 1107
70 Ga0070705_100063046 3300005440 Bacteria 2210
71 Ga0070705_100219765 3300005440 Bacteria 1315
72 Ga0070705_100273089 3300005440 Unclassified 1198
73 Ga0070700_100011758 3300005441 Bacteria 4858
74 Ga0070700_100034087 3300005441 Bacteria 3072
75 Ga0070700_101268788 3300005441 Unclassified 618
76 Ga0070694_100229334 3300005444 Bacteria 1396
77 Ga0070694_100396587 3300005444 Bacteria 1079
78 Ga0070662_100138166 3300005457 Bacteria 1886
79 Ga0070681_10000519 3300005458 Bacteria 31501
80 Ga0070681_10001374 3300005458 Bacteria 21319
81 Ga0070681_10307692 3300005458 Bacteria 1494
82 Ga0068867_100015645 3300005459 Bacteria 5381
83 Ga0068867_100137190 3300005459 Bacteria 1908
84 Ga0068867_100215770 3300005459 Bacteria 1543
85 Ga0068867_100737192 3300005459 Unclassified 873
86 Ga0068867_100765362 3300005459 Unclassified 858
87 Ga0070707_100034904 3300005468 Bacteria 4795
88 Ga0070698_100009468 3300005471 Bacteria 10435
89 Ga0070698_100120474 3300005471 Unclassified 2584
90 Ga0070698_101204773 3300005471 Bacteria 706
91 Ga0070699_100001980 3300005518 Bacteria 18475
92 Ga0070699_100020120 3300005518 Bacteria 5752
93 Ga0070699_100601875 3300005518 Unclassified 1002
94 Ga0070679_100011845 3300005530 Bacteria 8321
95 Ga0070679_100967380 3300005530 Unclassified 795
96 Ga0070684_100693567 3300005535 Bacteria 949
97 Ga0070684_100752300 3300005535 Bacteria 910
98 Ga0070697_100010501 3300005536 Bacteria 7228
99 Ga0068853_100061008 3300005539 Unclassified 3261
100 Ga0070672_100062570 3300005543 Unclassified 2937
101 Ga0070672_100999852 3300005543 Unclassified 741
102 Ga0070686_100458125 3300005544 Bacteria 982
103 Ga0070695_100153754 3300005545 Bacteria 1608
104 Ga0070696_100059250 3300005546 Bacteria 2676
105 Ga0070696_100782156 3300005546 Unclassified 784
106 Ga0070693_100191842 3300005547 Bacteria 1322
107 Ga0070693_100859301 3300005547 Bacteria 677
108 Ga0070665_100038737 3300005548 Bacteria 4792
109 Ga0070665_101520494 3300005548 Unclassified 678
110 Ga0070704_100026915 3300005549 Bacteria 3807
111 Ga0070704_100133598 3300005549 Bacteria 1927
112 Ga0070704_100370843 3300005549 Unclassified 1214
113 Ga0070704_100538884 3300005549 Bacteria 1018
114 Ga0070704_100719650 3300005549 Bacteria 887
115 Ga0068855_100371554 3300005563 Bacteria 1572
116 Ga0068855_101234271 3300005563 Viruses 776
117 Ga0070664_100001726 3300005564 Bacteria 17495
118 Ga0070664_100123075 3300005564 Bacteria 2273
119 Ga0070664_100663660 3300005564 Bacteria 970
120 Ga0068857_100003047 3300005577 Bacteria 13864
121 Ga0068857_100109791 3300005577 Bacteria 2479
122 Ga0068857_100823524 3300005577 Bacteria 887
123 Ga0068854_100122927 3300005578 Bacteria 1973
124 Ga0068854_100763315 3300005578 Bacteria 840
125 Ga0068856_100914110 3300005614 Bacteria 896
126 Ga0070702_100015173 3300005615 Bacteria 3927
127 Ga0070702_100034189 3300005615 Bacteria 2801
128 Ga0070702_100177757 3300005615 Unclassified 1390
129 Ga0070702_100836485 3300005615 Unclassified 715
130 Ga0068852_100050604 3300005616 Bacteria 3560
131 Ga0068852_100701517 3300005616 Unclassified 1022
132 Ga0068859_100004920 3300005617 Bacteria 13585
133 Ga0068859_100022227 3300005617 Bacteria 6359
134 Ga0068859_100033615 3300005617 Bacteria 5150
135 Ga0068859_100080667 3300005617 Unclassified 3295
136 Ga0068859_100104127 3300005617 Unclassified 2897
137 Ga0068859_100121893 3300005617 Bacteria 2674
138 Ga0068859_100169446 3300005617 Bacteria 2264
139 Ga0068859_100375243 3300005617 Bacteria 1518
140 Ga0068859_100405479 3300005617 Bacteria 1459
141 Ga0068859_100451570 3300005617 Unclassified 1381
142 Ga0068859_100519675 3300005617 Bacteria 1285
143 Ga0068859_100752936 3300005617 Bacteria 1063
144 Ga0068859_101170335 3300005617 Unclassified 846
145 Ga0068859_101697320 3300005617 Bacteria 698
146 Ga0068864_100010311 3300005618 Bacteria 7716
147 Ga0068864_100022120 3300005618 Bacteria 5330
148 Ga0068864_100022306 3300005618 Bacteria 5308
149 Ga0068864_100024326 3300005618 Bacteria 5094
150 Ga0068864_100221609 3300005618 Bacteria 1745
151 Ga0068864_100450014 3300005618 Unclassified 1231
152 Ga0068864_100577591 3300005618 Bacteria 1089
153 Ga0068864_100874497 3300005618 Bacteria 886
154 Ga0068864_101097678 3300005618 Unclassified 792
155 Ga0068866_10129408 3300005718 Bacteria 1434
156 Ga0068861_100608152 3300005719 Bacteria 1004
157 Ga0068861_100701603 3300005719 Unclassified 940
158 Ga0068870_10023609 3300005840 Bacteria 3034
159 Ga0068870_10047065 3300005840 Unclassified 2265
160 Ga0068870_10086032 3300005840 Bacteria 1748
161 Ga0068870_10180931 3300005840 Unclassified 1265
162 Ga0068870_10233984 3300005840 Bacteria 1131
163 Ga0068863_100043180 3300005841 Bacteria 4280
164 Ga0068863_100311689 3300005841 Bacteria 1527
165 Ga0068863_100553169 3300005841 Bacteria 1136
166 Ga0068863_101727031 3300005841 Bacteria 635
167 Ga0068858_100020075 3300005842 Bacteria 6249
168 Ga0068858_100029333 3300005842 Bacteria 5108
169 Ga0068858_100053924 3300005842 Bacteria 3718
170 Ga0068858_100079648 3300005842 Bacteria 3044
171 Ga0068858_100101334 3300005842 Bacteria 2685
172 Ga0068858_100155345 3300005842 Unclassified 2152
173 Ga0068858_100172544 3300005842 Bacteria 2040
174 Ga0068858_100202876 3300005842 Bacteria 1876
175 Ga0068858_100394964 3300005842 Bacteria 1328
176 Ga0068860_100020626 3300005843 Bacteria 6384
177 Ga0068860_100028275 3300005843 Bacteria 5396
178 Ga0068860_100109411 3300005843 Bacteria 2641
179 Ga0068860_100116483 3300005843 Unclassified 2556
180 Ga0068860_100117154 3300005843 Bacteria 2548
181 Ga0068860_100356230 3300005843 Unclassified 1441
182 Ga0068860_100563380 3300005843 Unclassified 1142
183 Ga0068860_100671341 3300005843 Bacteria 1045
184 Ga0068860_101503483 3300005843 Unclassified 695
185 Ga0068862_100056965 3300005844 Unclassified 3350
186 Ga0068862_100125111 3300005844 Bacteria 2269
187 Ga0068862_100137483 3300005844 Bacteria 2167
188 Ga0068862_100389705 3300005844 Bacteria 1301
189 Ga0068862_101861851 3300005844 Bacteria 611
190 Ga0081539_10003189 3300005985 Bacteria 20742
191 Ga0081539_10241828 3300005985 Unclassified 808
192 Ga0075432_10070854 3300006058 Unclassified 1252
193 Ga0097621_100006828 3300006237 Bacteria 8111
194 Ga0097621_100097644 3300006237 Bacteria 2467
195 Ga0097621_101352716 3300006237 Bacteria 673
196 Ga0068871_100004942 3300006358 Bacteria 9313
197 Ga0068871_100011059 3300006358 Bacteria 6616
198 Ga0068871_100013526 3300006358 Bacteria 6056
199 Ga0068871_100453528 3300006358 Unclassified 1150
200 Ga0075428_100671877 3300006844 Bacteria 1104
201 Ga0075428_100715681 3300006844 Bacteria 1066
202 Ga0075428_100802837 3300006844 Bacteria 1000
203 Ga0075430_100021974 3300006846 Bacteria 5422
204 Ga0075431_100010205 3300006847 Bacteria 9442
205 Ga0075433_10005011 3300006852 Bacteria 10375
206 Ga0075433_10029588 3300006852 Bacteria 4668
207 Ga0075433_10040939 3300006852 Bacteria 4013
208 Ga0075433_10233799 3300006852 Bacteria 1632
209 Ga0075434_100985158 3300006871 Unclassified 857
210 Ga0075429_100004809 3300006880 Bacteria 11627
211 Ga0068865_100001935 3300006881 Bacteria 12191
212 Ga0068865_100271719 3300006881 Bacteria 1346
213 Ga0097620_100004920 3300006931 Bacteria 13585
214 Ga0097620_100022227 3300006931 Bacteria 6359
215 Ga0097620_100033615 3300006931 Bacteria 5150
216 Ga0097620_100080666 3300006931 Unclassified 3295
217 Ga0097620_100104126 3300006931 Unclassified 2897
218 Ga0097620_100110840 3300006931 Bacteria 2806
219 Ga0097620_100121894 3300006931 Bacteria 2674
220 Ga0097620_100169438 3300006931 Bacteria 2264
221 Ga0097620_100375242 3300006931 Bacteria 1518
222 Ga0097620_100405486 3300006931 Bacteria 1459
223 Ga0097620_100451591 3300006931 Unclassified 1381
224 Ga0097620_100519679 3300006931 Bacteria 1285
225 Ga0097620_100753038 3300006931 Bacteria 1063
226 Ga0097620_101170312 3300006931 Unclassified 846
227 Ga0097620_101697167 3300006931 Bacteria 698
228 Ga0105251_10230803 3300009011 Unclassified 833
229 Ga0111539_10002264 3300009094 Bacteria 25641
230 Ga0111539_10304209 3300009094 Bacteria 1856
231 Ga0111539_10309288 3300009094 Bacteria 1839
232 Ga0105245_10209832 3300009098 Bacteria 1874
233 Ga0105245_10822757 3300009098 Unclassified 967
234 Ga0105245_10917606 3300009098 Unclassified 918
235 Ga0105245_10941225 3300009098 Unclassified 907
236 Ga0105247_10004136 3300009101 Bacteria 9316
237 Ga0105247_10254161 3300009101 Unclassified 1202
238 Ga0105247_10538803 3300009101 Bacteria 856
239 Ga0105247_10697420 3300009101 Bacteria 764
240 Ga0105247_10988007 3300009101 Bacteria 656
241 Ga0114129_10125398 3300009147 Unclassified 3531
242 Ga0114129_10435643 3300009147 Unclassified 1722
243 Ga0114129_11152067 3300009147 Unclassified 968
244 Ga0105243_10003410 3300009148 Bacteria 12890
245 Ga0105243_10085258 3300009148 Bacteria 2589
246 Ga0105243_10172158 3300009148 Bacteria 1876
247 Ga0105243_10424114 3300009148 Bacteria 1242
248 Ga0105241_10118983 3300009174 Bacteria 2124
249 Ga0105241_10166094 3300009174 Bacteria 1819
250 Ga0105241_10309660 3300009174 Unclassified 1358
251 Ga0105241_10312009 3300009174 Bacteria 1353
252 Ga0105241_10615747 3300009174 Bacteria 982
253 Ga0105241_11220158 3300009174 Unclassified 713
254 Ga0105242_10003554 3300009176 Bacteria 12120
255 Ga0105248_10074790 3300009177 Unclassified 3807
256 Ga0105248_10221084 3300009177 Unclassified 2132
257 Ga0105248_10252747 3300009177 Bacteria 1984
258 Ga0105248_10731162 3300009177 Bacteria 1117
259 Ga0105248_10867148 3300009177 Unclassified 1019
260 Ga0105248_11783820 3300009177 Unclassified 698
261 Ga0105237_10079128 3300009545 Bacteria 3277
262 Ga0105237_10700747 3300009545 Bacteria 1019
263 Ga0105238_10020215 3300009551 Bacteria 6777
264 Ga0105238_10156256 3300009551 Bacteria 2256
265 Ga0105238_10387010 3300009551 Bacteria 1390
266 Ga0105249_10008330 3300009553 Bacteria 9027
267 Ga0105249_10024632 3300009553 Bacteria 5409
268 Ga0105249_10555406 3300009553 Bacteria 1199
269 Ga0105249_10579030 3300009553 Bacteria 1176
270 Ga0105239_10234504 3300010375 Unclassified 2059
271 Ga0105239_10948757 3300010375 Unclassified 988
272 Ga0105246_10019101 3300011119 Bacteria 4374
273 Ga0105246_10032752 3300011119 Unclassified 3449
274 Ga0105246_10100388 3300011119 Unclassified 2106
275 Ga0105246_10145153 3300011119 Bacteria 1789
276 Ga0105246_10855412 3300011119 Bacteria 812
277 Ga0157373_10012256 3300013100 Bacteria 6303
278 Ga0157373_10188448 3300013100 Bacteria 1453
279 Ga0157373_10416865 3300013100 Bacteria 964
280 Ga0157373_10881643 3300013100 Bacteria 663
281 Ga0157371_10134483 3300013102 Bacteria 1760
282 Ga0157374_10046884 3300013296 Unclassified 4004
283 Ga0157374_10222168 3300013296 Bacteria 1854
284 Ga0157374_10225929 3300013296 Bacteria 1838
285 Ga0157374_10835625 3300013296 Unclassified 937
286 Ga0157378_10001714 3300013297 Bacteria 19720
287 Ga0157378_10185701 3300013297 Bacteria 1958
288 Ga0157378_10621365 3300013297 Bacteria 1094
289 Ga0163162_10006148 3300013306 Bacteria 11621
290 Ga0163162_10012482 3300013306 Bacteria 8300
291 Ga0163162_10035294 3300013306 Bacteria 4980
292 Ga0163162_10368894 3300013306 Bacteria 1569
293 Ga0163162_10422122 3300013306 Unclassified 1466
294 Ga0163162_10425599 3300013306 Bacteria 1460
295 Ga0163162_11286590 3300013306 Bacteria 831
296 Ga0163162_11297519 3300013306 Bacteria 827
297 Ga0157372_10039421 3300013307 Bacteria 5213
298 Ga0157375_10008835 3300013308 Bacteria 8824
299 Ga0157375_10011685 3300013308 Bacteria 7758
300 Ga0157375_10025853 3300013308 Bacteria 5462
301 Ga0157375_10049099 3300013308 Bacteria 4133
302 Ga0157375_11282970 3300013308 Unclassified 861
303 Ga0157375_12420250 3300013308 Bacteria 627
304 Ga0163163_10004025 3300014325 Bacteria 12532
305 Ga0163163_10005715 3300014325 Bacteria 10785
306 Ga0163163_10009610 3300014325 Bacteria 8643
307 Ga0163163_10012142 3300014325 Bacteria 7836
308 Ga0163163_10069749 3300014325 Unclassified 3500
309 Ga0163163_10086462 3300014325 Unclassified 3145
310 Ga0163163_10149024 3300014325 Unclassified 2384
311 Ga0163163_10153311 3300014325 Bacteria 2347
312 Ga0163163_10596992 3300014325 Unclassified 1167
313 Ga0157380_10032394 3300014326 Unclassified 4020
314 Ga0157380_10046077 3300014326 Bacteria 3424
315 Ga0157380_11112720 3300014326 Unclassified 829
316 Ga0157377_10040852 3300014745 Bacteria 2570
317 Ga0157379_10162179 3300014968 Unclassified 2018
318 Ga0157379_10328639 3300014968 Bacteria 1397
319 Ga0157379_10603920 3300014968 Bacteria 1024
320 Ga0157376_10018187 3300014969 Bacteria 5380
321 Ga0157376_10063790 3300014969 Bacteria 3105
322 Ga0157376_10173303 3300014969 Bacteria 1966
323 Ga0163161_10086615 3300017792 Unclassified 2312
324 Ga0207642_10102787 3300025899 Bacteria 1438
325 Ga0207642_10177598 3300025899 Unclassified 1157
326 Ga0207710_10000675 3300025900 Bacteria 19207
327 Ga0207710_10462184 3300025900 Bacteria 656
328 Ga0207688_10127118 3300025901 Bacteria 1491
329 Ga0207647_10013916 3300025904 Bacteria 5568
330 Ga0207643_10002028 3300025908 Bacteria 11180
331 Ga0207643_10005057 3300025908 Bacteria 7061
332 Ga0207643_10016923 3300025908 Bacteria 3978
333 Ga0207643_10134638 3300025908 Bacteria 1472
334 Ga0207654_10782223 3300025911 Unclassified 689
335 Ga0207707_10027809 3300025912 Bacteria 4944
336 Ga0207707_10039258 3300025912 Unclassified 4139
337 Ga0207662_10002981 3300025918 Bacteria 8622
338 Ga0207662_10037740 3300025918 Bacteria 2829
339 Ga0207662_10134292 3300025918 Bacteria 1563
340 Ga0207662_10165727 3300025918 Unclassified 1414
341 Ga0207649_10467372 3300025920 Unclassified 955
342 Ga0207652_10175295 3300025921 Unclassified 1925
343 Ga0207652_10724139 3300025921 Unclassified 887
344 Ga0207652_10819970 3300025921 Bacteria 825
345 Ga0207681_10070705 3300025923 Unclassified 2431
346 Ga0207681_10167484 3300025923 Bacteria 1662
347 Ga0207681_10287866 3300025923 Unclassified 1296
348 Ga0207694_10033408 3300025924 Bacteria 3941
349 Ga0207650_10000047 3300025925 Bacteria 175675
350 Ga0207650_10030858 3300025925 Bacteria 3866
351 Ga0207650_10063895 3300025925 Bacteria 2754
352 Ga0207650_10399219 3300025925 Bacteria 1138
353 Ga0207650_10414000 3300025925 Unclassified 1117
354 Ga0207659_10099128 3300025926 Bacteria 2193
355 Ga0207687_10199131 3300025927 Bacteria 1564
356 Ga0207644_10026750 3300025931 Unclassified 3980
357 Ga0207644_10268347 3300025931 Unclassified 1366
358 Ga0207644_10304529 3300025931 Unclassified 1285
359 Ga0207644_10446266 3300025931 Bacteria 1062
360 Ga0207690_10021799 3300025932 Unclassified 3978
361 Ga0207690_10039985 3300025932 Bacteria 3063
362 Ga0207706_10184285 3300025933 Bacteria 1833
363 Ga0207709_10012994 3300025935 Bacteria 4590
364 Ga0207670_10000161 3300025936 Bacteria 44305
365 Ga0207670_10248684 3300025936 Bacteria 1373
366 Ga0207704_10010910 3300025938 Bacteria 4454
367 Ga0207704_10495011 3300025938 Bacteria 984
368 Ga0207691_10003641 3300025940 Bacteria 14948
369 Ga0207691_11071810 3300025940 Bacteria 671
370 Ga0207711_10035856 3300025941 Unclassified 4206
371 Ga0207711_10092378 3300025941 Bacteria 2663
372 Ga0207711_10148149 3300025941 Unclassified 2116
373 Ga0207711_10295415 3300025941 Unclassified 1494
374 Ga0207711_10397506 3300025941 Bacteria 1280
375 Ga0207689_10004178 3300025942 Bacteria 13125
376 Ga0207689_10023465 3300025942 Bacteria 5177
377 Ga0207689_10066188 3300025942 Bacteria 2972
378 Ga0207689_10204541 3300025942 Bacteria 1630
379 Ga0207679_10227641 3300025945 Bacteria 1572
380 Ga0207667_10294629 3300025949 Bacteria 1658
381 Ga0207667_10955933 3300025949 Viruses 846
382 Ga0207651_10033841 3300025960 Bacteria 3301
383 Ga0207651_10092335 3300025960 Bacteria 2220
384 Ga0207651_10124612 3300025960 Bacteria 1961
385 Ga0207651_10289334 3300025960 Bacteria 1358
386 Ga0207651_10770464 3300025960 Unclassified 851
387 Ga0207712_10268523 3300025961 Bacteria 1387
388 Ga0207712_11526106 3300025961 Unclassified 598
389 Ga0207640_10076869 3300025981 Unclassified 2268
390 Ga0207640_10110705 3300025981 Bacteria 1946
391 Ga0207677_10180901 3300026023 Bacteria 1658
392 Ga0207677_10463934 3300026023 Bacteria 1088
393 Ga0207703_10097966 3300026035 Unclassified 2479
394 Ga0207703_10130060 3300026035 Bacteria 2173
395 Ga0207703_10271136 3300026035 Bacteria 1537
396 Ga0207703_10476989 3300026035 Bacteria 1168
397 Ga0207703_11034013 3300026035 Unclassified 788
398 Ga0207703_11178909 3300026035 Bacteria 736
399 Ga0207639_10170190 3300026041 Bacteria 1844
400 Ga0207639_10404599 3300026041 Bacteria 1230
401 Ga0207708_10013610 3300026075 Bacteria 6078
402 Ga0207708_10077917 3300026075 Bacteria 2544
403 Ga0207708_10625721 3300026075 Bacteria 914
404 Ga0207641_10112299 3300026088 Bacteria 2418
405 Ga0207641_10334797 3300026088 Bacteria 1439
406 Ga0207641_10505529 3300026088 Bacteria 1174
407 Ga0207648_10003789 3300026089 Bacteria 15798
408 Ga0207648_10089400 3300026089 Bacteria 2691
409 Ga0207648_10106347 3300026089 Bacteria 2462
410 Ga0207648_10245599 3300026089 Bacteria 1595
411 Ga0207648_10259393 3300026089 Bacteria 1551
412 Ga0207648_10576156 3300026089 Bacteria 1036
413 Ga0207648_10750265 3300026089 Unclassified 906
414 Ga0207676_10001124 3300026095 Bacteria 20280
415 Ga0207676_10005870 3300026095 Bacteria 8673
416 Ga0207676_10033362 3300026095 Bacteria 3889
417 Ga0207676_10088589 3300026095 Bacteria 2534
418 Ga0207676_10195693 3300026095 Bacteria 1783
419 Ga0207676_10238249 3300026095 Bacteria 1631
420 Ga0207676_10530454 3300026095 Bacteria 1122
421 Ga0207676_11290172 3300026095 Unclassified 725
422 Ga0207674_10000414 3300026116 Bacteria 55510
423 Ga0207674_10031160 3300026116 Bacteria 5604
424 Ga0207674_10090665 3300026116 Bacteria 3048
425 Ga0207674_10449080 3300026116 Bacteria 1246
426 Ga0207674_10583434 3300026116 Bacteria 1080
427 Ga0207674_10730441 3300026116 Unclassified 956
428 Ga0207674_10784873 3300026116 Unclassified 919
429 Ga0207674_10815537 3300026116 Bacteria 900
430 Ga0207675_100000575 3300026118 Bacteria 35883
431 Ga0207675_100094112 3300026118 Bacteria 2818
432 Ga0207675_100140595 3300026118 Bacteria 2293
433 Ga0207675_100697351 3300026118 Bacteria 1024
434 Ga0207675_100869290 3300026118 Unclassified 917
435 Ga0207683_10027646 3300026121 Bacteria 4901
436 Ga0207698_10041500 3300026142 Bacteria 3429
437 Ga0207428_10003842 3300027907 Bacteria 14410
438 Ga0268266_10301826 3300028379 Bacteria 1494
439 Ga0268265_10051326 3300028380 Bacteria 3113
440 Ga0268265_10138382 3300028380 Bacteria 2035
441 Ga0268265_10975491 3300028380 Unclassified 836
442 Ga0268264_10040371 3300028381 Bacteria 3856
443 Ga0268264_10069569 3300028381 Bacteria 2977
444 Ga0268264_10078500 3300028381 Bacteria 2815
445 Ga0268264_10160313 3300028381 Bacteria 2026
446 Ga0268264_10291848 3300028381 Bacteria 1532
447 Ga0268264_10626127 3300028381 Bacteria 1063
448 Ga0307405_10619954 3300031731 Unclassified 885
449 Ga0307410_10894339 3300031852 Bacteria 760
450 Ga0307414_10647477 3300032004 Bacteria 952
451 Ga0307415_100026925 3300032126 Bacteria 3635
452 Ga0373951_0002509 3300035091 Bacteria 4617
453 Ga0373951_0188846 3300035091 Unclassified 595
454 Ga0373941_0237306 3300035115 Unclassified 707
455 Ga0395900_0306628 3300037418 Unclassified 1572
456 Ga0395898_0187767 3300037466 Unclassified 1975
457 Ga0439453_0085189 3300041408 Bacteria 687
458 Ga0439431_0165871 3300041997 Bacteria 633
459 Ga0495643_0146634 3300046522 Bacteria 1172
460 Ga0495647_0037151 3300046681 Bacteria 1837
461 Ga0496104_0891459 3300048907 Unclassified 795
462 Ga0496106_0049791 3300048909 Bacteria 3157
463 Ga0496107_0110927 3300048910 Bacteria 2016
464 Ga0496112_0171546 3300048915 Bacteria 2134
465 Ga0496112_0521893 3300048915 Unclassified 1122
466 Ga0496113_0350299 3300048916 Bacteria 1185
467 Ga0496114_0853883 3300048917 Unclassified 791
468 Ga0501291_001769 3300049514 Bacteria 2526
469 Ga0501298_024619 3300049521 Bacteria 1148
470 Ga0501076_0618110 3300049592 Bacteria 894
471 Ga0501223_131168 3300049663 Unclassified 534
472 Ga0501235_001954 3300049669 Bacteria 4414
473 nmdc:mga05p37_134331_c1 3300050507 Unclassified 3035
474 nmdc:mga09592_408868_c1 3300050508 Bacteria 1173
475 nmdc:mga0qj67_79058_c1 3300050509 Bacteria 2633
476 nmdc:mga06r32_516919_c1 3300050510 Unclassified 1170
477 nmdc:mga08y16_1047_c1 3300050511 Bacteria 27143
478 nmdc:mga08y16_24903_c1 3300050511 Bacteria 6312
479 nmdc:mga0n895_204957_c1 3300050512 Bacteria 2003
480 nmdc:mga0n895_312820_c1 3300050512 Unclassified 1592
481 nmdc:mga0n895_362305_c1 3300050512 Bacteria 1468
482 nmdc:mga0n895_839707_c1 3300050512 Unclassified 907
483 nmdc:mga0rr50_739601_c1 3300050513 Unclassified 839
484 nmdc:mga0a205_13488_c1 3300050515 Bacteria 7609
485 nmdc:mga0a205_244477_c1 3300050515 Bacteria 1675
486 nmdc:mga0a205_25354_c1 3300050515 Bacteria 5649
487 Ga0501084_0498791 3300054114 Bacteria 1029
488 Ga0068864_100009758
489 SwRhRL2b_contig_719158
490 MRS1b_contig_4784088
491 MBSR1b_contig_13912214
492 JGI24737J22298_10079992
493 JGI24751J29686_10000122
494 JGI25406J46586_10042841
495 rootL2_10082220
496 rootL2_10247141
497 Ga0065714_10064481
498 Ga0065704_10004948
499 Ga0065712_10000143
500 Ga0065712_10018212
501 Ga0065712_10343784
502 Ga0065712_10457170
503 Ga0065715_10012945
504 Ga0065715_10089930
505 Ga0065715_10090500
506 Ga0065715_10103281
507 Ga0065715_10195392
508 Ga0065715_10297577
509 Ga0065715_10420474
510 Ga0065707_10003314
511 Ga0065707_10880420
512 Ga0070676_10585180
513 Ga0070690_100032014
514 Ga0070690_100603062
515 Ga0070670_100000741
516 Ga0070670_100027782
517 Ga0070670_100098350
518 Ga0068869_100016022
519 Ga0068869_100062558
520 Ga0068869_100302352
521 Ga0068869_100518329
522 Ga0068869_100974217
523 Ga0070666_10125629
524 Ga0070666_10346558
525 Ga0070680_100910771
526 Ga0070682_100003344
527 Ga0070682_100169854
528 Ga0068868_100618164
529 Ga0070689_100000613
530 Ga0070689_100511060
531 Ga0070691_10375439
532 Ga0070687_100086226
533 Ga0070692_10283135
534 Ga0070692_10488944
535 Ga0070669_100127608
536 Ga0070675_100330375
537 Ga0070675_100425189
538 Ga0070675_100477848
539 Ga0070675_100594794
540 Ga0070671_100020820
541 Ga0070671_100033216
542 Ga0070671_100061248
543 Ga0070673_100016373
544 Ga0070673_100182754
545 Ga0070673_100431272
546 Ga0070673_100760332
547 Ga0070673_100915420
548 Ga0070688_100167815
549 Ga0070688_100507646
550 Ga0070659_100002144
551 Ga0070659_100028014
552 Ga0070667_100269930
553 Ga0070703_10108892
554 Ga0070701_10116611
555 Ga0070701_10135744
556 Ga0070701_10231238
557 Ga0070705_100063046
558 Ga0070705_100219765
559 Ga0070705_100273089
560 Ga0070700_100011758
561 Ga0070700_100034087
562 Ga0070700_101268788
563 Ga0070694_100229334
564 Ga0070694_100396587
565 Ga0070662_100138166
566 Ga0070681_10000519
567 Ga0070681_10001374
568 Ga0070681_10307692
569 Ga0068867_100015645
570 Ga0068867_100137190
571 Ga0068867_100215770
572 Ga0068867_100737192
573 Ga0068867_100765362
574 Ga0070707_100034904
575 Ga0070698_100009468
576 Ga0070698_100120474
577 Ga0070698_101204773
578 Ga0070699_100001980
579 Ga0070699_100020120
580 Ga0070699_100601875
581 Ga0070679_100011845
582 Ga0070679_100967380
583 Ga0070684_100693567
584 Ga0070684_100752300
585 Ga0070697_100010501
586 Ga0068853_100061008
587 Ga0070672_100062570
588 Ga0070672_100999852
589 Ga0070686_100458125
590 Ga0070695_100153754
591 Ga0070696_100059250
592 Ga0070696_100782156
593 Ga0070693_100191842
594 Ga0070693_100859301
595 Ga0070665_100038737
596 Ga0070665_101520494
597 Ga0070704_100026915
598 Ga0070704_100133598
599 Ga0070704_100370843
600 Ga0070704_100538884
601 Ga0070704_100719650
602 Ga0068855_100371554
603 Ga0068855_101234271
604 Ga0070664_100001726
605 Ga0070664_100123075
606 Ga0070664_100663660
607 Ga0068857_100003047
608 Ga0068857_100109791
609 Ga0068857_100823524
610 Ga0068854_100122927
611 Ga0068854_100763315
612 Ga0068856_100914110
613 Ga0070702_100015173
614 Ga0070702_100034189
615 Ga0070702_100177757
616 Ga0070702_100836485
617 Ga0068852_100050604
618 Ga0068852_100701517
619 Ga0068859_100004920
620 Ga0068859_100022227
621 Ga0068859_100033615
622 Ga0068859_100080667
623 Ga0068859_100104127
624 Ga0068859_100121893
625 Ga0068859_100169446
626 Ga0068859_100375243
627 Ga0068859_100405479
628 Ga0068859_100451570
629 Ga0068859_100519675
630 Ga0068859_100752936
631 Ga0068859_101170335
632 Ga0068859_101697320
633 Ga0068864_100010311
634 Ga0068864_100022120
635 Ga0068864_100022306
636 Ga0068864_100024326
637 Ga0068864_100221609
638 Ga0068864_100450014
639 Ga0068864_100577591
640 Ga0068864_100874497
641 Ga0068864_101097678
642 Ga0068866_10129408
643 Ga0068861_100608152
644 Ga0068861_100701603
645 Ga0068870_10023609
646 Ga0068870_10047065
647 Ga0068870_10086032
648 Ga0068870_10180931
649 Ga0068870_10233984
650 Ga0068863_100043180
651 Ga0068863_100311689
652 Ga0068863_100553169
653 Ga0068863_101727031
654 Ga0068858_100020075
655 Ga0068858_100029333
656 Ga0068858_100053924
657 Ga0068858_100079648
658 Ga0068858_100101334
659 Ga0068858_100155345
660 Ga0068858_100172544
661 Ga0068858_100202876
662 Ga0068858_100394964
663 Ga0068860_100020626
664 Ga0068860_100028275
665 Ga0068860_100109411
666 Ga0068860_100116483
667 Ga0068860_100117154
668 Ga0068860_100356230
669 Ga0068860_100563380
670 Ga0068860_100671341
671 Ga0068860_101503483
672 Ga0068862_100056965
673 Ga0068862_100125111
674 Ga0068862_100137483
675 Ga0068862_100389705
676 Ga0068862_101861851
677 Ga0081539_10003189
678 Ga0081539_10241828
679 Ga0075432_10070854
680 Ga0097621_100006828
681 Ga0097621_100097644
682 Ga0097621_101352716
683 Ga0068871_100004942
684 Ga0068871_100011059
685 Ga0068871_100013526
686 Ga0068871_100453528
687 Ga0075428_100671877
688 Ga0075428_100715681
689 Ga0075428_100802837
690 Ga0075430_100021974
691 Ga0075431_100010205
692 Ga0075433_10005011
693 Ga0075433_10029588
694 Ga0075433_10040939
695 Ga0075433_10233799
696 Ga0075434_100985158
697 Ga0075429_100004809
698 Ga0068865_100001935
699 Ga0068865_100271719
700 Ga0097620_100004920
701 Ga0097620_100022227
702 Ga0097620_100033615
703 Ga0097620_100080666
704 Ga0097620_100104126
705 Ga0097620_100110840
706 Ga0097620_100121894
707 Ga0097620_100169438
708 Ga0097620_100375242
709 Ga0097620_100405486
710 Ga0097620_100451591
711 Ga0097620_100519679
712 Ga0097620_100753038
713 Ga0097620_101170312
714 Ga0097620_101697167
715 Ga0105251_10230803
716 Ga0111539_10002264
717 Ga0111539_10304209
718 Ga0111539_10309288
719 Ga0105245_10209832
720 Ga0105245_10822757
721 Ga0105245_10917606
722 Ga0105245_10941225
723 Ga0105247_10004136
724 Ga0105247_10254161
725 Ga0105247_10538803
726 Ga0105247_10697420
727 Ga0105247_10988007
728 Ga0114129_10125398
729 Ga0114129_10435643
730 Ga0114129_11152067
731 Ga0105243_10003410
732 Ga0105243_10085258
733 Ga0105243_10172158
734 Ga0105243_10424114
735 Ga0105241_10118983
736 Ga0105241_10166094
737 Ga0105241_10309660
738 Ga0105241_10312009
739 Ga0105241_10615747
740 Ga0105241_11220158
741 Ga0105242_10003554
742 Ga0105248_10074790
743 Ga0105248_10221084
744 Ga0105248_10252747
745 Ga0105248_10731162
746 Ga0105248_10867148
747 Ga0105248_11783820
748 Ga0105237_10079128
749 Ga0105237_10700747
750 Ga0105238_10020215
751 Ga0105238_10156256
752 Ga0105238_10387010
753 Ga0105249_10008330
754 Ga0105249_10024632
755 Ga0105249_10555406
756 Ga0105249_10579030
757 Ga0105239_10234504
758 Ga0105239_10948757
759 Ga0105246_10019101
760 Ga0105246_10032752
761 Ga0105246_10100388
762 Ga0105246_10145153
763 Ga0105246_10855412
764 Ga0157373_10012256
765 Ga0157373_10188448
766 Ga0157373_10416865
767 Ga0157373_10881643
768 Ga0157371_10134483
769 Ga0157374_10046884
770 Ga0157374_10222168
771 Ga0157374_10225929
772 Ga0157374_10835625
773 Ga0157378_10001714
774 Ga0157378_10185701
775 Ga0157378_10621365
776 Ga0163162_10006148
777 Ga0163162_10012482
778 Ga0163162_10035294
779 Ga0163162_10368894
780 Ga0163162_10422122
781 Ga0163162_10425599
782 Ga0163162_11286590
783 Ga0163162_11297519
784 Ga0157372_10039421
785 Ga0157375_10008835
786 Ga0157375_10011685
787 Ga0157375_10025853
788 Ga0157375_10049099
789 Ga0157375_11282970
790 Ga0157375_12420250
791 Ga0163163_10004025
792 Ga0163163_10005715
793 Ga0163163_10009610
794 Ga0163163_10012142
795 Ga0163163_10069749
796 Ga0163163_10086462
797 Ga0163163_10149024
798 Ga0163163_10153311
799 Ga0163163_10596992
800 Ga0157380_10032394
801 Ga0157380_10046077
802 Ga0157380_11112720
803 Ga0157377_10040852
804 Ga0157379_10162179
805 Ga0157379_10328639
806 Ga0157379_10603920
807 Ga0157376_10018187
808 Ga0157376_10063790
809 Ga0157376_10173303
810 Ga0163161_10086615
811 Ga0207642_10102787
812 Ga0207642_10177598
813 Ga0207710_10000675
814 Ga0207710_10462184
815 Ga0207688_10127118
816 Ga0207647_10013916
817 Ga0207643_10002028
818 Ga0207643_10005057
819 Ga0207643_10016923
820 Ga0207643_10134638
821 Ga0207654_10782223
822 Ga0207707_10027809
823 Ga0207707_10039258
824 Ga0207662_10002981
825 Ga0207662_10037740
826 Ga0207662_10134292
827 Ga0207662_10165727
828 Ga0207649_10467372
829 Ga0207652_10175295
830 Ga0207652_10724139
831 Ga0207652_10819970
832 Ga0207681_10070705
833 Ga0207681_10167484
834 Ga0207681_10287866
835 Ga0207694_10033408
836 Ga0207650_10000047
837 Ga0207650_10030858
838 Ga0207650_10063895
839 Ga0207650_10399219
840 Ga0207650_10414000
841 Ga0207659_10099128
842 Ga0207687_10199131
843 Ga0207644_10026750
844 Ga0207644_10268347
845 Ga0207644_10304529
846 Ga0207644_10446266
847 Ga0207690_10021799
848 Ga0207690_10039985
849 Ga0207706_10184285
850 Ga0207709_10012994
851 Ga0207670_10000161
852 Ga0207670_10248684
853 Ga0207704_10010910
854 Ga0207704_10495011
855 Ga0207691_10003641
856 Ga0207691_11071810
857 Ga0207711_10035856
858 Ga0207711_10092378
859 Ga0207711_10148149
860 Ga0207711_10295415
861 Ga0207711_10397506
862 Ga0207689_10004178
863 Ga0207689_10023465
864 Ga0207689_10066188
865 Ga0207689_10204541
866 Ga0207679_10227641
867 Ga0207667_10294629
868 Ga0207667_10955933
869 Ga0207651_10033841
870 Ga0207651_10092335
871 Ga0207651_10124612
872 Ga0207651_10289334
873 Ga0207651_10770464
874 Ga0207712_10268523
875 Ga0207712_11526106
876 Ga0207640_10076869
877 Ga0207640_10110705
878 Ga0207677_10180901
879 Ga0207677_10463934
880 Ga0207703_10097966
881 Ga0207703_10130060
882 Ga0207703_10271136
883 Ga0207703_10476989
884 Ga0207703_11034013
885 Ga0207703_11178909
886 Ga0207639_10170190
887 Ga0207639_10404599
888 Ga0207708_10013610
889 Ga0207708_10077917
890 Ga0207708_10625721
891 Ga0207641_10112299
892 Ga0207641_10334797
893 Ga0207641_10505529
894 Ga0207648_10003789
895 Ga0207648_10089400
896 Ga0207648_10106347
897 Ga0207648_10245599
898 Ga0207648_10259393
899 Ga0207648_10576156
900 Ga0207648_10750265
901 Ga0207676_10001124
902 Ga0207676_10005870
903 Ga0207676_10033362
904 Ga0207676_10088589
905 Ga0207676_10195693
906 Ga0207676_10238249
907 Ga0207676_10530454
908 Ga0207676_11290172
909 Ga0207674_10000414
910 Ga0207674_10031160
911 Ga0207674_10090665
912 Ga0207674_10449080
913 Ga0207674_10583434
914 Ga0207674_10730441
915 Ga0207674_10784873
916 Ga0207674_10815537
917 Ga0207675_100000575
918 Ga0207675_100094112
919 Ga0207675_100140595
920 Ga0207675_100697351
921 Ga0207675_100869290
922 Ga0207683_10027646
923 Ga0207698_10041500
924 Ga0207428_10003842
925 Ga0268266_10301826
926 Ga0268265_10051326
927 Ga0268265_10138382
928 Ga0268265_10975491
929 Ga0268264_10040371
930 Ga0268264_10069569
931 Ga0268264_10078500
932 Ga0268264_10160313
933 Ga0268264_10291848
934 Ga0268264_10626127
935 Ga0307405_10619954
936 Ga0307410_10894339
937 Ga0307414_10647477
938 Ga0307415_100026925
939 Ga0373951_0002509
940 Ga0373951_0188846
941 Ga0373941_0237306
942 Ga0395900_0306628
943 Ga0395898_0187767
944 Ga0439453_0085189
945 Ga0439431_0165871
946 Ga0495643_0146634
947 Ga0495647_0037151
948 Ga0496104_0891459
949 Ga0496106_0049791
950 Ga0496107_0110927
951 Ga0496112_0171546
952 Ga0496112_0521893
953 Ga0496113_0350299
954 Ga0496114_0853883
955 Ga0501291_001769
956 Ga0501298_024619
957 Ga0501076_0618110
958 Ga0501223_131168
959 Ga0501235_001954
960 nmdc:mga05p37_134331_c1
961 nmdc:mga09592_408868_c1
962 nmdc:mga0qj67_79058_c1
963 nmdc:mga06r32_516919_c1
964 nmdc:mga08y16_1047_c1
965 nmdc:mga08y16_24903_c1
966 nmdc:mga0n895_204957_c1
967 nmdc:mga0n895_312820_c1
968 nmdc:mga0n895_362305_c1
969 nmdc:mga0n895_839707_c1
970 nmdc:mga0rr50_739601_c1
971 nmdc:mga0a205_13488_c1
972 nmdc:mga0a205_244477_c1
973 nmdc:mga0a205_25354_c1
974 Ga0501084_0498791

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01202

SKI

Shikimate kinase

29

186

0.91

PF13238

AAA_18

AAA domain

23

151

0.7

Structural Annotation

Top 5 Hits

ID Description Score Start End
2iyz-assembly1.cif.gz_A shikimate kinase from mycobacterium tuberculosis in complex with shikimate-3-phosphate and adp 0.9236 5 167
2dft-assembly1.cif.gz_B structure of shikimate kinase from mycobacterium tuberculosis complexed with adp and mg at 2.8 angstrons of resolution 0.9157 5 166
1zui-assembly1.cif.gz_A structural basis for shikimate-binding specificity of helicobacter pylori shikimate kinase 0.9139 3 165
1via-assembly1.cif.gz_B crystal structure of shikimate kinase 0.9136 3 168
1u8a-assembly1.cif.gz_A crystal structure of mycobacterium tuberculosis shikimate kinase in complex with shikimate and adp at 2.15 angstrom resolution 0.9132 5 166
ID Description Score Start End Superfamily
af_Q8IYQ7_54_228_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9031 3 169 3.40.50.300
4y0aA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9025 3 172 3.40.50.300
af_I1JY85_1_186_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8994 10 168 3.40.50.300
1kagA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.89 1 167 3.40.50.300
4y0aA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8827 3 172 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A838MXW7-F1-model_v4 AAA family ATPase 0.9805 3 156 GO:0004765
GO:0005524
GO:0005829
GO:0008652
GO:0009073
AF-A0A2V8R0K0-F1-model_v4 Shikimate kinase (SK) (EC 2.7.1.71) 0.98 2 167 GO:0000287
GO:0004765
GO:0005524
GO:0005829
GO:0008652
GO:0009073
GO:0009423
AF-A0A352FKS2-F1-model_v4 Shikimate kinase (SK) (EC 2.7.1.71) 0.9791 1 161 GO:0000287
GO:0004765
GO:0005524
GO:0005829
GO:0008652
GO:0009073
GO:0009423
AF-A0A7C5ZWM7-F1-model_v4 Shikimate kinase (SK) (EC 2.7.1.71) 0.9692 2 165 GO:0000287
GO:0004765
GO:0005524
GO:0005829
GO:0008652
GO:0009073
GO:0009423
AF-A0A7V8YZP6-F1-model_v4 Shikimate kinase (SK) (EC 2.7.1.71) 0.9686 2 167 GO:0000287
GO:0004765
GO:0005524
GO:0005829
GO:0008652
GO:0009073
GO:0009423

Map