F453413

General Info

Members Datasets Scaffolds Average Seq Length
487 224 487 37

Family's Representative Sequence

Representative Sequence 3300005545|Ga0070695_101258884|Ga0070695_1012588841
Length 40
Sequence MSELVKTVSRAARVAFTFVMMNYAAVAGLVAAARGRQAWK

Samples

Sample ID Description Type Environment
1 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
2 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
3 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
4 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
5 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
6 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
7 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
8 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
9 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
10 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
11 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
12 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
13 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
14 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
15 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
16 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
17 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
18 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
19 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
20 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
21 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
22 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
23 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
24 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
25 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
26 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
27 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
28 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
29 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
30 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
31 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
32 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
33 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
34 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
35 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
36 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
37 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
38 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
39 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
45 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
47 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
48 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300012473 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.12.yng.090610 Metagenome Rhizosphere
54 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
55 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
56 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
57 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
58 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
59 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
60 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
61 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
62 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
63 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
64 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
119 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
120 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
124 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
125 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
126 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
127 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
128 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
129 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
130 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
131 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
132 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
133 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
134 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
135 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
136 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
137 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
138 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
139 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
140 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
141 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
142 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
143 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
144 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
145 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
146 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
147 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
148 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
149 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
150 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
151 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
152 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
153 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
154 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
155 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
156 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
157 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
158 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
159 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
160 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
161 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
162 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
163 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
164 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
165 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
166 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
167 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
168 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
169 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
170 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
171 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
181 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
182 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
183 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
184 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
185 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
186 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
187 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
188 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
189 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
190 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
191 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
192 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
193 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
194 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
197 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
198 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
199 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
200 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
201 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
202 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
203 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
204 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
205 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
206 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
207 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
208 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
209 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
210 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
211 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
212 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
213 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
214 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
215 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
216 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
217 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
218 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
219 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
220 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
221 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
222 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
223 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
224 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.95
Metatranscriptomes 2.05
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.8
Nodule 0
Rhizoplane 4.11
Rhizosphere 87.47
Stem 0
Stem Tuber 0
Unclassified 0.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070672_100012108 3300005543 Bacteria 6039
2 Ga0070672_100099207 3300005543 Bacteria 2360
3 Ga0070672_100163866 3300005543 Bacteria 1846
4 Ga0070695_101258884 3300005545 Unclassified 610
5 Ga0070665_100133289 3300005548 Bacteria 2486
6 Ga0070665_101574266 3300005548 Bacteria 665
7 Ga0068855_102330338 3300005563 Bacteria 535
8 Ga0070664_100005497 3300005564 Bacteria 10176
9 Ga0070664_100322636 3300005564 Bacteria 1400
10 Ga0070664_101878826 3300005564 Bacteria 568
11 Ga0068857_100066778 3300005577 Bacteria 3201
12 Ga0068854_101097868 3300005578 Bacteria 709
13 Ga0068852_100274943 3300005616 Bacteria 1622
14 Ga0068859_100156806 3300005617 Bacteria 2354
15 Ga0068859_102111821 3300005617 Unclassified 622
16 Ga0068864_100038520 3300005618 Bacteria 4084
17 Ga0068864_101627703 3300005618 Bacteria 650
18 Ga0068866_10334851 3300005718 Bacteria 956
19 Ga0068861_101473756 3300005719 Bacteria 667
20 Ga0068861_101621548 3300005719 Bacteria 638
21 Ga0068861_102571335 3300005719 Unclassified 513
22 Ga0068851_10161516 3300005834 Bacteria 1231
23 Ga0068851_10223853 3300005834 Archaea 1058
24 Ga0068863_100429239 3300005841 Unclassified 1295
25 Ga0068863_100612059 3300005841 Unclassified 1079
26 Ga0068858_100008176 3300005842 Bacteria 10060
27 Ga0068858_101831771 3300005842 Bacteria 600
28 Ga0068858_102315335 3300005842 Unclassified 531
29 Ga0068860_102641402 3300005843 Bacteria 521
30 Ga0068862_101476824 3300005844 Unclassified 685
31 Ga0075365_10528553 3300006038 Bacteria 834
32 Ga0075368_10388705 3300006042 Unclassified 611
33 Ga0075363_100138709 3300006048 Unclassified 1368
34 Ga0075364_10151562 3300006051 Unclassified 1562
35 Ga0075364_10209331 3300006051 Bacteria 1322
36 Ga0075364_10439660 3300006051 Bacteria 891
37 Ga0075364_11035439 3300006051 Bacteria 558
38 Ga0070715_10551032 3300006163 Bacteria 668
39 Ga0070716_101064973 3300006173 Bacteria 643
40 Ga0075367_10064857 3300006178 Unclassified 2185
41 Ga0075367_10241386 3300006178 Bacteria 1132
42 Ga0075367_10742813 3300006178 Bacteria 624
43 Ga0075369_10202008 3300006186 Bacteria 917
44 Ga0075427_10068428 3300006194 Unclassified 630
45 Ga0075366_10003343 3300006195 Bacteria 8446
46 Ga0075366_10044969 3300006195 Bacteria 2617
47 Ga0075366_10122348 3300006195 Bacteria 1568
48 Ga0075366_10258815 3300006195 Unclassified 1062
49 Ga0075366_10301034 3300006195 Bacteria 981
50 Ga0097621_100010253 3300006237 Bacteria 6845
51 Ga0097621_101208395 3300006237 Bacteria 712
52 Ga0097621_101370633 3300006237 Unclassified 669
53 Ga0075370_10061361 3300006353 Bacteria 2141
54 Ga0075370_10954305 3300006353 Bacteria 525
55 Ga0068871_100041133 3300006358 Bacteria 3705
56 Ga0068871_100212896 3300006358 Unclassified 1672
57 Ga0068871_100270994 3300006358 Unclassified 1483
58 Ga0075428_100000748 3300006844 Bacteria 33775
59 Ga0075428_100006301 3300006844 Bacteria 13189
60 Ga0075430_100007553 3300006846 Bacteria 9181
61 Ga0075430_101194545 3300006846 Bacteria 626
62 Ga0075430_101755272 3300006846 Bacteria 509
63 Ga0075431_100001504 3300006847 Bacteria 21608
64 Ga0075431_100022748 3300006847 Bacteria 6407
65 Ga0075431_100385352 3300006847 Bacteria 1405
66 Ga0075431_101782794 3300006847 Bacteria 572
67 Ga0075433_10013833 3300006852 Bacteria 6578
68 Ga0075434_100045401 3300006871 Bacteria 4358
69 Ga0075434_101367139 3300006871 Bacteria 718
70 Ga0075434_101787837 3300006871 Unclassified 622
71 Ga0075429_100000781 3300006880 Bacteria 25104
72 Ga0075429_100066138 3300006880 Bacteria 3147
73 Ga0075429_100098164 3300006880 Bacteria 2556
74 Ga0075429_101293252 3300006880 Bacteria 636
75 Ga0068865_100000679 3300006881 Bacteria 19202
76 Ga0068865_100044132 3300006881 Bacteria 3050
77 Ga0068865_100227718 3300006881 Bacteria 1461
78 Ga0068865_100998671 3300006881 Bacteria 733
79 Ga0068865_101288987 3300006881 Bacteria 649
80 Ga0075436_100008000 3300006914 Bacteria 7237
81 Ga0075436_100120505 3300006914 Bacteria 1835
82 Ga0097620_100156807 3300006931 Bacteria 2354
83 Ga0097620_102110815 3300006931 Unclassified 622
84 Ga0075435_100000002 3300007076 Bacteria 140391
85 Ga0075435_100028104 3300007076 Bacteria 4408
86 Ga0105240_10344214 3300009093 Unclassified 1693
87 Ga0105240_10718288 3300009093 Bacteria 1089
88 Ga0111539_10000860 3300009094 Bacteria 39623
89 Ga0111539_10310676 3300009094 Bacteria 1835
90 Ga0111539_10518154 3300009094 Bacteria 1389
91 Ga0111539_12712706 3300009094 Bacteria 574
92 Ga0105245_10102499 3300009098 Unclassified 2651
93 Ga0105245_10122064 3300009098 Bacteria 2435
94 Ga0105245_10258510 3300009098 Bacteria 1694
95 Ga0105247_10089908 3300009101 Unclassified 1947
96 Ga0105247_11179246 3300009101 Bacteria 609
97 Ga0114129_10000684 3300009147 Bacteria 42801
98 Ga0114129_10002998 3300009147 Bacteria 23653
99 Ga0114129_10011167 3300009147 Bacteria 12804
100 Ga0105243_12141372 3300009148 Unclassified 595
101 Ga0105241_10423653 3300009174 Unclassified 1172
102 Ga0105241_11391667 3300009174 Bacteria 671
103 Ga0105242_10005420 3300009176 Bacteria 9867
104 Ga0105242_10041974 3300009176 Unclassified 3692
105 Ga0105242_10948705 3300009176 Unclassified 864
106 Ga0105248_10011217 3300009177 Bacteria 9883
107 Ga0105248_10011809 3300009177 Bacteria 9634
108 Ga0105248_10430157 3300009177 Bacteria 1487
109 Ga0105248_11448051 3300009177 Bacteria 777
110 Ga0105237_10189781 3300009545 Unclassified 2055
111 Ga0105249_10665896 3300009553 Unclassified 1099
112 Ga0105249_11189541 3300009553 Bacteria 833
113 Ga0105249_12882847 3300009553 Unclassified 552
114 Ga0105249_13190133 3300009553 Unclassified 527
115 Ga0105249_13417213 3300009553 Unclassified 511
116 Ga0105239_11189333 3300010375 Bacteria 878
117 Ga0105239_11294344 3300010375 Bacteria 841
118 Ga0157340_1021313 3300012473 Unclassified 549
119 Ga0157374_10008482 3300013296 Bacteria 8790
120 Ga0157374_11975001 3300013296 Bacteria 609
121 Ga0157378_10431415 3300013297 Bacteria 1304
122 Ga0157378_11619669 3300013297 Bacteria 693
123 Ga0163162_10203069 3300013306 Unclassified 2111
124 Ga0163162_13262540 3300013306 Bacteria 520
125 Ga0157375_10210845 3300013308 Bacteria 2100
126 Ga0163163_10010086 3300014325 Bacteria 8475
127 Ga0163163_10204488 3300014325 Bacteria 2023
128 Ga0163163_11897052 3300014325 Bacteria 656
129 Ga0157380_10529999 3300014326 Bacteria 1151
130 Ga0157380_10531002 3300014326 Bacteria 1150
131 Ga0157377_10252791 3300014745 Bacteria 1143
132 Ga0157379_10015416 3300014968 Bacteria 6704
133 Ga0157379_12492494 3300014968 Unclassified 517
134 Ga0157376_10015600 3300014969 Bacteria 5744
135 Ga0157376_10086333 3300014969 Bacteria 2705
136 Ga0157376_10117216 3300014969 Bacteria 2354
137 Ga0157376_10569416 3300014969 Unclassified 1123
138 Ga0157376_11879730 3300014969 Bacteria 635
139 Ga0163161_10662680 3300017792 Bacteria 866
140 Ga0206352_10511350 3300020078 Unclassified 546
141 Ga0206352_11214068 3300020078 Bacteria 537
142 Ga0224712_10054033 3300022467 Unclassified 1575
143 Ga0207656_10169466 3300025321 Bacteria 1043
144 Ga0207656_10258915 3300025321 Bacteria 854
145 Ga0207656_10267843 3300025321 Unclassified 840
146 Ga0207682_10005717 3300025893 Bacteria 5043
147 Ga0207682_10066839 3300025893 Unclassified 1516
148 Ga0207642_10061024 3300025899 Unclassified 1751
149 Ga0207688_10242787 3300025901 Bacteria 1089
150 Ga0207688_10763110 3300025901 Unclassified 612
151 Ga0207680_10072731 3300025903 Bacteria 2135
152 Ga0207680_10993801 3300025903 Bacteria 601
153 Ga0207699_10501042 3300025906 Bacteria 876
154 Ga0207645_10201687 3300025907 Bacteria 1309
155 Ga0207643_10150571 3300025908 Unclassified 1395
156 Ga0207705_10755179 3300025909 Bacteria 755
157 Ga0207654_10537297 3300025911 Bacteria 829
158 Ga0207707_10023073 3300025912 Bacteria 5444
159 Ga0207707_10232183 3300025912 Unclassified 1605
160 Ga0207695_10546426 3300025913 Bacteria 1040
161 Ga0207662_10345549 3300025918 Bacteria 998
162 Ga0207662_11230627 3300025918 Bacteria 532
163 Ga0207657_10408099 3300025919 Bacteria 1068
164 Ga0207649_10027454 3300025920 Bacteria 3340
165 Ga0207649_10148489 3300025920 Unclassified 1612
166 Ga0207652_10808978 3300025921 Unclassified 832
167 Ga0207652_11031649 3300025921 Unclassified 722
168 Ga0207646_10108507 3300025922 Bacteria 2490
169 Ga0207681_10006280 3300025923 Bacteria 7296
170 Ga0207681_10476188 3300025923 Bacteria 1019
171 Ga0207650_10032996 3300025925 Unclassified 3747
172 Ga0207650_10033989 3300025925 Bacteria 3696
173 Ga0207650_10354397 3300025925 Unclassified 1208
174 Ga0207650_11157163 3300025925 Bacteria 659
175 Ga0207659_10328957 3300025926 Bacteria 1263
176 Ga0207659_10424713 3300025926 Bacteria 1115
177 Ga0207659_10450889 3300025926 Bacteria 1083
178 Ga0207687_10051801 3300025927 Bacteria 2862
179 Ga0207687_10100232 3300025927 Bacteria 2130
180 Ga0207687_10720580 3300025927 Bacteria 847
181 Ga0207644_10065958 3300025931 Bacteria 2634
182 Ga0207644_10811491 3300025931 Bacteria 783
183 Ga0207644_11058043 3300025931 Unclassified 681
184 Ga0207690_11677324 3300025932 Unclassified 531
185 Ga0207706_10235538 3300025933 Bacteria 1601
186 Ga0207706_10251569 3300025933 Bacteria 1543
187 Ga0207706_10661685 3300025933 Unclassified 894
188 Ga0207686_10003510 3300025934 Bacteria 8421
189 Ga0207686_10819869 3300025934 Unclassified 747
190 Ga0207670_11497241 3300025936 Unclassified 574
191 Ga0207669_11369937 3300025937 Bacteria 602
192 Ga0207704_10030279 3300025938 Bacteria 3033
193 Ga0207704_10275194 3300025938 Bacteria 1277
194 Ga0207704_10612038 3300025938 Bacteria 893
195 Ga0207704_10841040 3300025938 Unclassified 769
196 Ga0207704_10883948 3300025938 Bacteria 751
197 Ga0207665_10413415 3300025939 Bacteria 1029
198 Ga0207691_10025721 3300025940 Bacteria 5524
199 Ga0207691_10064751 3300025940 Bacteria 3311
200 Ga0207691_10091157 3300025940 Bacteria 2731
201 Ga0207691_10394630 3300025940 Bacteria 1180
202 Ga0207691_11172539 3300025940 Bacteria 637
203 Ga0207711_10060017 3300025941 Bacteria 3276
204 Ga0207711_10071693 3300025941 Bacteria 3007
205 Ga0207711_10242734 3300025941 Bacteria 1652
206 Ga0207711_10574730 3300025941 Unclassified 1051
207 Ga0207689_11598836 3300025942 Bacteria 542
208 Ga0207661_10026252 3300025944 Bacteria 4435
209 Ga0207679_10012693 3300025945 Bacteria 5500
210 Ga0207679_10223185 3300025945 Bacteria 1586
211 Ga0207667_11958598 3300025949 Bacteria 547
212 Ga0207651_10133564 3300025960 Bacteria 1904
213 Ga0207712_10053179 3300025961 Bacteria 2840
214 Ga0207712_10085636 3300025961 Unclassified 2307
215 Ga0207712_10945704 3300025961 Bacteria 763
216 Ga0207668_10016325 3300025972 Bacteria 4632
217 Ga0207668_10253744 3300025972 Bacteria 1430
218 Ga0207658_10566208 3300025986 Bacteria 1018
219 Ga0207677_10009286 3300026023 Bacteria 5528
220 Ga0207677_10448438 3300026023 Bacteria 1105
221 Ga0207677_11406442 3300026023 Bacteria 643
222 Ga0207703_10001117 3300026035 Bacteria 25361
223 Ga0207703_10360129 3300026035 Bacteria 1341
224 Ga0207703_11892084 3300026035 Unclassified 573
225 Ga0207703_12121159 3300026035 Bacteria 538
226 Ga0207639_10557014 3300026041 Unclassified 1053
227 Ga0207639_12303427 3300026041 Bacteria 500
228 Ga0207678_10045865 3300026067 Bacteria 3779
229 Ga0207678_10134457 3300026067 Bacteria 2110
230 Ga0207678_11385809 3300026067 Unclassified 622
231 Ga0207708_10341528 3300026075 Bacteria 1226
232 Ga0207702_11957865 3300026078 Unclassified 577
233 Ga0207641_10504426 3300026088 Bacteria 1175
234 Ga0207641_10587500 3300026088 Archaea 1089
235 Ga0207641_12070542 3300026088 Bacteria 570
236 Ga0207648_10686068 3300026089 Bacteria 948
237 Ga0207648_11067819 3300026089 Bacteria 757
238 Ga0207648_11224326 3300026089 Unclassified 705
239 Ga0207676_10078092 3300026095 Bacteria 2680
240 Ga0207676_10400287 3300026095 Bacteria 1283
241 Ga0207676_10610819 3300026095 Unclassified 1048
242 Ga0207674_10081672 3300026116 Bacteria 3234
243 Ga0207675_100032892 3300026118 Bacteria 4832
244 Ga0207675_100254452 3300026118 Bacteria 1700
245 Ga0207675_101197910 3300026118 Bacteria 780
246 Ga0207683_10068944 3300026121 Bacteria 3123
247 Ga0207683_10360350 3300026121 Bacteria 1335
248 Ga0207683_11049461 3300026121 Unclassified 756
249 Ga0207698_10249881 3300026142 Bacteria 1622
250 Ga0207698_11314367 3300026142 Bacteria 738
251 Ga0209813_10007409 3300027866 Bacteria 2733
252 Ga0209813_10275482 3300027866 Bacteria 646
253 Ga0207428_10118672 3300027907 Bacteria 2030
254 Ga0268266_10003213 3300028379 Bacteria 16522
255 Ga0268266_10230928 3300028379 Bacteria 1704
256 Ga0268266_11518262 3300028379 Bacteria 645
257 Ga0268265_12301563 3300028380 Bacteria 546
258 Ga0268264_10042164 3300028381 Bacteria 3777
259 Ga0268264_10506339 3300028381 Unclassified 1178
260 Ga0268264_11297783 3300028381 Unclassified 738
261 Ga0307408_100013214 3300031548 Bacteria 5481
262 Ga0307408_100027969 3300031548 Bacteria 3892
263 Ga0307408_100308637 3300031548 Unclassified 1328
264 Ga0307408_101219584 3300031548 Unclassified 702
265 Ga0307405_10030754 3300031731 Bacteria 3152
266 Ga0307405_10305389 3300031731 Bacteria 1209
267 Ga0307405_10897806 3300031731 Unclassified 749
268 Ga0307405_11047729 3300031731 Bacteria 698
269 Ga0307405_11528058 3300031731 Bacteria 587
270 Ga0307413_10167808 3300031824 Unclassified 1550
271 Ga0307413_10172433 3300031824 Unclassified 1533
272 Ga0307413_10317990 3300031824 Bacteria 1188
273 Ga0307413_11005708 3300031824 Unclassified 715
274 Ga0307413_11663244 3300031824 Bacteria 568
275 Ga0307410_10211139 3300031852 Bacteria 1487
276 Ga0307410_10691607 3300031852 Unclassified 859
277 Ga0307406_10072441 3300031901 Bacteria 2262
278 Ga0307406_10123758 3300031901 Bacteria 1803
279 Ga0307406_10497264 3300031901 Bacteria 988
280 Ga0307406_11360657 3300031901 Unclassified 621
281 Ga0307406_11725975 3300031901 Bacteria 555
282 Ga0307407_10273325 3300031903 Bacteria 1167
283 Ga0307407_10714177 3300031903 Unclassified 756
284 Ga0307412_10149115 3300031911 Bacteria 1723
285 Ga0307412_10318866 3300031911 Bacteria 1236
286 Ga0307412_10550836 3300031911 Unclassified 969
287 Ga0307412_11005105 3300031911 Unclassified 737
288 Ga0307412_11327237 3300031911 Unclassified 648
289 Ga0307409_100140202 3300031995 Bacteria 2082
290 Ga0307409_100283230 3300031995 Bacteria 1533
291 Ga0307409_100598528 3300031995 Bacteria 1089
292 Ga0307409_101612175 3300031995 Bacteria 677
293 Ga0307416_100009722 3300032002 Bacteria 6316
294 Ga0307416_100024525 3300032002 Bacteria 4405
295 Ga0307416_100073020 3300032002 Bacteria 2858
296 Ga0307416_100291304 3300032002 Bacteria 1616
297 Ga0307416_100383573 3300032002 Bacteria 1436
298 Ga0307416_100647719 3300032002 Bacteria 1141
299 Ga0307416_100740196 3300032002 Bacteria 1075
300 Ga0307416_102349967 3300032002 Unclassified 633
301 Ga0307416_103055091 3300032002 Bacteria 560
302 Ga0307416_103193803 3300032002 Unclassified 548
303 Ga0307416_103460099 3300032002 Unclassified 528
304 Ga0307414_10131557 3300032004 Bacteria 1943
305 Ga0307414_11079414 3300032004 Unclassified 741
306 Ga0307414_11365896 3300032004 Unclassified 658
307 Ga0307411_10215514 3300032005 Bacteria 1486
308 Ga0307411_10246394 3300032005 Bacteria 1402
309 Ga0307411_10447734 3300032005 Bacteria 1079
310 Ga0307411_10879013 3300032005 Bacteria 795
311 Ga0307411_11707954 3300032005 Unclassified 583
312 Ga0307415_100296418 3300032126 Bacteria 1337
313 Ga0307415_102360928 3300032126 Unclassified 522
314 Ga0373925_0893804 3300037068 Bacteria 732
315 Ga0451802_0205088 3300041460 Unclassified 773
316 Ga0451804_0048032 3300041463 Unclassified 594
317 Ga0451807_0280300 3300041486 Bacteria 957
318 Ga0451807_1555407 3300041486 Bacteria 694
319 Ga0451837_1789254 3300041494 Bacteria 667
320 Ga0451849_0174567 3300041505 Unclassified 970
321 Ga0451853_0946804 3300041512 Unclassified 998
322 Ga0439433_0153606 3300041999 Bacteria 593
323 Ga0439445_0191815 3300042004 Unclassified 602
324 Ga0439445_0197150 3300042004 Unclassified 594
325 Ga0439449_0129958 3300042007 Bacteria 936
326 Ga0439449_0253783 3300042007 Unclassified 661
327 Ga0450920_046620 3300042122 Bacteria 866
328 Ga0450923_030572 3300042125 Bacteria 1096
329 Ga0450896_028914 3300042133 Bacteria 833
330 Ga0439446_0006105 3300042156 Bacteria 3128
331 Ga0450908_001910 3300042184 Bacteria 4074
332 Ga0439435_0053004 3300042436 Unclassified 1165
333 Ga0450918_087500 3300042531 Unclassified 599
334 Ga0451577_0039937 3300042876 Bacteria 4214
335 Ga0451577_0052742 3300042876 Bacteria 3631
336 Ga0451577_0405672 3300042876 Bacteria 1237
337 Ga0453684_0076525 3300044712 Bacteria 4201
338 Ga0453684_0261550 3300044712 Bacteria 1982
339 Ga0453684_0444621 3300044712 Bacteria 1444
340 Ga0466958_0545368 3300045836 Unclassified 753
341 Ga0495598_0161911 3300046537 Unclassified 788
342 Ga0495658_0524479 3300046683 Unclassified 758
343 Ga0496101_0428957 3300048904 Bacteria 1042
344 Ga0496104_0003297 3300048907 Bacteria 13929
345 Ga0496105_0420461 3300048908 Bacteria 1058
346 Ga0496105_1302175 3300048908 Bacteria 530
347 Ga0496106_0263651 3300048909 Bacteria 1379
348 Ga0496106_0753649 3300048909 Bacteria 774
349 Ga0496107_0356805 3300048910 Bacteria 1088
350 Ga0496108_0014592 3300048911 Bacteria 6413
351 Ga0496109_0014602 3300048912 Bacteria 6833
352 Ga0496110_0014202 3300048913 Bacteria 6607
353 Ga0496110_1405013 3300048913 Unclassified 607
354 Ga0496111_0138220 3300048914 Bacteria 1805
355 Ga0496112_0024482 3300048915 Bacteria 5781
356 Ga0496114_0085681 3300048917 Bacteria 2669
357 Ga0496114_0760360 3300048917 Archaea 847
358 Ga0496115_0165716 3300048918 Unclassified 1828
359 Ga0501291_149425 3300049514 Unclassified 527
360 Ga0501300_084789 3300049523 Bacteria 525
361 Ga0501031_0118441 3300049568 Bacteria 1730
362 Ga0501031_0283801 3300049568 Bacteria 1074
363 Ga0501031_0647549 3300049568 Unclassified 679
364 Ga0501036_0066768 3300049572 Bacteria 3044
365 Ga0501036_0293512 3300049572 Bacteria 1360
366 Ga0501036_0329285 3300049572 Bacteria 1276
367 Ga0501037_0183316 3300049573 Unclassified 1485
368 Ga0501037_0579480 3300049573 Bacteria 755
369 Ga0501039_0216911 3300049575 Bacteria 1504
370 Ga0501039_0471121 3300049575 Bacteria 986
371 Ga0501039_0797823 3300049575 Bacteria 737
372 Ga0501040_0024917 3300049576 Bacteria 4020
373 Ga0501040_0060175 3300049576 Unclassified 2610
374 Ga0501040_0198378 3300049576 Bacteria 1425
375 Ga0501040_0295699 3300049576 Unclassified 1157
376 Ga0501041_0026587 3300049577 Bacteria 3482
377 Ga0501041_0042074 3300049577 Bacteria 2775
378 Ga0501041_0546645 3300049577 Bacteria 738
379 Ga0501041_0694033 3300049577 Bacteria 651
380 Ga0501042_0050065 3300049578 Bacteria 2980
381 Ga0501042_0061110 3300049578 Unclassified 2692
382 Ga0501042_0075315 3300049578 Unclassified 2415
383 Ga0501042_0179866 3300049578 Bacteria 1526
384 Ga0501042_0886076 3300049578 Bacteria 650
385 Ga0501046_0138905 3300049580 Unclassified 1840
386 Ga0501048_0044900 3300049582 Bacteria 3157
387 Ga0501048_0094998 3300049582 Unclassified 2103
388 Ga0501048_0400016 3300049582 Bacteria 982
389 Ga0501069_0250541 3300049585 Unclassified 1033
390 Ga0501069_0925292 3300049585 Unclassified 531
391 Ga0501071_0007028 3300049587 Bacteria 7353
392 Ga0501071_0015190 3300049587 Bacteria 5281
393 Ga0501071_0110118 3300049587 Bacteria 2035
394 Ga0501071_0160521 3300049587 Unclassified 1680
395 Ga0501071_0514333 3300049587 Unclassified 918
396 Ga0501071_0723925 3300049587 Bacteria 766
397 Ga0501072_0117533 3300049588 Bacteria 2118
398 Ga0501072_0120049 3300049588 Unclassified 2094
399 Ga0501073_0959862 3300049589 Bacteria 588
400 Ga0501074_0359005 3300049590 Bacteria 1034
401 Ga0501075_0039986 3300049591 Bacteria 3511
402 Ga0501075_0275092 3300049591 Bacteria 1283
403 Ga0501075_0503212 3300049591 Unclassified 924
404 Ga0501075_0707090 3300049591 Unclassified 768
405 Ga0501075_0914321 3300049591 Bacteria 667
406 Ga0501075_1424374 3300049591 Unclassified 525
407 Ga0501076_0030654 3300049592 Bacteria 4190
408 Ga0501076_0041859 3300049592 Bacteria 3606
409 Ga0501076_0065861 3300049592 Bacteria 2890
410 Ga0501076_0936950 3300049592 Bacteria 714
411 Ga0501076_1783777 3300049592 Unclassified 504
412 Ga0501077_0708849 3300049593 Unclassified 647
413 Ga0501077_1109652 3300049593 Unclassified 509
414 Ga0501077_1117431 3300049593 Bacteria 507
415 Ga0501257_271411 3300049686 Unclassified 508
416 Ga0501225_0257382 3300049705 Unclassified 576
417 Ga0501079_0059999 3300049741 Unclassified 2934
418 Ga0501079_0154399 3300049741 Bacteria 1789
419 Ga0501080_0213355 3300049742 Bacteria 1768
420 Ga0501080_0886294 3300049742 Unclassified 778
421 Ga0501081_0328925 3300049743 Unclassified 1124
422 Ga0501083_0441652 3300049744 Unclassified 847
423 Ga0501035_0878797 3300049822 Unclassified 711
424 Ga0501045_0144576 3300049824 Bacteria 1769
425 Ga0501045_0145567 3300049824 Unclassified 1762
426 Ga0501045_0147501 3300049824 Bacteria 1750
427 Ga0501045_0591632 3300049824 Unclassified 822
428 Ga0501045_1203555 3300049824 Bacteria 553
429 Ga0501212_083452 3300049851 Unclassified 581
430 nmdc:mga03683_444090_c1 3300050489 Bacteria 623
431 nmdc:mga03n38_442569_c1 3300050490 Bacteria 722
432 nmdc:mga00v17_366946_c1 3300050491 Bacteria 936
433 nmdc:mga00v17_469839_c1 3300050491 Unclassified 816
434 nmdc:mga0yw44_796033_c1 3300050492 Unclassified 642
435 nmdc:mga0yw44_858971_c1 3300050492 Bacteria 616
436 nmdc:mga0k408_170202_c1 3300050493 Bacteria 1298
437 nmdc:mga0k408_17218_c1 3300050493 Bacteria 4023
438 nmdc:mga0k408_594071_c1 3300050493 Bacteria 653
439 nmdc:mga0k408_8093_c1 3300050493 Bacteria 3103
440 nmdc:mga06z11_105936_c1 3300050494 Unclassified 1550
441 nmdc:mga06z11_211157_c1 3300050494 Bacteria 1131
442 nmdc:mga06z11_322484_c1 3300050494 Bacteria 922
443 nmdc:mga06z11_684648_c1 3300050494 Bacteria 625
444 nmdc:mga04h51_204659_c1 3300050495 Bacteria 777
445 nmdc:mga04h51_6639_c1 3300050495 Bacteria 3012
446 nmdc:mga07m45_27428_c2 3300050496 Bacteria 1649
447 nmdc:mga05p37_23490_c1 3300050507 Bacteria 7481
448 nmdc:mga09592_68656_c1 3300050508 Bacteria 3006
449 nmdc:mga09592_93718_c1 3300050508 Bacteria 2568
450 nmdc:mga0qj67_1177722_c1 3300050509 Unclassified 597
451 nmdc:mga0qj67_1600456_c1 3300050509 Bacteria 500
452 nmdc:mga06r32_1120864_c1 3300050510 Bacteria 735
453 nmdc:mga06r32_375266_c1 3300050510 Unclassified 1405
454 nmdc:mga06r32_8785_c1 3300050510 Bacteria 9105
455 nmdc:mga08y16_1316_c1 3300050511 Bacteria 24685
456 nmdc:mga08y16_240261_c1 3300050511 Bacteria 1872
457 nmdc:mga08y16_82861_c1 3300050511 Bacteria 3343
458 nmdc:mga0n895_123_c1 3300050512 Bacteria 46084
459 nmdc:mga0n895_158720_c1 3300050512 Unclassified 2293
460 nmdc:mga0n895_1766861_c1 3300050512 Unclassified 580
461 nmdc:mga0n895_283863_c1 3300050512 Unclassified 1679
462 nmdc:mga0n895_600911_c1 3300050512 Bacteria 1102
463 nmdc:mga0rr50_27_c1 3300050513 Bacteria 109881
464 nmdc:mga08x19_337_c1 3300050514 Bacteria 33875
465 nmdc:mga08x19_488500_c1 3300050514 Unclassified 869
466 nmdc:mga08x19_71654_c1 3300050514 Bacteria 2260
467 nmdc:mga0sz30_324056_c1 3300050516 Bacteria 688
468 Ga0501084_0060545 3300054114 Bacteria 3170
469 Ga0501084_0124121 3300054114 Unclassified 2172
470 Ga0590071_069336 3300059421 Bacteria 868
471 Ga0590071_131816 3300059421 Unclassified 642
472 Ga0590071_143988 3300059421 Unclassified 616
473 Ga0590075_080469 3300059424 Bacteria 844
474 Ga0590075_097085 3300059424 Unclassified 766
475 Ga0587066_213315 3300059490 Unclassified 514
476 Ga0587070_029518 3300059491 Unclassified 985
477 Ga0587073_0192673 3300059492 Unclassified 606
478 Ga0587073_0338655 3300059492 Bacteria 501
479 Ga0587083_0257401 3300059505 Unclassified 522
480 Ga0587091_046442 3300059511 Unclassified 876
481 Ga0587072_070687 3300059643 Unclassified 737
482 Ga0501082_0140375 3300060353 Bacteria 2097
483 Ga0501082_0188947 3300060353 Bacteria 1792
484 Ga0501082_0317396 3300060353 Unclassified 1357
485 Ga0501082_1056075 3300060353 Unclassified 710
486 Ga0530510_0975406 3300061734 Unclassified 648
487 Ga0530510_1046735 3300061734 Unclassified 625

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006194 Ga0075427_10068428 Ga0075427_100684282 34
2 3300006844 Ga0075428_100000748 Ga0075428_10000074812 34
3 3300006846 Ga0075430_100007553 Ga0075430_1000075536 34
4 3300006847 Ga0075431_100001504 Ga0075431_10000150418 34
5 3300006852 Ga0075433_10013833 Ga0075433_100138336 34
6 3300006871 Ga0075434_101367139 Ga0075434_1013671392 34
7 3300006880 Ga0075429_100000781 Ga0075429_10000078114 34
8 3300006880 Ga0075429_101293252 Ga0075429_1012932522 34
9 3300009094 Ga0111539_10000860 Ga0111539_1000086018 34
10 3300009147 Ga0114129_10000684 Ga0114129_1000068419 34
11 3300009147 Ga0114129_10011167 Ga0114129_100111676 34
12 3300031911 Ga0307412_11327237 Ga0307412_113272371 35
13 3300032002 Ga0307416_103193803 Ga0307416_1031938031 35
14 3300005543 Ga0070672_100099207 Ga0070672_1000992072 36
15 3300005563 Ga0068855_102330338 Ga0068855_1023303382 36
16 3300005564 Ga0070664_100005497 Ga0070664_1000054974 36
17 3300005577 Ga0068857_100066778 Ga0068857_1000667782 36
18 3300005578 Ga0068854_101097868 Ga0068854_1010978682 36
19 3300005842 Ga0068858_102315335 Ga0068858_1023153352 36
20 3300006163 Ga0070715_10551032 Ga0070715_105510321 36
21 3300006173 Ga0070716_101064973 Ga0070716_1010649731 36
22 3300006844 Ga0075428_100006301 Ga0075428_1000063011 36
23 3300006847 Ga0075431_100022748 Ga0075431_1000227482 36
24 3300006871 Ga0075434_100045401 Ga0075434_1000454012 36
25 3300006871 Ga0075434_101787837 Ga0075434_1017878371 36
26 3300006880 Ga0075429_100066138 Ga0075429_1000661382 36
27 3300006880 Ga0075429_100098164 Ga0075429_1000981642 36
28 3300006881 Ga0068865_100998671 Ga0068865_1009986712 36
29 3300006914 Ga0075436_100008000 Ga0075436_1000080002 36
30 3300006914 Ga0075436_100120505 Ga0075436_1001205052 36
31 3300007076 Ga0075435_100000002 Ga0075435_100000002124 36
32 3300007076 Ga0075435_100028104 Ga0075435_1000281045 36
33 3300009093 Ga0105240_10718288 Ga0105240_107182882 36
34 3300009094 Ga0111539_10518154 Ga0111539_105181542 36
35 3300009094 Ga0111539_12712706 Ga0111539_127127061 36
36 3300009098 Ga0105245_10258510 Ga0105245_102585102 36
37 3300009147 Ga0114129_10002998 Ga0114129_1000299810 36
38 3300009174 Ga0105241_10423653 Ga0105241_104236532 36
39 3300009177 Ga0105248_10011217 Ga0105248_100112175 36
40 3300009177 Ga0105248_10430157 Ga0105248_104301572 36
41 3300009553 Ga0105249_10665896 Ga0105249_106658962 36
42 3300009553 Ga0105249_12882847 Ga0105249_128828472 36
43 3300009553 Ga0105249_13417213 Ga0105249_134172132 36
44 3300010375 Ga0105239_11189333 Ga0105239_111893332 36
45 3300010375 Ga0105239_11294344 Ga0105239_112943442 36
46 3300013297 Ga0157378_10431415 Ga0157378_104314152 36
47 3300013306 Ga0163162_13262540 Ga0163162_132625402 36
48 3300014325 Ga0163163_10010086 Ga0163163_100100865 36
49 3300014326 Ga0157380_10529999 Ga0157380_105299992 36
50 3300014968 Ga0157379_12492494 Ga0157379_124924942 36
51 3300014969 Ga0157376_10569416 Ga0157376_105694162 36
52 3300020078 Ga0206352_10511350 Ga0206352_105113502 36
53 3300020078 Ga0206352_11214068 Ga0206352_112140682 36
54 3300025906 Ga0207699_10501042 Ga0207699_105010422 36
55 3300025913 Ga0207695_10546426 Ga0207695_105464262 36
56 3300025918 Ga0207662_10345549 Ga0207662_103455492 36
57 3300025919 Ga0207657_10408099 Ga0207657_104080992 36
58 3300025920 Ga0207649_10027454 Ga0207649_100274542 36
59 3300025921 Ga0207652_10808978 Ga0207652_108089781 36
60 3300025922 Ga0207646_10108507 Ga0207646_101085072 36
61 3300025923 Ga0207681_10006280 Ga0207681_100062803 36
62 3300025925 Ga0207650_10032996 Ga0207650_100329962 36
63 3300025925 Ga0207650_10354397 Ga0207650_103543972 36
64 3300025927 Ga0207687_10720580 Ga0207687_107205802 36
65 3300025931 Ga0207644_10065958 Ga0207644_100659582 36
66 3300025933 Ga0207706_10235538 Ga0207706_102355382 36
67 3300025933 Ga0207706_10251569 Ga0207706_102515692 36
68 3300025938 Ga0207704_10883948 Ga0207704_108839482 36
69 3300025939 Ga0207665_10413415 Ga0207665_104134152 36
70 3300025940 Ga0207691_10064751 Ga0207691_100647512 36
71 3300025940 Ga0207691_10394630 Ga0207691_103946302 36
72 3300025941 Ga0207711_10071693 Ga0207711_100716932 36
73 3300025941 Ga0207711_10242734 Ga0207711_102427342 36
74 3300025944 Ga0207661_10026252 Ga0207661_100262523 36
75 3300025945 Ga0207679_10012693 Ga0207679_100126933 36
76 3300025949 Ga0207667_11958598 Ga0207667_119585982 36
77 3300025961 Ga0207712_10053179 Ga0207712_100531794 36
78 3300025961 Ga0207712_10085636 Ga0207712_100856362 36
79 3300026035 Ga0207703_11892084 Ga0207703_118920842 36
80 3300026041 Ga0207639_12303427 Ga0207639_123034272 36
81 3300026067 Ga0207678_11385809 Ga0207678_113858092 36
82 3300026075 Ga0207708_10341528 Ga0207708_103415281 36
83 3300026089 Ga0207648_11224326 Ga0207648_112243262 36
84 3300026095 Ga0207676_10400287 Ga0207676_104002872 36
85 3300026116 Ga0207674_10081672 Ga0207674_100816722 36
86 3300026118 Ga0207675_100032892 Ga0207675_1000328923 36
87 3300026121 Ga0207683_11049461 Ga0207683_110494612 36
88 3300026142 Ga0207698_11314367 Ga0207698_113143672 36
89 3300027907 Ga0207428_10118672 Ga0207428_101186722 36
90 3300028381 Ga0268264_11297783 Ga0268264_112977832 36
91 3300031548 Ga0307408_100308637 Ga0307408_1003086372 36
92 3300031548 Ga0307408_101219584 Ga0307408_1012195842 36
93 3300031731 Ga0307405_10897806 Ga0307405_108978062 36
94 3300031731 Ga0307405_11528058 Ga0307405_115280582 36
95 3300031824 Ga0307413_10172433 Ga0307413_101724332 36
96 3300031824 Ga0307413_10317990 Ga0307413_103179902 36
97 3300031824 Ga0307413_11005708 Ga0307413_110057082 36
98 3300031852 Ga0307410_10211139 Ga0307410_102111392 36
99 3300031901 Ga0307406_10072441 Ga0307406_100724412 36
100 3300031901 Ga0307406_10497264 Ga0307406_104972642 36
101 3300031901 Ga0307406_11360657 Ga0307406_113606572 36
102 3300031903 Ga0307407_10273325 Ga0307407_102733252 36
103 3300031903 Ga0307407_10714177 Ga0307407_107141772 36
104 3300031911 Ga0307412_10149115 Ga0307412_101491152 36
105 3300031911 Ga0307412_11005105 Ga0307412_110051052 36
106 3300031995 Ga0307409_100283230 Ga0307409_1002832302 36
107 3300031995 Ga0307409_100598528 Ga0307409_1005985282 36
108 3300032002 Ga0307416_100073020 Ga0307416_1000730203 36
109 3300032002 Ga0307416_100291304 Ga0307416_1002913042 36
110 3300032002 Ga0307416_100740196 Ga0307416_1007401962 36
111 3300032002 Ga0307416_103460099 Ga0307416_1034600992 36
112 3300032004 Ga0307414_10131557 Ga0307414_101315572 36
113 3300032004 Ga0307414_11079414 Ga0307414_110794142 36
114 3300032004 Ga0307414_11365896 Ga0307414_113658962 36
115 3300032005 Ga0307411_10447734 Ga0307411_104477342 36
116 3300032126 Ga0307415_100296418 Ga0307415_1002964182 36
117 3300037068 Ga0373925_0893804 Ga0373925_0893804_609_719 36
118 3300041460 Ga0451802_0205088 Ga0451802_0205088_535_645 36
119 3300041463 Ga0451804_0048032 Ga0451804_0048032_262_372 36
120 3300041486 Ga0451807_1555407 Ga0451807_1555407_341_451 36
121 3300041505 Ga0451849_0174567 Ga0451849_0174567_380_490 36
122 3300041512 Ga0451853_0946804 Ga0451853_0946804_220_330 36
123 3300041999 Ga0439433_0153606 Ga0439433_0153606_439_549 36
124 3300042004 Ga0439445_0191815 Ga0439445_0191815_104_214 36
125 3300042007 Ga0439449_0129958 Ga0439449_0129958_398_508 36
126 3300042007 Ga0439449_0253783 Ga0439449_0253783_183_293 36
127 3300042156 Ga0439446_0006105 Ga0439446_0006105_2687_2797 36
128 3300042876 Ga0451577_0039937 Ga0451577_0039937_210_320 36
129 3300044712 Ga0453684_0076525 Ga0453684_0076525_419_529 36
130 3300045836 Ga0466958_0545368 Ga0466958_0545368_20_130 36
131 3300046537 Ga0495598_0161911 Ga0495598_0161911_496_606 36
132 3300046683 Ga0495658_0524479 Ga0495658_0524479_17_127 36
133 3300048904 Ga0496101_0428957 Ga0496101_0428957_154_264 36
134 3300048907 Ga0496104_0003297 Ga0496104_0003297_8756_8866 36
135 3300048908 Ga0496105_1302175 Ga0496105_1302175_263_373 36
136 3300048909 Ga0496106_0263651 Ga0496106_0263651_488_598 36
137 3300048910 Ga0496107_0356805 Ga0496107_0356805_909_1019 36
138 3300048911 Ga0496108_0014592 Ga0496108_0014592_4700_4810 36
139 3300048912 Ga0496109_0014602 Ga0496109_0014602_2853_2963 36
140 3300048913 Ga0496110_0014202 Ga0496110_0014202_2330_2440 36
141 3300048914 Ga0496111_0138220 Ga0496111_0138220_908_1018 36
142 3300048915 Ga0496112_0024482 Ga0496112_0024482_3256_3366 36
143 3300049514 Ga0501291_149425 Ga0501291_149425_189_299 36
144 3300049523 Ga0501300_084789 Ga0501300_084789_26_136 36
145 3300049568 Ga0501031_0283801 Ga0501031_0283801_680_790 36
146 3300049572 Ga0501036_0293512 Ga0501036_0293512_38_148 36
147 3300049575 Ga0501039_0797823 Ga0501039_0797823_300_410 36
148 3300049576 Ga0501040_0198378 Ga0501040_0198378_1124_1234 36
149 3300049576 Ga0501040_0295699 Ga0501040_0295699_261_371 36
150 3300049577 Ga0501041_0546645 Ga0501041_0546645_437_547 36
151 3300049578 Ga0501042_0179866 Ga0501042_0179866_457_567 36
152 3300049582 Ga0501048_0400016 Ga0501048_0400016_69_179 36
153 3300049587 Ga0501071_0514333 Ga0501071_0514333_291_401 36
154 3300049591 Ga0501075_0914321 Ga0501075_0914321_96_206 36
155 3300049592 Ga0501076_0936950 Ga0501076_0936950_451_561 36
156 3300049686 Ga0501257_271411 Ga0501257_271411_178_288 36
157 3300049705 Ga0501225_0257382 Ga0501225_0257382_406_516 36
158 3300049824 Ga0501045_1203555 Ga0501045_1203555_80_190 36
159 3300050507 nmdc:mga05p37_23490_c1 nmdc:mga05p37_23490_c1_76_186 36
160 3300050508 nmdc:mga09592_68656_c1 nmdc:mga09592_68656_c1_1139_1249 36
161 3300050508 nmdc:mga09592_93718_c1 nmdc:mga09592_93718_c1_1614_1724 36
162 3300050510 nmdc:mga06r32_8785_c1 nmdc:mga06r32_8785_c1_5587_5697 36
163 3300050511 nmdc:mga08y16_1316_c1 nmdc:mga08y16_1316_c1_6690_6800 36
164 3300050511 nmdc:mga08y16_82861_c1 nmdc:mga08y16_82861_c1_3203_3313 36
165 3300050512 nmdc:mga0n895_123_c1 nmdc:mga0n895_123_c1_32394_32504 36
166 3300050512 nmdc:mga0n895_158720_c1 nmdc:mga0n895_158720_c1_2056_2166 36
167 3300050512 nmdc:mga0n895_283863_c1 nmdc:mga0n895_283863_c1_49_159 36
168 3300050513 nmdc:mga0rr50_27_c1 nmdc:mga0rr50_27_c1_66852_66962 36
169 3300050514 nmdc:mga08x19_337_c1 nmdc:mga08x19_337_c1_17802_17912 36
170 3300050514 nmdc:mga08x19_488500_c1 nmdc:mga08x19_488500_c1_116_226 36
171 3300050514 nmdc:mga08x19_71654_c1 nmdc:mga08x19_71654_c1_1319_1429 36
172 3300059421 Ga0590071_069336 Ga0590071_069336_439_549 36
173 3300059421 Ga0590071_131816 Ga0590071_131816_131_241 36
174 3300059421 Ga0590071_143988 Ga0590071_143988_27_140 36
175 3300059490 Ga0587066_213315 Ga0587066_213315_265_375 36
176 3300059491 Ga0587070_029518 Ga0587070_029518_484_594 36
177 3300059492 Ga0587073_0192673 Ga0587073_0192673_262_372 36
178 3300059492 Ga0587073_0338655 Ga0587073_0338655_98_208 36
179 3300059505 Ga0587083_0257401 Ga0587083_0257401_310_420 36
180 3300059511 Ga0587091_046442 Ga0587091_046442_397_507 36
181 3300059643 Ga0587072_070687 Ga0587072_070687_297_407 36
182 3300060353 Ga0501082_1056075 Ga0501082_1056075_508_618 36
183 3300005543 Ga0070672_100012108 Ga0070672_1000121082 37
184 3300005543 Ga0070672_100163866 Ga0070672_1001638663 37
185 3300005545 Ga0070695_101258884 Ga0070695_1012588841 37
186 3300005548 Ga0070665_100133289 Ga0070665_1001332893 37
187 3300005548 Ga0070665_101574266 Ga0070665_1015742662 37
188 3300005564 Ga0070664_100322636 Ga0070664_1003226362 37
189 3300005564 Ga0070664_101878826 Ga0070664_1018788262 37
190 3300005616 Ga0068852_100274943 Ga0068852_1002749432 37
191 3300005617 Ga0068859_100156806 Ga0068859_1001568062 37
192 3300005617 Ga0068859_102111821 Ga0068859_1021118212 37
193 3300005618 Ga0068864_100038520 Ga0068864_1000385202 37
194 3300005618 Ga0068864_101627703 Ga0068864_1016277032 37
195 3300005718 Ga0068866_10334851 Ga0068866_103348512 37
196 3300005719 Ga0068861_101473756 Ga0068861_1014737562 37
197 3300005719 Ga0068861_101621548 Ga0068861_1016215481 37
198 3300005719 Ga0068861_102571335 Ga0068861_1025713352 37
199 3300005834 Ga0068851_10161516 Ga0068851_101615162 37
200 3300005834 Ga0068851_10223853 Ga0068851_102238532 37
201 3300005841 Ga0068863_100429239 Ga0068863_1004292392 37
202 3300005841 Ga0068863_100612059 Ga0068863_1006120592 37
203 3300005842 Ga0068858_100008176 Ga0068858_1000081764 37
204 3300005842 Ga0068858_101831771 Ga0068858_1018317712 37
205 3300005843 Ga0068860_102641402 Ga0068860_1026414022 37
206 3300005844 Ga0068862_101476824 Ga0068862_1014768242 37
207 3300006038 Ga0075365_10528553 Ga0075365_105285532 37
208 3300006042 Ga0075368_10388705 Ga0075368_103887052 37
209 3300006048 Ga0075363_100138709 Ga0075363_1001387092 37
210 3300006051 Ga0075364_10151562 Ga0075364_101515622 37
211 3300006051 Ga0075364_10209331 Ga0075364_102093312 37
212 3300006051 Ga0075364_10439660 Ga0075364_104396602 37
213 3300006051 Ga0075364_11035439 Ga0075364_110354392 37
214 3300006178 Ga0075367_10064857 Ga0075367_100648572 37
215 3300006178 Ga0075367_10241386 Ga0075367_102413862 37
216 3300006178 Ga0075367_10742813 Ga0075367_107428132 37
217 3300006186 Ga0075369_10202008 Ga0075369_102020082 37
218 3300006195 Ga0075366_10003343 Ga0075366_100033435 37
219 3300006195 Ga0075366_10044969 Ga0075366_100449693 37
220 3300006195 Ga0075366_10122348 Ga0075366_101223482 37
221 3300006195 Ga0075366_10258815 Ga0075366_102588152 37
222 3300006195 Ga0075366_10301034 Ga0075366_103010342 37
223 3300006237 Ga0097621_100010253 Ga0097621_1000102534 37
224 3300006237 Ga0097621_101208395 Ga0097621_1012083952 37
225 3300006237 Ga0097621_101370633 Ga0097621_1013706332 37
226 3300006353 Ga0075370_10061361 Ga0075370_100613612 37
227 3300006353 Ga0075370_10954305 Ga0075370_109543052 37
228 3300006358 Ga0068871_100041133 Ga0068871_1000411333 37
229 3300006358 Ga0068871_100212896 Ga0068871_1002128962 37
230 3300006358 Ga0068871_100270994 Ga0068871_1002709942 37
231 3300006846 Ga0075430_101194545 Ga0075430_1011945452 37
232 3300006846 Ga0075430_101755272 Ga0075430_1017552722 37
233 3300006847 Ga0075431_100385352 Ga0075431_1003853522 37
234 3300006847 Ga0075431_101782794 Ga0075431_1017827942 37
235 3300006881 Ga0068865_100000679 Ga0068865_10000067914 37
236 3300006881 Ga0068865_100044132 Ga0068865_1000441322 37
237 3300006881 Ga0068865_100227718 Ga0068865_1002277182 37
238 3300006881 Ga0068865_101288987 Ga0068865_1012889872 37
239 3300006931 Ga0097620_100156807 Ga0097620_1001568072 37
240 3300006931 Ga0097620_102110815 Ga0097620_1021108152 37
241 3300009093 Ga0105240_10344214 Ga0105240_103442141 37
242 3300009094 Ga0111539_10310676 Ga0111539_103106762 37
243 3300009098 Ga0105245_10102499 Ga0105245_101024992 37
244 3300009098 Ga0105245_10122064 Ga0105245_101220643 37
245 3300009101 Ga0105247_10089908 Ga0105247_100899083 37
246 3300009101 Ga0105247_11179246 Ga0105247_111792462 37
247 3300009148 Ga0105243_12141372 Ga0105243_121413722 37
248 3300009174 Ga0105241_11391667 Ga0105241_113916672 37
249 3300009176 Ga0105242_10005420 Ga0105242_100054208 37
250 3300009176 Ga0105242_10041974 Ga0105242_100419741 37
251 3300009176 Ga0105242_10948705 Ga0105242_109487051 37
252 3300009177 Ga0105248_10011809 Ga0105248_100118092 37
253 3300009177 Ga0105248_11448051 Ga0105248_114480512 37
254 3300009545 Ga0105237_10189781 Ga0105237_101897812 37
255 3300009553 Ga0105249_11189541 Ga0105249_111895412 37
256 3300009553 Ga0105249_13190133 Ga0105249_131901331 37
257 3300012473 Ga0157340_1021313 Ga0157340_10213132 37
258 3300013296 Ga0157374_10008482 Ga0157374_100084824 37
259 3300013296 Ga0157374_11975001 Ga0157374_119750011 37
260 3300013297 Ga0157378_11619669 Ga0157378_116196692 37
261 3300013306 Ga0163162_10203069 Ga0163162_102030692 37
262 3300013308 Ga0157375_10210845 Ga0157375_102108452 37
263 3300014325 Ga0163163_10204488 Ga0163163_102044881 37
264 3300014325 Ga0163163_11897052 Ga0163163_118970522 37
265 3300014326 Ga0157380_10531002 Ga0157380_105310022 37
266 3300014745 Ga0157377_10252791 Ga0157377_102527912 37
267 3300014968 Ga0157379_10015416 Ga0157379_100154164 37
268 3300014969 Ga0157376_10015600 Ga0157376_100156002 37
269 3300014969 Ga0157376_10086333 Ga0157376_100863333 37
270 3300014969 Ga0157376_10117216 Ga0157376_101172163 37
271 3300014969 Ga0157376_11879730 Ga0157376_118797302 37
272 3300017792 Ga0163161_10662680 Ga0163161_106626802 37
273 3300022467 Ga0224712_10054033 Ga0224712_100540332 37
274 3300025321 Ga0207656_10169466 Ga0207656_101694661 37
275 3300025321 Ga0207656_10258915 Ga0207656_102589152 37
276 3300025321 Ga0207656_10267843 Ga0207656_102678432 37
277 3300025893 Ga0207682_10005717 Ga0207682_100057173 37
278 3300025893 Ga0207682_10066839 Ga0207682_100668392 37
279 3300025899 Ga0207642_10061024 Ga0207642_100610242 37
280 3300025901 Ga0207688_10242787 Ga0207688_102427872 37
281 3300025901 Ga0207688_10763110 Ga0207688_107631102 37
282 3300025903 Ga0207680_10072731 Ga0207680_100727312 37
283 3300025903 Ga0207680_10993801 Ga0207680_109938012 37
284 3300025907 Ga0207645_10201687 Ga0207645_102016872 37
285 3300025908 Ga0207643_10150571 Ga0207643_101505712 37
286 3300025909 Ga0207705_10755179 Ga0207705_107551792 37
287 3300025911 Ga0207654_10537297 Ga0207654_105372972 37
288 3300025912 Ga0207707_10023073 Ga0207707_100230733 37
289 3300025912 Ga0207707_10232183 Ga0207707_102321832 37
290 3300025918 Ga0207662_11230627 Ga0207662_112306272 37
291 3300025920 Ga0207649_10148489 Ga0207649_101484892 37
292 3300025921 Ga0207652_11031649 Ga0207652_110316492 37
293 3300025923 Ga0207681_10476188 Ga0207681_104761882 37
294 3300025925 Ga0207650_10033989 Ga0207650_100339894 37
295 3300025925 Ga0207650_11157163 Ga0207650_111571632 37
296 3300025926 Ga0207659_10328957 Ga0207659_103289572 37
297 3300025926 Ga0207659_10424713 Ga0207659_104247132 37
298 3300025926 Ga0207659_10450889 Ga0207659_104508892 37
299 3300025927 Ga0207687_10051801 Ga0207687_100518012 37
300 3300025927 Ga0207687_10100232 Ga0207687_101002322 37
301 3300025931 Ga0207644_10811491 Ga0207644_108114912 37
302 3300025931 Ga0207644_11058043 Ga0207644_110580432 37
303 3300025932 Ga0207690_11677324 Ga0207690_116773242 37
304 3300025933 Ga0207706_10661685 Ga0207706_106616852 37
305 3300025934 Ga0207686_10003510 Ga0207686_100035104 37
306 3300025934 Ga0207686_10819869 Ga0207686_108198692 37
307 3300025936 Ga0207670_11497241 Ga0207670_114972412 37
308 3300025937 Ga0207669_11369937 Ga0207669_113699372 37
309 3300025938 Ga0207704_10030279 Ga0207704_100302793 37
310 3300025938 Ga0207704_10275194 Ga0207704_102751942 37
311 3300025938 Ga0207704_10612038 Ga0207704_106120382 37
312 3300025938 Ga0207704_10841040 Ga0207704_108410402 37
313 3300025940 Ga0207691_10025721 Ga0207691_100257214 37
314 3300025940 Ga0207691_10091157 Ga0207691_100911572 37
315 3300025940 Ga0207691_11172539 Ga0207691_111725392 37
316 3300025941 Ga0207711_10060017 Ga0207711_100600174 37
317 3300025941 Ga0207711_10574730 Ga0207711_105747301 37
318 3300025942 Ga0207689_11598836 Ga0207689_115988362 37
319 3300025945 Ga0207679_10223185 Ga0207679_102231852 37
320 3300025960 Ga0207651_10133564 Ga0207651_101335642 37
321 3300025961 Ga0207712_10945704 Ga0207712_109457042 37
322 3300025972 Ga0207668_10016325 Ga0207668_100163254 37
323 3300025972 Ga0207668_10253744 Ga0207668_102537442 37
324 3300025986 Ga0207658_10566208 Ga0207658_105662082 37
325 3300026023 Ga0207677_10009286 Ga0207677_100092862 37
326 3300026023 Ga0207677_10448438 Ga0207677_104484382 37
327 3300026023 Ga0207677_11406442 Ga0207677_114064422 37
328 3300026035 Ga0207703_10001117 Ga0207703_100011175 37
329 3300026035 Ga0207703_10360129 Ga0207703_103601292 37
330 3300026035 Ga0207703_12121159 Ga0207703_121211592 37
331 3300026041 Ga0207639_10557014 Ga0207639_105570142 37
332 3300026067 Ga0207678_10045865 Ga0207678_100458654 37
333 3300026067 Ga0207678_10134457 Ga0207678_101344572 37
334 3300026078 Ga0207702_11957865 Ga0207702_119578652 37
335 3300026088 Ga0207641_10504426 Ga0207641_105044262 37
336 3300026088 Ga0207641_10587500 Ga0207641_105875002 37
337 3300026088 Ga0207641_12070542 Ga0207641_120705422 37
338 3300026089 Ga0207648_10686068 Ga0207648_106860682 37
339 3300026089 Ga0207648_11067819 Ga0207648_110678192 37
340 3300026095 Ga0207676_10078092 Ga0207676_100780924 37
341 3300026095 Ga0207676_10610819 Ga0207676_106108192 37
342 3300026118 Ga0207675_100254452 Ga0207675_1002544522 37
343 3300026118 Ga0207675_101197910 Ga0207675_1011979102 37
344 3300026121 Ga0207683_10068944 Ga0207683_100689443 37
345 3300026121 Ga0207683_10360350 Ga0207683_103603502 37
346 3300026142 Ga0207698_10249881 Ga0207698_102498812 37
347 3300027866 Ga0209813_10007409 Ga0209813_100074093 37
348 3300027866 Ga0209813_10275482 Ga0209813_102754821 37
349 3300028379 Ga0268266_10003213 Ga0268266_1000321313 37
350 3300028379 Ga0268266_10230928 Ga0268266_102309282 37
351 3300028379 Ga0268266_11518262 Ga0268266_115182622 37
352 3300028380 Ga0268265_12301563 Ga0268265_123015632 37
353 3300028381 Ga0268264_10042164 Ga0268264_100421643 37
354 3300028381 Ga0268264_10506339 Ga0268264_105063392 37
355 3300031548 Ga0307408_100013214 Ga0307408_1000132144 37
356 3300031548 Ga0307408_100027969 Ga0307408_1000279692 37
357 3300031731 Ga0307405_10030754 Ga0307405_100307544 37
358 3300031731 Ga0307405_10305389 Ga0307405_103053892 37
359 3300031731 Ga0307405_11047729 Ga0307405_110477291 37
360 3300031824 Ga0307413_10167808 Ga0307413_101678082 37
361 3300031824 Ga0307413_11663244 Ga0307413_116632442 37
362 3300031852 Ga0307410_10691607 Ga0307410_106916072 37
363 3300031901 Ga0307406_10123758 Ga0307406_101237581 37
364 3300031901 Ga0307406_11725975 Ga0307406_117259752 37
365 3300031911 Ga0307412_10318866 Ga0307412_103188662 37
366 3300031911 Ga0307412_10550836 Ga0307412_105508362 37
367 3300031995 Ga0307409_100140202 Ga0307409_1001402023 37
368 3300031995 Ga0307409_101612175 Ga0307409_1016121752 37
369 3300032002 Ga0307416_100009722 Ga0307416_1000097222 37
370 3300032002 Ga0307416_100024525 Ga0307416_1000245253 37
371 3300032002 Ga0307416_100383573 Ga0307416_1003835732 37
372 3300032002 Ga0307416_100647719 Ga0307416_1006477192 37
373 3300032002 Ga0307416_102349967 Ga0307416_1023499672 37
374 3300032002 Ga0307416_103055091 Ga0307416_1030550911 37
375 3300032005 Ga0307411_10215514 Ga0307411_102155142 37
376 3300032005 Ga0307411_10246394 Ga0307411_102463942 37
377 3300032005 Ga0307411_10879013 Ga0307411_108790132 37
378 3300032005 Ga0307411_11707954 Ga0307411_117079542 37
379 3300032126 Ga0307415_102360928 Ga0307415_1023609282 37
380 3300041486 Ga0451807_0280300 Ga0451807_0280300_808_921 37
381 3300041494 Ga0451837_1789254 Ga0451837_1789254_68_181 37
382 3300042004 Ga0439445_0197150 Ga0439445_0197150_43_156 37
383 3300042122 Ga0450920_046620 Ga0450920_046620_439_552 37
384 3300042125 Ga0450923_030572 Ga0450923_030572_213_326 37
385 3300042133 Ga0450896_028914 Ga0450896_028914_673_786 37
386 3300042184 Ga0450908_001910 Ga0450908_001910_1121_1234 37
387 3300042436 Ga0439435_0053004 Ga0439435_0053004_128_241 37
388 3300042531 Ga0450918_087500 Ga0450918_087500_444_557 37
389 3300042876 Ga0451577_0052742 Ga0451577_0052742_2961_3074 37
390 3300042876 Ga0451577_0405672 Ga0451577_0405672_190_303 37
391 3300044712 Ga0453684_0261550 Ga0453684_0261550_960_1073 37
392 3300044712 Ga0453684_0444621 Ga0453684_0444621_448_561 37
393 3300048908 Ga0496105_0420461 Ga0496105_0420461_69_182 37
394 3300048909 Ga0496106_0753649 Ga0496106_0753649_402_515 37
395 3300048913 Ga0496110_1405013 Ga0496110_1405013_380_493 37
396 3300048917 Ga0496114_0085681 Ga0496114_0085681_2459_2572 37
397 3300048917 Ga0496114_0760360 Ga0496114_0760360_146_259 37
398 3300048918 Ga0496115_0165716 Ga0496115_0165716_379_492 37
399 3300049568 Ga0501031_0118441 Ga0501031_0118441_343_459 37
400 3300049568 Ga0501031_0647549 Ga0501031_0647549_263_376 37
401 3300049572 Ga0501036_0066768 Ga0501036_0066768_1729_1842 37
402 3300049572 Ga0501036_0329285 Ga0501036_0329285_30_143 37
403 3300049573 Ga0501037_0183316 Ga0501037_0183316_910_1026 37
404 3300049573 Ga0501037_0579480 Ga0501037_0579480_626_739 37
405 3300049575 Ga0501039_0216911 Ga0501039_0216911_361_474 37
406 3300049575 Ga0501039_0471121 Ga0501039_0471121_340_453 37
407 3300049576 Ga0501040_0024917 Ga0501040_0024917_111_224 37
408 3300049576 Ga0501040_0060175 Ga0501040_0060175_1225_1338 37
409 3300049577 Ga0501041_0026587 Ga0501041_0026587_355_468 37
410 3300049577 Ga0501041_0042074 Ga0501041_0042074_1919_2035 37
411 3300049577 Ga0501041_0694033 Ga0501041_0694033_340_453 37
412 3300049578 Ga0501042_0050065 Ga0501042_0050065_2198_2311 37
413 3300049578 Ga0501042_0061110 Ga0501042_0061110_598_711 37
414 3300049578 Ga0501042_0075315 Ga0501042_0075315_1506_1622 37
415 3300049578 Ga0501042_0886076 Ga0501042_0886076_202_315 37
416 3300049580 Ga0501046_0138905 Ga0501046_0138905_765_881 37
417 3300049582 Ga0501048_0044900 Ga0501048_0044900_1483_1596 37
418 3300049582 Ga0501048_0094998 Ga0501048_0094998_958_1074 37
419 3300049585 Ga0501069_0250541 Ga0501069_0250541_245_358 37
420 3300049585 Ga0501069_0925292 Ga0501069_0925292_292_405 37
421 3300049587 Ga0501071_0007028 Ga0501071_0007028_610_726 37
422 3300049587 Ga0501071_0015190 Ga0501071_0015190_3150_3263 37
423 3300049587 Ga0501071_0110118 Ga0501071_0110118_733_846 37
424 3300049587 Ga0501071_0160521 Ga0501071_0160521_1335_1448 37
425 3300049587 Ga0501071_0723925 Ga0501071_0723925_115_228 37
426 3300049588 Ga0501072_0117533 Ga0501072_0117533_401_514 37
427 3300049588 Ga0501072_0120049 Ga0501072_0120049_334_450 37
428 3300049589 Ga0501073_0959862 Ga0501073_0959862_420_533 37
429 3300049590 Ga0501074_0359005 Ga0501074_0359005_248_361 37
430 3300049591 Ga0501075_0039986 Ga0501075_0039986_1094_1207 37
431 3300049591 Ga0501075_0275092 Ga0501075_0275092_910_1026 37
432 3300049591 Ga0501075_0503212 Ga0501075_0503212_186_299 37
433 3300049591 Ga0501075_0707090 Ga0501075_0707090_160_273 37
434 3300049591 Ga0501075_1424374 Ga0501075_1424374_27_140 37
435 3300049592 Ga0501076_0030654 Ga0501076_0030654_1699_1812 37
436 3300049592 Ga0501076_0041859 Ga0501076_0041859_2362_2475 37
437 3300049592 Ga0501076_0065861 Ga0501076_0065861_657_773 37
438 3300049592 Ga0501076_1783777 Ga0501076_1783777_258_371 37
439 3300049593 Ga0501077_0708849 Ga0501077_0708849_413_526 37
440 3300049593 Ga0501077_1109652 Ga0501077_1109652_164_277 37
441 3300049593 Ga0501077_1117431 Ga0501077_1117431_335_451 37
442 3300049741 Ga0501079_0059999 Ga0501079_0059999_1349_1462 37
443 3300049741 Ga0501079_0154399 Ga0501079_0154399_1648_1764 37
444 3300049742 Ga0501080_0213355 Ga0501080_0213355_671_784 37
445 3300049742 Ga0501080_0886294 Ga0501080_0886294_469_585 37
446 3300049743 Ga0501081_0328925 Ga0501081_0328925_601_717 37
447 3300049744 Ga0501083_0441652 Ga0501083_0441652_466_582 37
448 3300049822 Ga0501035_0878797 Ga0501035_0878797_157_270 37
449 3300049824 Ga0501045_0144576 Ga0501045_0144576_1044_1157 37
450 3300049824 Ga0501045_0145567 Ga0501045_0145567_425_541 37
451 3300049824 Ga0501045_0147501 Ga0501045_0147501_1353_1466 37
452 3300049824 Ga0501045_0591632 Ga0501045_0591632_261_374 37
453 3300049851 Ga0501212_083452 Ga0501212_083452_167_280 37
454 3300050489 nmdc:mga03683_444090_c1 nmdc:mga03683_444090_c1_477_590 37
455 3300050490 nmdc:mga03n38_442569_c1 nmdc:mga03n38_442569_c1_519_632 37
456 3300050491 nmdc:mga00v17_366946_c1 nmdc:mga00v17_366946_c1_94_207 37
457 3300050491 nmdc:mga00v17_469839_c1 nmdc:mga00v17_469839_c1_667_780 37
458 3300050492 nmdc:mga0yw44_796033_c1 nmdc:mga0yw44_796033_c1_108_221 37
459 3300050492 nmdc:mga0yw44_858971_c1 nmdc:mga0yw44_858971_c1_97_210 37
460 3300050493 nmdc:mga0k408_170202_c1 nmdc:mga0k408_170202_c1_969_1082 37
461 3300050493 nmdc:mga0k408_17218_c1 nmdc:mga0k408_17218_c1_2750_2863 37
462 3300050493 nmdc:mga0k408_594071_c1 nmdc:mga0k408_594071_c1_318_431 37
463 3300050493 nmdc:mga0k408_8093_c1 nmdc:mga0k408_8093_c1_2532_2645 37
464 3300050494 nmdc:mga06z11_105936_c1 nmdc:mga06z11_105936_c1_1252_1365 37
465 3300050494 nmdc:mga06z11_211157_c1 nmdc:mga06z11_211157_c1_771_884 37
466 3300050494 nmdc:mga06z11_322484_c1 nmdc:mga06z11_322484_c1_550_663 37
467 3300050494 nmdc:mga06z11_684648_c1 nmdc:mga06z11_684648_c1_88_201 37
468 3300050495 nmdc:mga04h51_204659_c1 nmdc:mga04h51_204659_c1_609_722 37
469 3300050495 nmdc:mga04h51_6639_c1 nmdc:mga04h51_6639_c1_1624_1737 37
470 3300050496 nmdc:mga07m45_27428_c2 nmdc:mga07m45_27428_c2_457_570 37
471 3300050509 nmdc:mga0qj67_1177722_c1 nmdc:mga0qj67_1177722_c1_315_428 37
472 3300050509 nmdc:mga0qj67_1600456_c1 nmdc:mga0qj67_1600456_c1_369_482 37
473 3300050510 nmdc:mga06r32_1120864_c1 nmdc:mga06r32_1120864_c1_163_276 37
474 3300050510 nmdc:mga06r32_375266_c1 nmdc:mga06r32_375266_c1_1171_1284 37
475 3300050511 nmdc:mga08y16_240261_c1 nmdc:mga08y16_240261_c1_850_963 37
476 3300050512 nmdc:mga0n895_1766861_c1 nmdc:mga0n895_1766861_c1_44_157 37
477 3300050512 nmdc:mga0n895_600911_c1 nmdc:mga0n895_600911_c1_800_913 37
478 3300050516 nmdc:mga0sz30_324056_c1 nmdc:mga0sz30_324056_c1_149_262 37
479 3300054114 Ga0501084_0060545 Ga0501084_0060545_1510_1623 37
480 3300054114 Ga0501084_0124121 Ga0501084_0124121_767_883 37
481 3300059424 Ga0590075_080469 Ga0590075_080469_651_764 37
482 3300059424 Ga0590075_097085 Ga0590075_097085_37_150 37
483 3300060353 Ga0501082_0140375 Ga0501082_0140375_159_272 37
484 3300060353 Ga0501082_0188947 Ga0501082_0188947_96_209 37
485 3300060353 Ga0501082_0317396 Ga0501082_0317396_1081_1197 37
486 3300061734 Ga0530510_0975406 Ga0530510_0975406_149_262 37
487 3300061734 Ga0530510_1046735 Ga0530510_1046735_110_223 37

Feature Viewer

pLDDT pTM Quality
86.92 0.51 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map