F453413
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 487 | 224 | 487 | 37 |
Family's Representative Sequence
| Representative Sequence | 3300005545|Ga0070695_101258884|Ga0070695_1012588841 |
| Length | 40 |
| Sequence | MSELVKTVSRAARVAFTFVMMNYAAVAGLVAAARGRQAWK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 3 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 5 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 7 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 8 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 9 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 10 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 11 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 12 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 13 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 14 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 15 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 16 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 17 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 18 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 19 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 20 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 21 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 22 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 25 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 26 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 27 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 28 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 29 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 30 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 31 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 32 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 33 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 34 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 35 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 36 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 37 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 38 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 39 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 40 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 41 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300012473 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.12.yng.090610 | Metagenome | Rhizosphere |
| 54 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 65 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 66 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 120 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 124 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 125 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 126 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 127 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 128 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 129 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 130 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 131 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 132 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 133 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 134 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 135 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 136 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 137 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 138 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 139 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 140 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 141 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 142 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 143 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 144 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 145 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 146 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 147 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 148 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 149 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 150 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 151 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 152 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 153 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 154 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 155 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 158 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 159 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 160 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 161 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 162 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 163 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 164 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 165 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 166 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 167 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 168 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 169 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 170 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 171 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 172 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 173 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 174 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 175 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 176 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 177 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 178 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 179 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 180 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 181 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 182 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 183 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 184 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 185 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 186 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 187 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 188 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 189 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 190 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 191 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 192 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 193 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 194 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 195 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 196 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 197 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 198 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 199 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 200 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 201 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 202 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 203 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 204 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 205 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 206 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 207 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 208 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 209 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 210 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 211 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 212 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 213 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 214 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 215 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 216 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 217 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 218 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 219 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 220 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 221 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 222 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 223 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 224 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.95 |
| Metatranscriptomes | 2.05 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.8 |
| Nodule | 0 |
| Rhizoplane | 4.11 |
| Rhizosphere | 87.47 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.62 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070672_100012108 | 3300005543 | Bacteria | 6039 |
| 2 | Ga0070672_100099207 | 3300005543 | Bacteria | 2360 |
| 3 | Ga0070672_100163866 | 3300005543 | Bacteria | 1846 |
| 4 | Ga0070695_101258884 | 3300005545 | Unclassified | 610 |
| 5 | Ga0070665_100133289 | 3300005548 | Bacteria | 2486 |
| 6 | Ga0070665_101574266 | 3300005548 | Bacteria | 665 |
| 7 | Ga0068855_102330338 | 3300005563 | Bacteria | 535 |
| 8 | Ga0070664_100005497 | 3300005564 | Bacteria | 10176 |
| 9 | Ga0070664_100322636 | 3300005564 | Bacteria | 1400 |
| 10 | Ga0070664_101878826 | 3300005564 | Bacteria | 568 |
| 11 | Ga0068857_100066778 | 3300005577 | Bacteria | 3201 |
| 12 | Ga0068854_101097868 | 3300005578 | Bacteria | 709 |
| 13 | Ga0068852_100274943 | 3300005616 | Bacteria | 1622 |
| 14 | Ga0068859_100156806 | 3300005617 | Bacteria | 2354 |
| 15 | Ga0068859_102111821 | 3300005617 | Unclassified | 622 |
| 16 | Ga0068864_100038520 | 3300005618 | Bacteria | 4084 |
| 17 | Ga0068864_101627703 | 3300005618 | Bacteria | 650 |
| 18 | Ga0068866_10334851 | 3300005718 | Bacteria | 956 |
| 19 | Ga0068861_101473756 | 3300005719 | Bacteria | 667 |
| 20 | Ga0068861_101621548 | 3300005719 | Bacteria | 638 |
| 21 | Ga0068861_102571335 | 3300005719 | Unclassified | 513 |
| 22 | Ga0068851_10161516 | 3300005834 | Bacteria | 1231 |
| 23 | Ga0068851_10223853 | 3300005834 | Archaea | 1058 |
| 24 | Ga0068863_100429239 | 3300005841 | Unclassified | 1295 |
| 25 | Ga0068863_100612059 | 3300005841 | Unclassified | 1079 |
| 26 | Ga0068858_100008176 | 3300005842 | Bacteria | 10060 |
| 27 | Ga0068858_101831771 | 3300005842 | Bacteria | 600 |
| 28 | Ga0068858_102315335 | 3300005842 | Unclassified | 531 |
| 29 | Ga0068860_102641402 | 3300005843 | Bacteria | 521 |
| 30 | Ga0068862_101476824 | 3300005844 | Unclassified | 685 |
| 31 | Ga0075365_10528553 | 3300006038 | Bacteria | 834 |
| 32 | Ga0075368_10388705 | 3300006042 | Unclassified | 611 |
| 33 | Ga0075363_100138709 | 3300006048 | Unclassified | 1368 |
| 34 | Ga0075364_10151562 | 3300006051 | Unclassified | 1562 |
| 35 | Ga0075364_10209331 | 3300006051 | Bacteria | 1322 |
| 36 | Ga0075364_10439660 | 3300006051 | Bacteria | 891 |
| 37 | Ga0075364_11035439 | 3300006051 | Bacteria | 558 |
| 38 | Ga0070715_10551032 | 3300006163 | Bacteria | 668 |
| 39 | Ga0070716_101064973 | 3300006173 | Bacteria | 643 |
| 40 | Ga0075367_10064857 | 3300006178 | Unclassified | 2185 |
| 41 | Ga0075367_10241386 | 3300006178 | Bacteria | 1132 |
| 42 | Ga0075367_10742813 | 3300006178 | Bacteria | 624 |
| 43 | Ga0075369_10202008 | 3300006186 | Bacteria | 917 |
| 44 | Ga0075427_10068428 | 3300006194 | Unclassified | 630 |
| 45 | Ga0075366_10003343 | 3300006195 | Bacteria | 8446 |
| 46 | Ga0075366_10044969 | 3300006195 | Bacteria | 2617 |
| 47 | Ga0075366_10122348 | 3300006195 | Bacteria | 1568 |
| 48 | Ga0075366_10258815 | 3300006195 | Unclassified | 1062 |
| 49 | Ga0075366_10301034 | 3300006195 | Bacteria | 981 |
| 50 | Ga0097621_100010253 | 3300006237 | Bacteria | 6845 |
| 51 | Ga0097621_101208395 | 3300006237 | Bacteria | 712 |
| 52 | Ga0097621_101370633 | 3300006237 | Unclassified | 669 |
| 53 | Ga0075370_10061361 | 3300006353 | Bacteria | 2141 |
| 54 | Ga0075370_10954305 | 3300006353 | Bacteria | 525 |
| 55 | Ga0068871_100041133 | 3300006358 | Bacteria | 3705 |
| 56 | Ga0068871_100212896 | 3300006358 | Unclassified | 1672 |
| 57 | Ga0068871_100270994 | 3300006358 | Unclassified | 1483 |
| 58 | Ga0075428_100000748 | 3300006844 | Bacteria | 33775 |
| 59 | Ga0075428_100006301 | 3300006844 | Bacteria | 13189 |
| 60 | Ga0075430_100007553 | 3300006846 | Bacteria | 9181 |
| 61 | Ga0075430_101194545 | 3300006846 | Bacteria | 626 |
| 62 | Ga0075430_101755272 | 3300006846 | Bacteria | 509 |
| 63 | Ga0075431_100001504 | 3300006847 | Bacteria | 21608 |
| 64 | Ga0075431_100022748 | 3300006847 | Bacteria | 6407 |
| 65 | Ga0075431_100385352 | 3300006847 | Bacteria | 1405 |
| 66 | Ga0075431_101782794 | 3300006847 | Bacteria | 572 |
| 67 | Ga0075433_10013833 | 3300006852 | Bacteria | 6578 |
| 68 | Ga0075434_100045401 | 3300006871 | Bacteria | 4358 |
| 69 | Ga0075434_101367139 | 3300006871 | Bacteria | 718 |
| 70 | Ga0075434_101787837 | 3300006871 | Unclassified | 622 |
| 71 | Ga0075429_100000781 | 3300006880 | Bacteria | 25104 |
| 72 | Ga0075429_100066138 | 3300006880 | Bacteria | 3147 |
| 73 | Ga0075429_100098164 | 3300006880 | Bacteria | 2556 |
| 74 | Ga0075429_101293252 | 3300006880 | Bacteria | 636 |
| 75 | Ga0068865_100000679 | 3300006881 | Bacteria | 19202 |
| 76 | Ga0068865_100044132 | 3300006881 | Bacteria | 3050 |
| 77 | Ga0068865_100227718 | 3300006881 | Bacteria | 1461 |
| 78 | Ga0068865_100998671 | 3300006881 | Bacteria | 733 |
| 79 | Ga0068865_101288987 | 3300006881 | Bacteria | 649 |
| 80 | Ga0075436_100008000 | 3300006914 | Bacteria | 7237 |
| 81 | Ga0075436_100120505 | 3300006914 | Bacteria | 1835 |
| 82 | Ga0097620_100156807 | 3300006931 | Bacteria | 2354 |
| 83 | Ga0097620_102110815 | 3300006931 | Unclassified | 622 |
| 84 | Ga0075435_100000002 | 3300007076 | Bacteria | 140391 |
| 85 | Ga0075435_100028104 | 3300007076 | Bacteria | 4408 |
| 86 | Ga0105240_10344214 | 3300009093 | Unclassified | 1693 |
| 87 | Ga0105240_10718288 | 3300009093 | Bacteria | 1089 |
| 88 | Ga0111539_10000860 | 3300009094 | Bacteria | 39623 |
| 89 | Ga0111539_10310676 | 3300009094 | Bacteria | 1835 |
| 90 | Ga0111539_10518154 | 3300009094 | Bacteria | 1389 |
| 91 | Ga0111539_12712706 | 3300009094 | Bacteria | 574 |
| 92 | Ga0105245_10102499 | 3300009098 | Unclassified | 2651 |
| 93 | Ga0105245_10122064 | 3300009098 | Bacteria | 2435 |
| 94 | Ga0105245_10258510 | 3300009098 | Bacteria | 1694 |
| 95 | Ga0105247_10089908 | 3300009101 | Unclassified | 1947 |
| 96 | Ga0105247_11179246 | 3300009101 | Bacteria | 609 |
| 97 | Ga0114129_10000684 | 3300009147 | Bacteria | 42801 |
| 98 | Ga0114129_10002998 | 3300009147 | Bacteria | 23653 |
| 99 | Ga0114129_10011167 | 3300009147 | Bacteria | 12804 |
| 100 | Ga0105243_12141372 | 3300009148 | Unclassified | 595 |
| 101 | Ga0105241_10423653 | 3300009174 | Unclassified | 1172 |
| 102 | Ga0105241_11391667 | 3300009174 | Bacteria | 671 |
| 103 | Ga0105242_10005420 | 3300009176 | Bacteria | 9867 |
| 104 | Ga0105242_10041974 | 3300009176 | Unclassified | 3692 |
| 105 | Ga0105242_10948705 | 3300009176 | Unclassified | 864 |
| 106 | Ga0105248_10011217 | 3300009177 | Bacteria | 9883 |
| 107 | Ga0105248_10011809 | 3300009177 | Bacteria | 9634 |
| 108 | Ga0105248_10430157 | 3300009177 | Bacteria | 1487 |
| 109 | Ga0105248_11448051 | 3300009177 | Bacteria | 777 |
| 110 | Ga0105237_10189781 | 3300009545 | Unclassified | 2055 |
| 111 | Ga0105249_10665896 | 3300009553 | Unclassified | 1099 |
| 112 | Ga0105249_11189541 | 3300009553 | Bacteria | 833 |
| 113 | Ga0105249_12882847 | 3300009553 | Unclassified | 552 |
| 114 | Ga0105249_13190133 | 3300009553 | Unclassified | 527 |
| 115 | Ga0105249_13417213 | 3300009553 | Unclassified | 511 |
| 116 | Ga0105239_11189333 | 3300010375 | Bacteria | 878 |
| 117 | Ga0105239_11294344 | 3300010375 | Bacteria | 841 |
| 118 | Ga0157340_1021313 | 3300012473 | Unclassified | 549 |
| 119 | Ga0157374_10008482 | 3300013296 | Bacteria | 8790 |
| 120 | Ga0157374_11975001 | 3300013296 | Bacteria | 609 |
| 121 | Ga0157378_10431415 | 3300013297 | Bacteria | 1304 |
| 122 | Ga0157378_11619669 | 3300013297 | Bacteria | 693 |
| 123 | Ga0163162_10203069 | 3300013306 | Unclassified | 2111 |
| 124 | Ga0163162_13262540 | 3300013306 | Bacteria | 520 |
| 125 | Ga0157375_10210845 | 3300013308 | Bacteria | 2100 |
| 126 | Ga0163163_10010086 | 3300014325 | Bacteria | 8475 |
| 127 | Ga0163163_10204488 | 3300014325 | Bacteria | 2023 |
| 128 | Ga0163163_11897052 | 3300014325 | Bacteria | 656 |
| 129 | Ga0157380_10529999 | 3300014326 | Bacteria | 1151 |
| 130 | Ga0157380_10531002 | 3300014326 | Bacteria | 1150 |
| 131 | Ga0157377_10252791 | 3300014745 | Bacteria | 1143 |
| 132 | Ga0157379_10015416 | 3300014968 | Bacteria | 6704 |
| 133 | Ga0157379_12492494 | 3300014968 | Unclassified | 517 |
| 134 | Ga0157376_10015600 | 3300014969 | Bacteria | 5744 |
| 135 | Ga0157376_10086333 | 3300014969 | Bacteria | 2705 |
| 136 | Ga0157376_10117216 | 3300014969 | Bacteria | 2354 |
| 137 | Ga0157376_10569416 | 3300014969 | Unclassified | 1123 |
| 138 | Ga0157376_11879730 | 3300014969 | Bacteria | 635 |
| 139 | Ga0163161_10662680 | 3300017792 | Bacteria | 866 |
| 140 | Ga0206352_10511350 | 3300020078 | Unclassified | 546 |
| 141 | Ga0206352_11214068 | 3300020078 | Bacteria | 537 |
| 142 | Ga0224712_10054033 | 3300022467 | Unclassified | 1575 |
| 143 | Ga0207656_10169466 | 3300025321 | Bacteria | 1043 |
| 144 | Ga0207656_10258915 | 3300025321 | Bacteria | 854 |
| 145 | Ga0207656_10267843 | 3300025321 | Unclassified | 840 |
| 146 | Ga0207682_10005717 | 3300025893 | Bacteria | 5043 |
| 147 | Ga0207682_10066839 | 3300025893 | Unclassified | 1516 |
| 148 | Ga0207642_10061024 | 3300025899 | Unclassified | 1751 |
| 149 | Ga0207688_10242787 | 3300025901 | Bacteria | 1089 |
| 150 | Ga0207688_10763110 | 3300025901 | Unclassified | 612 |
| 151 | Ga0207680_10072731 | 3300025903 | Bacteria | 2135 |
| 152 | Ga0207680_10993801 | 3300025903 | Bacteria | 601 |
| 153 | Ga0207699_10501042 | 3300025906 | Bacteria | 876 |
| 154 | Ga0207645_10201687 | 3300025907 | Bacteria | 1309 |
| 155 | Ga0207643_10150571 | 3300025908 | Unclassified | 1395 |
| 156 | Ga0207705_10755179 | 3300025909 | Bacteria | 755 |
| 157 | Ga0207654_10537297 | 3300025911 | Bacteria | 829 |
| 158 | Ga0207707_10023073 | 3300025912 | Bacteria | 5444 |
| 159 | Ga0207707_10232183 | 3300025912 | Unclassified | 1605 |
| 160 | Ga0207695_10546426 | 3300025913 | Bacteria | 1040 |
| 161 | Ga0207662_10345549 | 3300025918 | Bacteria | 998 |
| 162 | Ga0207662_11230627 | 3300025918 | Bacteria | 532 |
| 163 | Ga0207657_10408099 | 3300025919 | Bacteria | 1068 |
| 164 | Ga0207649_10027454 | 3300025920 | Bacteria | 3340 |
| 165 | Ga0207649_10148489 | 3300025920 | Unclassified | 1612 |
| 166 | Ga0207652_10808978 | 3300025921 | Unclassified | 832 |
| 167 | Ga0207652_11031649 | 3300025921 | Unclassified | 722 |
| 168 | Ga0207646_10108507 | 3300025922 | Bacteria | 2490 |
| 169 | Ga0207681_10006280 | 3300025923 | Bacteria | 7296 |
| 170 | Ga0207681_10476188 | 3300025923 | Bacteria | 1019 |
| 171 | Ga0207650_10032996 | 3300025925 | Unclassified | 3747 |
| 172 | Ga0207650_10033989 | 3300025925 | Bacteria | 3696 |
| 173 | Ga0207650_10354397 | 3300025925 | Unclassified | 1208 |
| 174 | Ga0207650_11157163 | 3300025925 | Bacteria | 659 |
| 175 | Ga0207659_10328957 | 3300025926 | Bacteria | 1263 |
| 176 | Ga0207659_10424713 | 3300025926 | Bacteria | 1115 |
| 177 | Ga0207659_10450889 | 3300025926 | Bacteria | 1083 |
| 178 | Ga0207687_10051801 | 3300025927 | Bacteria | 2862 |
| 179 | Ga0207687_10100232 | 3300025927 | Bacteria | 2130 |
| 180 | Ga0207687_10720580 | 3300025927 | Bacteria | 847 |
| 181 | Ga0207644_10065958 | 3300025931 | Bacteria | 2634 |
| 182 | Ga0207644_10811491 | 3300025931 | Bacteria | 783 |
| 183 | Ga0207644_11058043 | 3300025931 | Unclassified | 681 |
| 184 | Ga0207690_11677324 | 3300025932 | Unclassified | 531 |
| 185 | Ga0207706_10235538 | 3300025933 | Bacteria | 1601 |
| 186 | Ga0207706_10251569 | 3300025933 | Bacteria | 1543 |
| 187 | Ga0207706_10661685 | 3300025933 | Unclassified | 894 |
| 188 | Ga0207686_10003510 | 3300025934 | Bacteria | 8421 |
| 189 | Ga0207686_10819869 | 3300025934 | Unclassified | 747 |
| 190 | Ga0207670_11497241 | 3300025936 | Unclassified | 574 |
| 191 | Ga0207669_11369937 | 3300025937 | Bacteria | 602 |
| 192 | Ga0207704_10030279 | 3300025938 | Bacteria | 3033 |
| 193 | Ga0207704_10275194 | 3300025938 | Bacteria | 1277 |
| 194 | Ga0207704_10612038 | 3300025938 | Bacteria | 893 |
| 195 | Ga0207704_10841040 | 3300025938 | Unclassified | 769 |
| 196 | Ga0207704_10883948 | 3300025938 | Bacteria | 751 |
| 197 | Ga0207665_10413415 | 3300025939 | Bacteria | 1029 |
| 198 | Ga0207691_10025721 | 3300025940 | Bacteria | 5524 |
| 199 | Ga0207691_10064751 | 3300025940 | Bacteria | 3311 |
| 200 | Ga0207691_10091157 | 3300025940 | Bacteria | 2731 |
| 201 | Ga0207691_10394630 | 3300025940 | Bacteria | 1180 |
| 202 | Ga0207691_11172539 | 3300025940 | Bacteria | 637 |
| 203 | Ga0207711_10060017 | 3300025941 | Bacteria | 3276 |
| 204 | Ga0207711_10071693 | 3300025941 | Bacteria | 3007 |
| 205 | Ga0207711_10242734 | 3300025941 | Bacteria | 1652 |
| 206 | Ga0207711_10574730 | 3300025941 | Unclassified | 1051 |
| 207 | Ga0207689_11598836 | 3300025942 | Bacteria | 542 |
| 208 | Ga0207661_10026252 | 3300025944 | Bacteria | 4435 |
| 209 | Ga0207679_10012693 | 3300025945 | Bacteria | 5500 |
| 210 | Ga0207679_10223185 | 3300025945 | Bacteria | 1586 |
| 211 | Ga0207667_11958598 | 3300025949 | Bacteria | 547 |
| 212 | Ga0207651_10133564 | 3300025960 | Bacteria | 1904 |
| 213 | Ga0207712_10053179 | 3300025961 | Bacteria | 2840 |
| 214 | Ga0207712_10085636 | 3300025961 | Unclassified | 2307 |
| 215 | Ga0207712_10945704 | 3300025961 | Bacteria | 763 |
| 216 | Ga0207668_10016325 | 3300025972 | Bacteria | 4632 |
| 217 | Ga0207668_10253744 | 3300025972 | Bacteria | 1430 |
| 218 | Ga0207658_10566208 | 3300025986 | Bacteria | 1018 |
| 219 | Ga0207677_10009286 | 3300026023 | Bacteria | 5528 |
| 220 | Ga0207677_10448438 | 3300026023 | Bacteria | 1105 |
| 221 | Ga0207677_11406442 | 3300026023 | Bacteria | 643 |
| 222 | Ga0207703_10001117 | 3300026035 | Bacteria | 25361 |
| 223 | Ga0207703_10360129 | 3300026035 | Bacteria | 1341 |
| 224 | Ga0207703_11892084 | 3300026035 | Unclassified | 573 |
| 225 | Ga0207703_12121159 | 3300026035 | Bacteria | 538 |
| 226 | Ga0207639_10557014 | 3300026041 | Unclassified | 1053 |
| 227 | Ga0207639_12303427 | 3300026041 | Bacteria | 500 |
| 228 | Ga0207678_10045865 | 3300026067 | Bacteria | 3779 |
| 229 | Ga0207678_10134457 | 3300026067 | Bacteria | 2110 |
| 230 | Ga0207678_11385809 | 3300026067 | Unclassified | 622 |
| 231 | Ga0207708_10341528 | 3300026075 | Bacteria | 1226 |
| 232 | Ga0207702_11957865 | 3300026078 | Unclassified | 577 |
| 233 | Ga0207641_10504426 | 3300026088 | Bacteria | 1175 |
| 234 | Ga0207641_10587500 | 3300026088 | Archaea | 1089 |
| 235 | Ga0207641_12070542 | 3300026088 | Bacteria | 570 |
| 236 | Ga0207648_10686068 | 3300026089 | Bacteria | 948 |
| 237 | Ga0207648_11067819 | 3300026089 | Bacteria | 757 |
| 238 | Ga0207648_11224326 | 3300026089 | Unclassified | 705 |
| 239 | Ga0207676_10078092 | 3300026095 | Bacteria | 2680 |
| 240 | Ga0207676_10400287 | 3300026095 | Bacteria | 1283 |
| 241 | Ga0207676_10610819 | 3300026095 | Unclassified | 1048 |
| 242 | Ga0207674_10081672 | 3300026116 | Bacteria | 3234 |
| 243 | Ga0207675_100032892 | 3300026118 | Bacteria | 4832 |
| 244 | Ga0207675_100254452 | 3300026118 | Bacteria | 1700 |
| 245 | Ga0207675_101197910 | 3300026118 | Bacteria | 780 |
| 246 | Ga0207683_10068944 | 3300026121 | Bacteria | 3123 |
| 247 | Ga0207683_10360350 | 3300026121 | Bacteria | 1335 |
| 248 | Ga0207683_11049461 | 3300026121 | Unclassified | 756 |
| 249 | Ga0207698_10249881 | 3300026142 | Bacteria | 1622 |
| 250 | Ga0207698_11314367 | 3300026142 | Bacteria | 738 |
| 251 | Ga0209813_10007409 | 3300027866 | Bacteria | 2733 |
| 252 | Ga0209813_10275482 | 3300027866 | Bacteria | 646 |
| 253 | Ga0207428_10118672 | 3300027907 | Bacteria | 2030 |
| 254 | Ga0268266_10003213 | 3300028379 | Bacteria | 16522 |
| 255 | Ga0268266_10230928 | 3300028379 | Bacteria | 1704 |
| 256 | Ga0268266_11518262 | 3300028379 | Bacteria | 645 |
| 257 | Ga0268265_12301563 | 3300028380 | Bacteria | 546 |
| 258 | Ga0268264_10042164 | 3300028381 | Bacteria | 3777 |
| 259 | Ga0268264_10506339 | 3300028381 | Unclassified | 1178 |
| 260 | Ga0268264_11297783 | 3300028381 | Unclassified | 738 |
| 261 | Ga0307408_100013214 | 3300031548 | Bacteria | 5481 |
| 262 | Ga0307408_100027969 | 3300031548 | Bacteria | 3892 |
| 263 | Ga0307408_100308637 | 3300031548 | Unclassified | 1328 |
| 264 | Ga0307408_101219584 | 3300031548 | Unclassified | 702 |
| 265 | Ga0307405_10030754 | 3300031731 | Bacteria | 3152 |
| 266 | Ga0307405_10305389 | 3300031731 | Bacteria | 1209 |
| 267 | Ga0307405_10897806 | 3300031731 | Unclassified | 749 |
| 268 | Ga0307405_11047729 | 3300031731 | Bacteria | 698 |
| 269 | Ga0307405_11528058 | 3300031731 | Bacteria | 587 |
| 270 | Ga0307413_10167808 | 3300031824 | Unclassified | 1550 |
| 271 | Ga0307413_10172433 | 3300031824 | Unclassified | 1533 |
| 272 | Ga0307413_10317990 | 3300031824 | Bacteria | 1188 |
| 273 | Ga0307413_11005708 | 3300031824 | Unclassified | 715 |
| 274 | Ga0307413_11663244 | 3300031824 | Bacteria | 568 |
| 275 | Ga0307410_10211139 | 3300031852 | Bacteria | 1487 |
| 276 | Ga0307410_10691607 | 3300031852 | Unclassified | 859 |
| 277 | Ga0307406_10072441 | 3300031901 | Bacteria | 2262 |
| 278 | Ga0307406_10123758 | 3300031901 | Bacteria | 1803 |
| 279 | Ga0307406_10497264 | 3300031901 | Bacteria | 988 |
| 280 | Ga0307406_11360657 | 3300031901 | Unclassified | 621 |
| 281 | Ga0307406_11725975 | 3300031901 | Bacteria | 555 |
| 282 | Ga0307407_10273325 | 3300031903 | Bacteria | 1167 |
| 283 | Ga0307407_10714177 | 3300031903 | Unclassified | 756 |
| 284 | Ga0307412_10149115 | 3300031911 | Bacteria | 1723 |
| 285 | Ga0307412_10318866 | 3300031911 | Bacteria | 1236 |
| 286 | Ga0307412_10550836 | 3300031911 | Unclassified | 969 |
| 287 | Ga0307412_11005105 | 3300031911 | Unclassified | 737 |
| 288 | Ga0307412_11327237 | 3300031911 | Unclassified | 648 |
| 289 | Ga0307409_100140202 | 3300031995 | Bacteria | 2082 |
| 290 | Ga0307409_100283230 | 3300031995 | Bacteria | 1533 |
| 291 | Ga0307409_100598528 | 3300031995 | Bacteria | 1089 |
| 292 | Ga0307409_101612175 | 3300031995 | Bacteria | 677 |
| 293 | Ga0307416_100009722 | 3300032002 | Bacteria | 6316 |
| 294 | Ga0307416_100024525 | 3300032002 | Bacteria | 4405 |
| 295 | Ga0307416_100073020 | 3300032002 | Bacteria | 2858 |
| 296 | Ga0307416_100291304 | 3300032002 | Bacteria | 1616 |
| 297 | Ga0307416_100383573 | 3300032002 | Bacteria | 1436 |
| 298 | Ga0307416_100647719 | 3300032002 | Bacteria | 1141 |
| 299 | Ga0307416_100740196 | 3300032002 | Bacteria | 1075 |
| 300 | Ga0307416_102349967 | 3300032002 | Unclassified | 633 |
| 301 | Ga0307416_103055091 | 3300032002 | Bacteria | 560 |
| 302 | Ga0307416_103193803 | 3300032002 | Unclassified | 548 |
| 303 | Ga0307416_103460099 | 3300032002 | Unclassified | 528 |
| 304 | Ga0307414_10131557 | 3300032004 | Bacteria | 1943 |
| 305 | Ga0307414_11079414 | 3300032004 | Unclassified | 741 |
| 306 | Ga0307414_11365896 | 3300032004 | Unclassified | 658 |
| 307 | Ga0307411_10215514 | 3300032005 | Bacteria | 1486 |
| 308 | Ga0307411_10246394 | 3300032005 | Bacteria | 1402 |
| 309 | Ga0307411_10447734 | 3300032005 | Bacteria | 1079 |
| 310 | Ga0307411_10879013 | 3300032005 | Bacteria | 795 |
| 311 | Ga0307411_11707954 | 3300032005 | Unclassified | 583 |
| 312 | Ga0307415_100296418 | 3300032126 | Bacteria | 1337 |
| 313 | Ga0307415_102360928 | 3300032126 | Unclassified | 522 |
| 314 | Ga0373925_0893804 | 3300037068 | Bacteria | 732 |
| 315 | Ga0451802_0205088 | 3300041460 | Unclassified | 773 |
| 316 | Ga0451804_0048032 | 3300041463 | Unclassified | 594 |
| 317 | Ga0451807_0280300 | 3300041486 | Bacteria | 957 |
| 318 | Ga0451807_1555407 | 3300041486 | Bacteria | 694 |
| 319 | Ga0451837_1789254 | 3300041494 | Bacteria | 667 |
| 320 | Ga0451849_0174567 | 3300041505 | Unclassified | 970 |
| 321 | Ga0451853_0946804 | 3300041512 | Unclassified | 998 |
| 322 | Ga0439433_0153606 | 3300041999 | Bacteria | 593 |
| 323 | Ga0439445_0191815 | 3300042004 | Unclassified | 602 |
| 324 | Ga0439445_0197150 | 3300042004 | Unclassified | 594 |
| 325 | Ga0439449_0129958 | 3300042007 | Bacteria | 936 |
| 326 | Ga0439449_0253783 | 3300042007 | Unclassified | 661 |
| 327 | Ga0450920_046620 | 3300042122 | Bacteria | 866 |
| 328 | Ga0450923_030572 | 3300042125 | Bacteria | 1096 |
| 329 | Ga0450896_028914 | 3300042133 | Bacteria | 833 |
| 330 | Ga0439446_0006105 | 3300042156 | Bacteria | 3128 |
| 331 | Ga0450908_001910 | 3300042184 | Bacteria | 4074 |
| 332 | Ga0439435_0053004 | 3300042436 | Unclassified | 1165 |
| 333 | Ga0450918_087500 | 3300042531 | Unclassified | 599 |
| 334 | Ga0451577_0039937 | 3300042876 | Bacteria | 4214 |
| 335 | Ga0451577_0052742 | 3300042876 | Bacteria | 3631 |
| 336 | Ga0451577_0405672 | 3300042876 | Bacteria | 1237 |
| 337 | Ga0453684_0076525 | 3300044712 | Bacteria | 4201 |
| 338 | Ga0453684_0261550 | 3300044712 | Bacteria | 1982 |
| 339 | Ga0453684_0444621 | 3300044712 | Bacteria | 1444 |
| 340 | Ga0466958_0545368 | 3300045836 | Unclassified | 753 |
| 341 | Ga0495598_0161911 | 3300046537 | Unclassified | 788 |
| 342 | Ga0495658_0524479 | 3300046683 | Unclassified | 758 |
| 343 | Ga0496101_0428957 | 3300048904 | Bacteria | 1042 |
| 344 | Ga0496104_0003297 | 3300048907 | Bacteria | 13929 |
| 345 | Ga0496105_0420461 | 3300048908 | Bacteria | 1058 |
| 346 | Ga0496105_1302175 | 3300048908 | Bacteria | 530 |
| 347 | Ga0496106_0263651 | 3300048909 | Bacteria | 1379 |
| 348 | Ga0496106_0753649 | 3300048909 | Bacteria | 774 |
| 349 | Ga0496107_0356805 | 3300048910 | Bacteria | 1088 |
| 350 | Ga0496108_0014592 | 3300048911 | Bacteria | 6413 |
| 351 | Ga0496109_0014602 | 3300048912 | Bacteria | 6833 |
| 352 | Ga0496110_0014202 | 3300048913 | Bacteria | 6607 |
| 353 | Ga0496110_1405013 | 3300048913 | Unclassified | 607 |
| 354 | Ga0496111_0138220 | 3300048914 | Bacteria | 1805 |
| 355 | Ga0496112_0024482 | 3300048915 | Bacteria | 5781 |
| 356 | Ga0496114_0085681 | 3300048917 | Bacteria | 2669 |
| 357 | Ga0496114_0760360 | 3300048917 | Archaea | 847 |
| 358 | Ga0496115_0165716 | 3300048918 | Unclassified | 1828 |
| 359 | Ga0501291_149425 | 3300049514 | Unclassified | 527 |
| 360 | Ga0501300_084789 | 3300049523 | Bacteria | 525 |
| 361 | Ga0501031_0118441 | 3300049568 | Bacteria | 1730 |
| 362 | Ga0501031_0283801 | 3300049568 | Bacteria | 1074 |
| 363 | Ga0501031_0647549 | 3300049568 | Unclassified | 679 |
| 364 | Ga0501036_0066768 | 3300049572 | Bacteria | 3044 |
| 365 | Ga0501036_0293512 | 3300049572 | Bacteria | 1360 |
| 366 | Ga0501036_0329285 | 3300049572 | Bacteria | 1276 |
| 367 | Ga0501037_0183316 | 3300049573 | Unclassified | 1485 |
| 368 | Ga0501037_0579480 | 3300049573 | Bacteria | 755 |
| 369 | Ga0501039_0216911 | 3300049575 | Bacteria | 1504 |
| 370 | Ga0501039_0471121 | 3300049575 | Bacteria | 986 |
| 371 | Ga0501039_0797823 | 3300049575 | Bacteria | 737 |
| 372 | Ga0501040_0024917 | 3300049576 | Bacteria | 4020 |
| 373 | Ga0501040_0060175 | 3300049576 | Unclassified | 2610 |
| 374 | Ga0501040_0198378 | 3300049576 | Bacteria | 1425 |
| 375 | Ga0501040_0295699 | 3300049576 | Unclassified | 1157 |
| 376 | Ga0501041_0026587 | 3300049577 | Bacteria | 3482 |
| 377 | Ga0501041_0042074 | 3300049577 | Bacteria | 2775 |
| 378 | Ga0501041_0546645 | 3300049577 | Bacteria | 738 |
| 379 | Ga0501041_0694033 | 3300049577 | Bacteria | 651 |
| 380 | Ga0501042_0050065 | 3300049578 | Bacteria | 2980 |
| 381 | Ga0501042_0061110 | 3300049578 | Unclassified | 2692 |
| 382 | Ga0501042_0075315 | 3300049578 | Unclassified | 2415 |
| 383 | Ga0501042_0179866 | 3300049578 | Bacteria | 1526 |
| 384 | Ga0501042_0886076 | 3300049578 | Bacteria | 650 |
| 385 | Ga0501046_0138905 | 3300049580 | Unclassified | 1840 |
| 386 | Ga0501048_0044900 | 3300049582 | Bacteria | 3157 |
| 387 | Ga0501048_0094998 | 3300049582 | Unclassified | 2103 |
| 388 | Ga0501048_0400016 | 3300049582 | Bacteria | 982 |
| 389 | Ga0501069_0250541 | 3300049585 | Unclassified | 1033 |
| 390 | Ga0501069_0925292 | 3300049585 | Unclassified | 531 |
| 391 | Ga0501071_0007028 | 3300049587 | Bacteria | 7353 |
| 392 | Ga0501071_0015190 | 3300049587 | Bacteria | 5281 |
| 393 | Ga0501071_0110118 | 3300049587 | Bacteria | 2035 |
| 394 | Ga0501071_0160521 | 3300049587 | Unclassified | 1680 |
| 395 | Ga0501071_0514333 | 3300049587 | Unclassified | 918 |
| 396 | Ga0501071_0723925 | 3300049587 | Bacteria | 766 |
| 397 | Ga0501072_0117533 | 3300049588 | Bacteria | 2118 |
| 398 | Ga0501072_0120049 | 3300049588 | Unclassified | 2094 |
| 399 | Ga0501073_0959862 | 3300049589 | Bacteria | 588 |
| 400 | Ga0501074_0359005 | 3300049590 | Bacteria | 1034 |
| 401 | Ga0501075_0039986 | 3300049591 | Bacteria | 3511 |
| 402 | Ga0501075_0275092 | 3300049591 | Bacteria | 1283 |
| 403 | Ga0501075_0503212 | 3300049591 | Unclassified | 924 |
| 404 | Ga0501075_0707090 | 3300049591 | Unclassified | 768 |
| 405 | Ga0501075_0914321 | 3300049591 | Bacteria | 667 |
| 406 | Ga0501075_1424374 | 3300049591 | Unclassified | 525 |
| 407 | Ga0501076_0030654 | 3300049592 | Bacteria | 4190 |
| 408 | Ga0501076_0041859 | 3300049592 | Bacteria | 3606 |
| 409 | Ga0501076_0065861 | 3300049592 | Bacteria | 2890 |
| 410 | Ga0501076_0936950 | 3300049592 | Bacteria | 714 |
| 411 | Ga0501076_1783777 | 3300049592 | Unclassified | 504 |
| 412 | Ga0501077_0708849 | 3300049593 | Unclassified | 647 |
| 413 | Ga0501077_1109652 | 3300049593 | Unclassified | 509 |
| 414 | Ga0501077_1117431 | 3300049593 | Bacteria | 507 |
| 415 | Ga0501257_271411 | 3300049686 | Unclassified | 508 |
| 416 | Ga0501225_0257382 | 3300049705 | Unclassified | 576 |
| 417 | Ga0501079_0059999 | 3300049741 | Unclassified | 2934 |
| 418 | Ga0501079_0154399 | 3300049741 | Bacteria | 1789 |
| 419 | Ga0501080_0213355 | 3300049742 | Bacteria | 1768 |
| 420 | Ga0501080_0886294 | 3300049742 | Unclassified | 778 |
| 421 | Ga0501081_0328925 | 3300049743 | Unclassified | 1124 |
| 422 | Ga0501083_0441652 | 3300049744 | Unclassified | 847 |
| 423 | Ga0501035_0878797 | 3300049822 | Unclassified | 711 |
| 424 | Ga0501045_0144576 | 3300049824 | Bacteria | 1769 |
| 425 | Ga0501045_0145567 | 3300049824 | Unclassified | 1762 |
| 426 | Ga0501045_0147501 | 3300049824 | Bacteria | 1750 |
| 427 | Ga0501045_0591632 | 3300049824 | Unclassified | 822 |
| 428 | Ga0501045_1203555 | 3300049824 | Bacteria | 553 |
| 429 | Ga0501212_083452 | 3300049851 | Unclassified | 581 |
| 430 | nmdc:mga03683_444090_c1 | 3300050489 | Bacteria | 623 |
| 431 | nmdc:mga03n38_442569_c1 | 3300050490 | Bacteria | 722 |
| 432 | nmdc:mga00v17_366946_c1 | 3300050491 | Bacteria | 936 |
| 433 | nmdc:mga00v17_469839_c1 | 3300050491 | Unclassified | 816 |
| 434 | nmdc:mga0yw44_796033_c1 | 3300050492 | Unclassified | 642 |
| 435 | nmdc:mga0yw44_858971_c1 | 3300050492 | Bacteria | 616 |
| 436 | nmdc:mga0k408_170202_c1 | 3300050493 | Bacteria | 1298 |
| 437 | nmdc:mga0k408_17218_c1 | 3300050493 | Bacteria | 4023 |
| 438 | nmdc:mga0k408_594071_c1 | 3300050493 | Bacteria | 653 |
| 439 | nmdc:mga0k408_8093_c1 | 3300050493 | Bacteria | 3103 |
| 440 | nmdc:mga06z11_105936_c1 | 3300050494 | Unclassified | 1550 |
| 441 | nmdc:mga06z11_211157_c1 | 3300050494 | Bacteria | 1131 |
| 442 | nmdc:mga06z11_322484_c1 | 3300050494 | Bacteria | 922 |
| 443 | nmdc:mga06z11_684648_c1 | 3300050494 | Bacteria | 625 |
| 444 | nmdc:mga04h51_204659_c1 | 3300050495 | Bacteria | 777 |
| 445 | nmdc:mga04h51_6639_c1 | 3300050495 | Bacteria | 3012 |
| 446 | nmdc:mga07m45_27428_c2 | 3300050496 | Bacteria | 1649 |
| 447 | nmdc:mga05p37_23490_c1 | 3300050507 | Bacteria | 7481 |
| 448 | nmdc:mga09592_68656_c1 | 3300050508 | Bacteria | 3006 |
| 449 | nmdc:mga09592_93718_c1 | 3300050508 | Bacteria | 2568 |
| 450 | nmdc:mga0qj67_1177722_c1 | 3300050509 | Unclassified | 597 |
| 451 | nmdc:mga0qj67_1600456_c1 | 3300050509 | Bacteria | 500 |
| 452 | nmdc:mga06r32_1120864_c1 | 3300050510 | Bacteria | 735 |
| 453 | nmdc:mga06r32_375266_c1 | 3300050510 | Unclassified | 1405 |
| 454 | nmdc:mga06r32_8785_c1 | 3300050510 | Bacteria | 9105 |
| 455 | nmdc:mga08y16_1316_c1 | 3300050511 | Bacteria | 24685 |
| 456 | nmdc:mga08y16_240261_c1 | 3300050511 | Bacteria | 1872 |
| 457 | nmdc:mga08y16_82861_c1 | 3300050511 | Bacteria | 3343 |
| 458 | nmdc:mga0n895_123_c1 | 3300050512 | Bacteria | 46084 |
| 459 | nmdc:mga0n895_158720_c1 | 3300050512 | Unclassified | 2293 |
| 460 | nmdc:mga0n895_1766861_c1 | 3300050512 | Unclassified | 580 |
| 461 | nmdc:mga0n895_283863_c1 | 3300050512 | Unclassified | 1679 |
| 462 | nmdc:mga0n895_600911_c1 | 3300050512 | Bacteria | 1102 |
| 463 | nmdc:mga0rr50_27_c1 | 3300050513 | Bacteria | 109881 |
| 464 | nmdc:mga08x19_337_c1 | 3300050514 | Bacteria | 33875 |
| 465 | nmdc:mga08x19_488500_c1 | 3300050514 | Unclassified | 869 |
| 466 | nmdc:mga08x19_71654_c1 | 3300050514 | Bacteria | 2260 |
| 467 | nmdc:mga0sz30_324056_c1 | 3300050516 | Bacteria | 688 |
| 468 | Ga0501084_0060545 | 3300054114 | Bacteria | 3170 |
| 469 | Ga0501084_0124121 | 3300054114 | Unclassified | 2172 |
| 470 | Ga0590071_069336 | 3300059421 | Bacteria | 868 |
| 471 | Ga0590071_131816 | 3300059421 | Unclassified | 642 |
| 472 | Ga0590071_143988 | 3300059421 | Unclassified | 616 |
| 473 | Ga0590075_080469 | 3300059424 | Bacteria | 844 |
| 474 | Ga0590075_097085 | 3300059424 | Unclassified | 766 |
| 475 | Ga0587066_213315 | 3300059490 | Unclassified | 514 |
| 476 | Ga0587070_029518 | 3300059491 | Unclassified | 985 |
| 477 | Ga0587073_0192673 | 3300059492 | Unclassified | 606 |
| 478 | Ga0587073_0338655 | 3300059492 | Bacteria | 501 |
| 479 | Ga0587083_0257401 | 3300059505 | Unclassified | 522 |
| 480 | Ga0587091_046442 | 3300059511 | Unclassified | 876 |
| 481 | Ga0587072_070687 | 3300059643 | Unclassified | 737 |
| 482 | Ga0501082_0140375 | 3300060353 | Bacteria | 2097 |
| 483 | Ga0501082_0188947 | 3300060353 | Bacteria | 1792 |
| 484 | Ga0501082_0317396 | 3300060353 | Unclassified | 1357 |
| 485 | Ga0501082_1056075 | 3300060353 | Unclassified | 710 |
| 486 | Ga0530510_0975406 | 3300061734 | Unclassified | 648 |
| 487 | Ga0530510_1046735 | 3300061734 | Unclassified | 625 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300006194 | Ga0075427_10068428 | Ga0075427_100684282 | 34 |
| 2 | 3300006844 | Ga0075428_100000748 | Ga0075428_10000074812 | 34 |
| 3 | 3300006846 | Ga0075430_100007553 | Ga0075430_1000075536 | 34 |
| 4 | 3300006847 | Ga0075431_100001504 | Ga0075431_10000150418 | 34 |
| 5 | 3300006852 | Ga0075433_10013833 | Ga0075433_100138336 | 34 |
| 6 | 3300006871 | Ga0075434_101367139 | Ga0075434_1013671392 | 34 |
| 7 | 3300006880 | Ga0075429_100000781 | Ga0075429_10000078114 | 34 |
| 8 | 3300006880 | Ga0075429_101293252 | Ga0075429_1012932522 | 34 |
| 9 | 3300009094 | Ga0111539_10000860 | Ga0111539_1000086018 | 34 |
| 10 | 3300009147 | Ga0114129_10000684 | Ga0114129_1000068419 | 34 |
| 11 | 3300009147 | Ga0114129_10011167 | Ga0114129_100111676 | 34 |
| 12 | 3300031911 | Ga0307412_11327237 | Ga0307412_113272371 | 35 |
| 13 | 3300032002 | Ga0307416_103193803 | Ga0307416_1031938031 | 35 |
| 14 | 3300005543 | Ga0070672_100099207 | Ga0070672_1000992072 | 36 |
| 15 | 3300005563 | Ga0068855_102330338 | Ga0068855_1023303382 | 36 |
| 16 | 3300005564 | Ga0070664_100005497 | Ga0070664_1000054974 | 36 |
| 17 | 3300005577 | Ga0068857_100066778 | Ga0068857_1000667782 | 36 |
| 18 | 3300005578 | Ga0068854_101097868 | Ga0068854_1010978682 | 36 |
| 19 | 3300005842 | Ga0068858_102315335 | Ga0068858_1023153352 | 36 |
| 20 | 3300006163 | Ga0070715_10551032 | Ga0070715_105510321 | 36 |
| 21 | 3300006173 | Ga0070716_101064973 | Ga0070716_1010649731 | 36 |
| 22 | 3300006844 | Ga0075428_100006301 | Ga0075428_1000063011 | 36 |
| 23 | 3300006847 | Ga0075431_100022748 | Ga0075431_1000227482 | 36 |
| 24 | 3300006871 | Ga0075434_100045401 | Ga0075434_1000454012 | 36 |
| 25 | 3300006871 | Ga0075434_101787837 | Ga0075434_1017878371 | 36 |
| 26 | 3300006880 | Ga0075429_100066138 | Ga0075429_1000661382 | 36 |
| 27 | 3300006880 | Ga0075429_100098164 | Ga0075429_1000981642 | 36 |
| 28 | 3300006881 | Ga0068865_100998671 | Ga0068865_1009986712 | 36 |
| 29 | 3300006914 | Ga0075436_100008000 | Ga0075436_1000080002 | 36 |
| 30 | 3300006914 | Ga0075436_100120505 | Ga0075436_1001205052 | 36 |
| 31 | 3300007076 | Ga0075435_100000002 | Ga0075435_100000002124 | 36 |
| 32 | 3300007076 | Ga0075435_100028104 | Ga0075435_1000281045 | 36 |
| 33 | 3300009093 | Ga0105240_10718288 | Ga0105240_107182882 | 36 |
| 34 | 3300009094 | Ga0111539_10518154 | Ga0111539_105181542 | 36 |
| 35 | 3300009094 | Ga0111539_12712706 | Ga0111539_127127061 | 36 |
| 36 | 3300009098 | Ga0105245_10258510 | Ga0105245_102585102 | 36 |
| 37 | 3300009147 | Ga0114129_10002998 | Ga0114129_1000299810 | 36 |
| 38 | 3300009174 | Ga0105241_10423653 | Ga0105241_104236532 | 36 |
| 39 | 3300009177 | Ga0105248_10011217 | Ga0105248_100112175 | 36 |
| 40 | 3300009177 | Ga0105248_10430157 | Ga0105248_104301572 | 36 |
| 41 | 3300009553 | Ga0105249_10665896 | Ga0105249_106658962 | 36 |
| 42 | 3300009553 | Ga0105249_12882847 | Ga0105249_128828472 | 36 |
| 43 | 3300009553 | Ga0105249_13417213 | Ga0105249_134172132 | 36 |
| 44 | 3300010375 | Ga0105239_11189333 | Ga0105239_111893332 | 36 |
| 45 | 3300010375 | Ga0105239_11294344 | Ga0105239_112943442 | 36 |
| 46 | 3300013297 | Ga0157378_10431415 | Ga0157378_104314152 | 36 |
| 47 | 3300013306 | Ga0163162_13262540 | Ga0163162_132625402 | 36 |
| 48 | 3300014325 | Ga0163163_10010086 | Ga0163163_100100865 | 36 |
| 49 | 3300014326 | Ga0157380_10529999 | Ga0157380_105299992 | 36 |
| 50 | 3300014968 | Ga0157379_12492494 | Ga0157379_124924942 | 36 |
| 51 | 3300014969 | Ga0157376_10569416 | Ga0157376_105694162 | 36 |
| 52 | 3300020078 | Ga0206352_10511350 | Ga0206352_105113502 | 36 |
| 53 | 3300020078 | Ga0206352_11214068 | Ga0206352_112140682 | 36 |
| 54 | 3300025906 | Ga0207699_10501042 | Ga0207699_105010422 | 36 |
| 55 | 3300025913 | Ga0207695_10546426 | Ga0207695_105464262 | 36 |
| 56 | 3300025918 | Ga0207662_10345549 | Ga0207662_103455492 | 36 |
| 57 | 3300025919 | Ga0207657_10408099 | Ga0207657_104080992 | 36 |
| 58 | 3300025920 | Ga0207649_10027454 | Ga0207649_100274542 | 36 |
| 59 | 3300025921 | Ga0207652_10808978 | Ga0207652_108089781 | 36 |
| 60 | 3300025922 | Ga0207646_10108507 | Ga0207646_101085072 | 36 |
| 61 | 3300025923 | Ga0207681_10006280 | Ga0207681_100062803 | 36 |
| 62 | 3300025925 | Ga0207650_10032996 | Ga0207650_100329962 | 36 |
| 63 | 3300025925 | Ga0207650_10354397 | Ga0207650_103543972 | 36 |
| 64 | 3300025927 | Ga0207687_10720580 | Ga0207687_107205802 | 36 |
| 65 | 3300025931 | Ga0207644_10065958 | Ga0207644_100659582 | 36 |
| 66 | 3300025933 | Ga0207706_10235538 | Ga0207706_102355382 | 36 |
| 67 | 3300025933 | Ga0207706_10251569 | Ga0207706_102515692 | 36 |
| 68 | 3300025938 | Ga0207704_10883948 | Ga0207704_108839482 | 36 |
| 69 | 3300025939 | Ga0207665_10413415 | Ga0207665_104134152 | 36 |
| 70 | 3300025940 | Ga0207691_10064751 | Ga0207691_100647512 | 36 |
| 71 | 3300025940 | Ga0207691_10394630 | Ga0207691_103946302 | 36 |
| 72 | 3300025941 | Ga0207711_10071693 | Ga0207711_100716932 | 36 |
| 73 | 3300025941 | Ga0207711_10242734 | Ga0207711_102427342 | 36 |
| 74 | 3300025944 | Ga0207661_10026252 | Ga0207661_100262523 | 36 |
| 75 | 3300025945 | Ga0207679_10012693 | Ga0207679_100126933 | 36 |
| 76 | 3300025949 | Ga0207667_11958598 | Ga0207667_119585982 | 36 |
| 77 | 3300025961 | Ga0207712_10053179 | Ga0207712_100531794 | 36 |
| 78 | 3300025961 | Ga0207712_10085636 | Ga0207712_100856362 | 36 |
| 79 | 3300026035 | Ga0207703_11892084 | Ga0207703_118920842 | 36 |
| 80 | 3300026041 | Ga0207639_12303427 | Ga0207639_123034272 | 36 |
| 81 | 3300026067 | Ga0207678_11385809 | Ga0207678_113858092 | 36 |
| 82 | 3300026075 | Ga0207708_10341528 | Ga0207708_103415281 | 36 |
| 83 | 3300026089 | Ga0207648_11224326 | Ga0207648_112243262 | 36 |
| 84 | 3300026095 | Ga0207676_10400287 | Ga0207676_104002872 | 36 |
| 85 | 3300026116 | Ga0207674_10081672 | Ga0207674_100816722 | 36 |
| 86 | 3300026118 | Ga0207675_100032892 | Ga0207675_1000328923 | 36 |
| 87 | 3300026121 | Ga0207683_11049461 | Ga0207683_110494612 | 36 |
| 88 | 3300026142 | Ga0207698_11314367 | Ga0207698_113143672 | 36 |
| 89 | 3300027907 | Ga0207428_10118672 | Ga0207428_101186722 | 36 |
| 90 | 3300028381 | Ga0268264_11297783 | Ga0268264_112977832 | 36 |
| 91 | 3300031548 | Ga0307408_100308637 | Ga0307408_1003086372 | 36 |
| 92 | 3300031548 | Ga0307408_101219584 | Ga0307408_1012195842 | 36 |
| 93 | 3300031731 | Ga0307405_10897806 | Ga0307405_108978062 | 36 |
| 94 | 3300031731 | Ga0307405_11528058 | Ga0307405_115280582 | 36 |
| 95 | 3300031824 | Ga0307413_10172433 | Ga0307413_101724332 | 36 |
| 96 | 3300031824 | Ga0307413_10317990 | Ga0307413_103179902 | 36 |
| 97 | 3300031824 | Ga0307413_11005708 | Ga0307413_110057082 | 36 |
| 98 | 3300031852 | Ga0307410_10211139 | Ga0307410_102111392 | 36 |
| 99 | 3300031901 | Ga0307406_10072441 | Ga0307406_100724412 | 36 |
| 100 | 3300031901 | Ga0307406_10497264 | Ga0307406_104972642 | 36 |
| 101 | 3300031901 | Ga0307406_11360657 | Ga0307406_113606572 | 36 |
| 102 | 3300031903 | Ga0307407_10273325 | Ga0307407_102733252 | 36 |
| 103 | 3300031903 | Ga0307407_10714177 | Ga0307407_107141772 | 36 |
| 104 | 3300031911 | Ga0307412_10149115 | Ga0307412_101491152 | 36 |
| 105 | 3300031911 | Ga0307412_11005105 | Ga0307412_110051052 | 36 |
| 106 | 3300031995 | Ga0307409_100283230 | Ga0307409_1002832302 | 36 |
| 107 | 3300031995 | Ga0307409_100598528 | Ga0307409_1005985282 | 36 |
| 108 | 3300032002 | Ga0307416_100073020 | Ga0307416_1000730203 | 36 |
| 109 | 3300032002 | Ga0307416_100291304 | Ga0307416_1002913042 | 36 |
| 110 | 3300032002 | Ga0307416_100740196 | Ga0307416_1007401962 | 36 |
| 111 | 3300032002 | Ga0307416_103460099 | Ga0307416_1034600992 | 36 |
| 112 | 3300032004 | Ga0307414_10131557 | Ga0307414_101315572 | 36 |
| 113 | 3300032004 | Ga0307414_11079414 | Ga0307414_110794142 | 36 |
| 114 | 3300032004 | Ga0307414_11365896 | Ga0307414_113658962 | 36 |
| 115 | 3300032005 | Ga0307411_10447734 | Ga0307411_104477342 | 36 |
| 116 | 3300032126 | Ga0307415_100296418 | Ga0307415_1002964182 | 36 |
| 117 | 3300037068 | Ga0373925_0893804 | Ga0373925_0893804_609_719 | 36 |
| 118 | 3300041460 | Ga0451802_0205088 | Ga0451802_0205088_535_645 | 36 |
| 119 | 3300041463 | Ga0451804_0048032 | Ga0451804_0048032_262_372 | 36 |
| 120 | 3300041486 | Ga0451807_1555407 | Ga0451807_1555407_341_451 | 36 |
| 121 | 3300041505 | Ga0451849_0174567 | Ga0451849_0174567_380_490 | 36 |
| 122 | 3300041512 | Ga0451853_0946804 | Ga0451853_0946804_220_330 | 36 |
| 123 | 3300041999 | Ga0439433_0153606 | Ga0439433_0153606_439_549 | 36 |
| 124 | 3300042004 | Ga0439445_0191815 | Ga0439445_0191815_104_214 | 36 |
| 125 | 3300042007 | Ga0439449_0129958 | Ga0439449_0129958_398_508 | 36 |
| 126 | 3300042007 | Ga0439449_0253783 | Ga0439449_0253783_183_293 | 36 |
| 127 | 3300042156 | Ga0439446_0006105 | Ga0439446_0006105_2687_2797 | 36 |
| 128 | 3300042876 | Ga0451577_0039937 | Ga0451577_0039937_210_320 | 36 |
| 129 | 3300044712 | Ga0453684_0076525 | Ga0453684_0076525_419_529 | 36 |
| 130 | 3300045836 | Ga0466958_0545368 | Ga0466958_0545368_20_130 | 36 |
| 131 | 3300046537 | Ga0495598_0161911 | Ga0495598_0161911_496_606 | 36 |
| 132 | 3300046683 | Ga0495658_0524479 | Ga0495658_0524479_17_127 | 36 |
| 133 | 3300048904 | Ga0496101_0428957 | Ga0496101_0428957_154_264 | 36 |
| 134 | 3300048907 | Ga0496104_0003297 | Ga0496104_0003297_8756_8866 | 36 |
| 135 | 3300048908 | Ga0496105_1302175 | Ga0496105_1302175_263_373 | 36 |
| 136 | 3300048909 | Ga0496106_0263651 | Ga0496106_0263651_488_598 | 36 |
| 137 | 3300048910 | Ga0496107_0356805 | Ga0496107_0356805_909_1019 | 36 |
| 138 | 3300048911 | Ga0496108_0014592 | Ga0496108_0014592_4700_4810 | 36 |
| 139 | 3300048912 | Ga0496109_0014602 | Ga0496109_0014602_2853_2963 | 36 |
| 140 | 3300048913 | Ga0496110_0014202 | Ga0496110_0014202_2330_2440 | 36 |
| 141 | 3300048914 | Ga0496111_0138220 | Ga0496111_0138220_908_1018 | 36 |
| 142 | 3300048915 | Ga0496112_0024482 | Ga0496112_0024482_3256_3366 | 36 |
| 143 | 3300049514 | Ga0501291_149425 | Ga0501291_149425_189_299 | 36 |
| 144 | 3300049523 | Ga0501300_084789 | Ga0501300_084789_26_136 | 36 |
| 145 | 3300049568 | Ga0501031_0283801 | Ga0501031_0283801_680_790 | 36 |
| 146 | 3300049572 | Ga0501036_0293512 | Ga0501036_0293512_38_148 | 36 |
| 147 | 3300049575 | Ga0501039_0797823 | Ga0501039_0797823_300_410 | 36 |
| 148 | 3300049576 | Ga0501040_0198378 | Ga0501040_0198378_1124_1234 | 36 |
| 149 | 3300049576 | Ga0501040_0295699 | Ga0501040_0295699_261_371 | 36 |
| 150 | 3300049577 | Ga0501041_0546645 | Ga0501041_0546645_437_547 | 36 |
| 151 | 3300049578 | Ga0501042_0179866 | Ga0501042_0179866_457_567 | 36 |
| 152 | 3300049582 | Ga0501048_0400016 | Ga0501048_0400016_69_179 | 36 |
| 153 | 3300049587 | Ga0501071_0514333 | Ga0501071_0514333_291_401 | 36 |
| 154 | 3300049591 | Ga0501075_0914321 | Ga0501075_0914321_96_206 | 36 |
| 155 | 3300049592 | Ga0501076_0936950 | Ga0501076_0936950_451_561 | 36 |
| 156 | 3300049686 | Ga0501257_271411 | Ga0501257_271411_178_288 | 36 |
| 157 | 3300049705 | Ga0501225_0257382 | Ga0501225_0257382_406_516 | 36 |
| 158 | 3300049824 | Ga0501045_1203555 | Ga0501045_1203555_80_190 | 36 |
| 159 | 3300050507 | nmdc:mga05p37_23490_c1 | nmdc:mga05p37_23490_c1_76_186 | 36 |
| 160 | 3300050508 | nmdc:mga09592_68656_c1 | nmdc:mga09592_68656_c1_1139_1249 | 36 |
| 161 | 3300050508 | nmdc:mga09592_93718_c1 | nmdc:mga09592_93718_c1_1614_1724 | 36 |
| 162 | 3300050510 | nmdc:mga06r32_8785_c1 | nmdc:mga06r32_8785_c1_5587_5697 | 36 |
| 163 | 3300050511 | nmdc:mga08y16_1316_c1 | nmdc:mga08y16_1316_c1_6690_6800 | 36 |
| 164 | 3300050511 | nmdc:mga08y16_82861_c1 | nmdc:mga08y16_82861_c1_3203_3313 | 36 |
| 165 | 3300050512 | nmdc:mga0n895_123_c1 | nmdc:mga0n895_123_c1_32394_32504 | 36 |
| 166 | 3300050512 | nmdc:mga0n895_158720_c1 | nmdc:mga0n895_158720_c1_2056_2166 | 36 |
| 167 | 3300050512 | nmdc:mga0n895_283863_c1 | nmdc:mga0n895_283863_c1_49_159 | 36 |
| 168 | 3300050513 | nmdc:mga0rr50_27_c1 | nmdc:mga0rr50_27_c1_66852_66962 | 36 |
| 169 | 3300050514 | nmdc:mga08x19_337_c1 | nmdc:mga08x19_337_c1_17802_17912 | 36 |
| 170 | 3300050514 | nmdc:mga08x19_488500_c1 | nmdc:mga08x19_488500_c1_116_226 | 36 |
| 171 | 3300050514 | nmdc:mga08x19_71654_c1 | nmdc:mga08x19_71654_c1_1319_1429 | 36 |
| 172 | 3300059421 | Ga0590071_069336 | Ga0590071_069336_439_549 | 36 |
| 173 | 3300059421 | Ga0590071_131816 | Ga0590071_131816_131_241 | 36 |
| 174 | 3300059421 | Ga0590071_143988 | Ga0590071_143988_27_140 | 36 |
| 175 | 3300059490 | Ga0587066_213315 | Ga0587066_213315_265_375 | 36 |
| 176 | 3300059491 | Ga0587070_029518 | Ga0587070_029518_484_594 | 36 |
| 177 | 3300059492 | Ga0587073_0192673 | Ga0587073_0192673_262_372 | 36 |
| 178 | 3300059492 | Ga0587073_0338655 | Ga0587073_0338655_98_208 | 36 |
| 179 | 3300059505 | Ga0587083_0257401 | Ga0587083_0257401_310_420 | 36 |
| 180 | 3300059511 | Ga0587091_046442 | Ga0587091_046442_397_507 | 36 |
| 181 | 3300059643 | Ga0587072_070687 | Ga0587072_070687_297_407 | 36 |
| 182 | 3300060353 | Ga0501082_1056075 | Ga0501082_1056075_508_618 | 36 |
| 183 | 3300005543 | Ga0070672_100012108 | Ga0070672_1000121082 | 37 |
| 184 | 3300005543 | Ga0070672_100163866 | Ga0070672_1001638663 | 37 |
| 185 | 3300005545 | Ga0070695_101258884 | Ga0070695_1012588841 | 37 |
| 186 | 3300005548 | Ga0070665_100133289 | Ga0070665_1001332893 | 37 |
| 187 | 3300005548 | Ga0070665_101574266 | Ga0070665_1015742662 | 37 |
| 188 | 3300005564 | Ga0070664_100322636 | Ga0070664_1003226362 | 37 |
| 189 | 3300005564 | Ga0070664_101878826 | Ga0070664_1018788262 | 37 |
| 190 | 3300005616 | Ga0068852_100274943 | Ga0068852_1002749432 | 37 |
| 191 | 3300005617 | Ga0068859_100156806 | Ga0068859_1001568062 | 37 |
| 192 | 3300005617 | Ga0068859_102111821 | Ga0068859_1021118212 | 37 |
| 193 | 3300005618 | Ga0068864_100038520 | Ga0068864_1000385202 | 37 |
| 194 | 3300005618 | Ga0068864_101627703 | Ga0068864_1016277032 | 37 |
| 195 | 3300005718 | Ga0068866_10334851 | Ga0068866_103348512 | 37 |
| 196 | 3300005719 | Ga0068861_101473756 | Ga0068861_1014737562 | 37 |
| 197 | 3300005719 | Ga0068861_101621548 | Ga0068861_1016215481 | 37 |
| 198 | 3300005719 | Ga0068861_102571335 | Ga0068861_1025713352 | 37 |
| 199 | 3300005834 | Ga0068851_10161516 | Ga0068851_101615162 | 37 |
| 200 | 3300005834 | Ga0068851_10223853 | Ga0068851_102238532 | 37 |
| 201 | 3300005841 | Ga0068863_100429239 | Ga0068863_1004292392 | 37 |
| 202 | 3300005841 | Ga0068863_100612059 | Ga0068863_1006120592 | 37 |
| 203 | 3300005842 | Ga0068858_100008176 | Ga0068858_1000081764 | 37 |
| 204 | 3300005842 | Ga0068858_101831771 | Ga0068858_1018317712 | 37 |
| 205 | 3300005843 | Ga0068860_102641402 | Ga0068860_1026414022 | 37 |
| 206 | 3300005844 | Ga0068862_101476824 | Ga0068862_1014768242 | 37 |
| 207 | 3300006038 | Ga0075365_10528553 | Ga0075365_105285532 | 37 |
| 208 | 3300006042 | Ga0075368_10388705 | Ga0075368_103887052 | 37 |
| 209 | 3300006048 | Ga0075363_100138709 | Ga0075363_1001387092 | 37 |
| 210 | 3300006051 | Ga0075364_10151562 | Ga0075364_101515622 | 37 |
| 211 | 3300006051 | Ga0075364_10209331 | Ga0075364_102093312 | 37 |
| 212 | 3300006051 | Ga0075364_10439660 | Ga0075364_104396602 | 37 |
| 213 | 3300006051 | Ga0075364_11035439 | Ga0075364_110354392 | 37 |
| 214 | 3300006178 | Ga0075367_10064857 | Ga0075367_100648572 | 37 |
| 215 | 3300006178 | Ga0075367_10241386 | Ga0075367_102413862 | 37 |
| 216 | 3300006178 | Ga0075367_10742813 | Ga0075367_107428132 | 37 |
| 217 | 3300006186 | Ga0075369_10202008 | Ga0075369_102020082 | 37 |
| 218 | 3300006195 | Ga0075366_10003343 | Ga0075366_100033435 | 37 |
| 219 | 3300006195 | Ga0075366_10044969 | Ga0075366_100449693 | 37 |
| 220 | 3300006195 | Ga0075366_10122348 | Ga0075366_101223482 | 37 |
| 221 | 3300006195 | Ga0075366_10258815 | Ga0075366_102588152 | 37 |
| 222 | 3300006195 | Ga0075366_10301034 | Ga0075366_103010342 | 37 |
| 223 | 3300006237 | Ga0097621_100010253 | Ga0097621_1000102534 | 37 |
| 224 | 3300006237 | Ga0097621_101208395 | Ga0097621_1012083952 | 37 |
| 225 | 3300006237 | Ga0097621_101370633 | Ga0097621_1013706332 | 37 |
| 226 | 3300006353 | Ga0075370_10061361 | Ga0075370_100613612 | 37 |
| 227 | 3300006353 | Ga0075370_10954305 | Ga0075370_109543052 | 37 |
| 228 | 3300006358 | Ga0068871_100041133 | Ga0068871_1000411333 | 37 |
| 229 | 3300006358 | Ga0068871_100212896 | Ga0068871_1002128962 | 37 |
| 230 | 3300006358 | Ga0068871_100270994 | Ga0068871_1002709942 | 37 |
| 231 | 3300006846 | Ga0075430_101194545 | Ga0075430_1011945452 | 37 |
| 232 | 3300006846 | Ga0075430_101755272 | Ga0075430_1017552722 | 37 |
| 233 | 3300006847 | Ga0075431_100385352 | Ga0075431_1003853522 | 37 |
| 234 | 3300006847 | Ga0075431_101782794 | Ga0075431_1017827942 | 37 |
| 235 | 3300006881 | Ga0068865_100000679 | Ga0068865_10000067914 | 37 |
| 236 | 3300006881 | Ga0068865_100044132 | Ga0068865_1000441322 | 37 |
| 237 | 3300006881 | Ga0068865_100227718 | Ga0068865_1002277182 | 37 |
| 238 | 3300006881 | Ga0068865_101288987 | Ga0068865_1012889872 | 37 |
| 239 | 3300006931 | Ga0097620_100156807 | Ga0097620_1001568072 | 37 |
| 240 | 3300006931 | Ga0097620_102110815 | Ga0097620_1021108152 | 37 |
| 241 | 3300009093 | Ga0105240_10344214 | Ga0105240_103442141 | 37 |
| 242 | 3300009094 | Ga0111539_10310676 | Ga0111539_103106762 | 37 |
| 243 | 3300009098 | Ga0105245_10102499 | Ga0105245_101024992 | 37 |
| 244 | 3300009098 | Ga0105245_10122064 | Ga0105245_101220643 | 37 |
| 245 | 3300009101 | Ga0105247_10089908 | Ga0105247_100899083 | 37 |
| 246 | 3300009101 | Ga0105247_11179246 | Ga0105247_111792462 | 37 |
| 247 | 3300009148 | Ga0105243_12141372 | Ga0105243_121413722 | 37 |
| 248 | 3300009174 | Ga0105241_11391667 | Ga0105241_113916672 | 37 |
| 249 | 3300009176 | Ga0105242_10005420 | Ga0105242_100054208 | 37 |
| 250 | 3300009176 | Ga0105242_10041974 | Ga0105242_100419741 | 37 |
| 251 | 3300009176 | Ga0105242_10948705 | Ga0105242_109487051 | 37 |
| 252 | 3300009177 | Ga0105248_10011809 | Ga0105248_100118092 | 37 |
| 253 | 3300009177 | Ga0105248_11448051 | Ga0105248_114480512 | 37 |
| 254 | 3300009545 | Ga0105237_10189781 | Ga0105237_101897812 | 37 |
| 255 | 3300009553 | Ga0105249_11189541 | Ga0105249_111895412 | 37 |
| 256 | 3300009553 | Ga0105249_13190133 | Ga0105249_131901331 | 37 |
| 257 | 3300012473 | Ga0157340_1021313 | Ga0157340_10213132 | 37 |
| 258 | 3300013296 | Ga0157374_10008482 | Ga0157374_100084824 | 37 |
| 259 | 3300013296 | Ga0157374_11975001 | Ga0157374_119750011 | 37 |
| 260 | 3300013297 | Ga0157378_11619669 | Ga0157378_116196692 | 37 |
| 261 | 3300013306 | Ga0163162_10203069 | Ga0163162_102030692 | 37 |
| 262 | 3300013308 | Ga0157375_10210845 | Ga0157375_102108452 | 37 |
| 263 | 3300014325 | Ga0163163_10204488 | Ga0163163_102044881 | 37 |
| 264 | 3300014325 | Ga0163163_11897052 | Ga0163163_118970522 | 37 |
| 265 | 3300014326 | Ga0157380_10531002 | Ga0157380_105310022 | 37 |
| 266 | 3300014745 | Ga0157377_10252791 | Ga0157377_102527912 | 37 |
| 267 | 3300014968 | Ga0157379_10015416 | Ga0157379_100154164 | 37 |
| 268 | 3300014969 | Ga0157376_10015600 | Ga0157376_100156002 | 37 |
| 269 | 3300014969 | Ga0157376_10086333 | Ga0157376_100863333 | 37 |
| 270 | 3300014969 | Ga0157376_10117216 | Ga0157376_101172163 | 37 |
| 271 | 3300014969 | Ga0157376_11879730 | Ga0157376_118797302 | 37 |
| 272 | 3300017792 | Ga0163161_10662680 | Ga0163161_106626802 | 37 |
| 273 | 3300022467 | Ga0224712_10054033 | Ga0224712_100540332 | 37 |
| 274 | 3300025321 | Ga0207656_10169466 | Ga0207656_101694661 | 37 |
| 275 | 3300025321 | Ga0207656_10258915 | Ga0207656_102589152 | 37 |
| 276 | 3300025321 | Ga0207656_10267843 | Ga0207656_102678432 | 37 |
| 277 | 3300025893 | Ga0207682_10005717 | Ga0207682_100057173 | 37 |
| 278 | 3300025893 | Ga0207682_10066839 | Ga0207682_100668392 | 37 |
| 279 | 3300025899 | Ga0207642_10061024 | Ga0207642_100610242 | 37 |
| 280 | 3300025901 | Ga0207688_10242787 | Ga0207688_102427872 | 37 |
| 281 | 3300025901 | Ga0207688_10763110 | Ga0207688_107631102 | 37 |
| 282 | 3300025903 | Ga0207680_10072731 | Ga0207680_100727312 | 37 |
| 283 | 3300025903 | Ga0207680_10993801 | Ga0207680_109938012 | 37 |
| 284 | 3300025907 | Ga0207645_10201687 | Ga0207645_102016872 | 37 |
| 285 | 3300025908 | Ga0207643_10150571 | Ga0207643_101505712 | 37 |
| 286 | 3300025909 | Ga0207705_10755179 | Ga0207705_107551792 | 37 |
| 287 | 3300025911 | Ga0207654_10537297 | Ga0207654_105372972 | 37 |
| 288 | 3300025912 | Ga0207707_10023073 | Ga0207707_100230733 | 37 |
| 289 | 3300025912 | Ga0207707_10232183 | Ga0207707_102321832 | 37 |
| 290 | 3300025918 | Ga0207662_11230627 | Ga0207662_112306272 | 37 |
| 291 | 3300025920 | Ga0207649_10148489 | Ga0207649_101484892 | 37 |
| 292 | 3300025921 | Ga0207652_11031649 | Ga0207652_110316492 | 37 |
| 293 | 3300025923 | Ga0207681_10476188 | Ga0207681_104761882 | 37 |
| 294 | 3300025925 | Ga0207650_10033989 | Ga0207650_100339894 | 37 |
| 295 | 3300025925 | Ga0207650_11157163 | Ga0207650_111571632 | 37 |
| 296 | 3300025926 | Ga0207659_10328957 | Ga0207659_103289572 | 37 |
| 297 | 3300025926 | Ga0207659_10424713 | Ga0207659_104247132 | 37 |
| 298 | 3300025926 | Ga0207659_10450889 | Ga0207659_104508892 | 37 |
| 299 | 3300025927 | Ga0207687_10051801 | Ga0207687_100518012 | 37 |
| 300 | 3300025927 | Ga0207687_10100232 | Ga0207687_101002322 | 37 |
| 301 | 3300025931 | Ga0207644_10811491 | Ga0207644_108114912 | 37 |
| 302 | 3300025931 | Ga0207644_11058043 | Ga0207644_110580432 | 37 |
| 303 | 3300025932 | Ga0207690_11677324 | Ga0207690_116773242 | 37 |
| 304 | 3300025933 | Ga0207706_10661685 | Ga0207706_106616852 | 37 |
| 305 | 3300025934 | Ga0207686_10003510 | Ga0207686_100035104 | 37 |
| 306 | 3300025934 | Ga0207686_10819869 | Ga0207686_108198692 | 37 |
| 307 | 3300025936 | Ga0207670_11497241 | Ga0207670_114972412 | 37 |
| 308 | 3300025937 | Ga0207669_11369937 | Ga0207669_113699372 | 37 |
| 309 | 3300025938 | Ga0207704_10030279 | Ga0207704_100302793 | 37 |
| 310 | 3300025938 | Ga0207704_10275194 | Ga0207704_102751942 | 37 |
| 311 | 3300025938 | Ga0207704_10612038 | Ga0207704_106120382 | 37 |
| 312 | 3300025938 | Ga0207704_10841040 | Ga0207704_108410402 | 37 |
| 313 | 3300025940 | Ga0207691_10025721 | Ga0207691_100257214 | 37 |
| 314 | 3300025940 | Ga0207691_10091157 | Ga0207691_100911572 | 37 |
| 315 | 3300025940 | Ga0207691_11172539 | Ga0207691_111725392 | 37 |
| 316 | 3300025941 | Ga0207711_10060017 | Ga0207711_100600174 | 37 |
| 317 | 3300025941 | Ga0207711_10574730 | Ga0207711_105747301 | 37 |
| 318 | 3300025942 | Ga0207689_11598836 | Ga0207689_115988362 | 37 |
| 319 | 3300025945 | Ga0207679_10223185 | Ga0207679_102231852 | 37 |
| 320 | 3300025960 | Ga0207651_10133564 | Ga0207651_101335642 | 37 |
| 321 | 3300025961 | Ga0207712_10945704 | Ga0207712_109457042 | 37 |
| 322 | 3300025972 | Ga0207668_10016325 | Ga0207668_100163254 | 37 |
| 323 | 3300025972 | Ga0207668_10253744 | Ga0207668_102537442 | 37 |
| 324 | 3300025986 | Ga0207658_10566208 | Ga0207658_105662082 | 37 |
| 325 | 3300026023 | Ga0207677_10009286 | Ga0207677_100092862 | 37 |
| 326 | 3300026023 | Ga0207677_10448438 | Ga0207677_104484382 | 37 |
| 327 | 3300026023 | Ga0207677_11406442 | Ga0207677_114064422 | 37 |
| 328 | 3300026035 | Ga0207703_10001117 | Ga0207703_100011175 | 37 |
| 329 | 3300026035 | Ga0207703_10360129 | Ga0207703_103601292 | 37 |
| 330 | 3300026035 | Ga0207703_12121159 | Ga0207703_121211592 | 37 |
| 331 | 3300026041 | Ga0207639_10557014 | Ga0207639_105570142 | 37 |
| 332 | 3300026067 | Ga0207678_10045865 | Ga0207678_100458654 | 37 |
| 333 | 3300026067 | Ga0207678_10134457 | Ga0207678_101344572 | 37 |
| 334 | 3300026078 | Ga0207702_11957865 | Ga0207702_119578652 | 37 |
| 335 | 3300026088 | Ga0207641_10504426 | Ga0207641_105044262 | 37 |
| 336 | 3300026088 | Ga0207641_10587500 | Ga0207641_105875002 | 37 |
| 337 | 3300026088 | Ga0207641_12070542 | Ga0207641_120705422 | 37 |
| 338 | 3300026089 | Ga0207648_10686068 | Ga0207648_106860682 | 37 |
| 339 | 3300026089 | Ga0207648_11067819 | Ga0207648_110678192 | 37 |
| 340 | 3300026095 | Ga0207676_10078092 | Ga0207676_100780924 | 37 |
| 341 | 3300026095 | Ga0207676_10610819 | Ga0207676_106108192 | 37 |
| 342 | 3300026118 | Ga0207675_100254452 | Ga0207675_1002544522 | 37 |
| 343 | 3300026118 | Ga0207675_101197910 | Ga0207675_1011979102 | 37 |
| 344 | 3300026121 | Ga0207683_10068944 | Ga0207683_100689443 | 37 |
| 345 | 3300026121 | Ga0207683_10360350 | Ga0207683_103603502 | 37 |
| 346 | 3300026142 | Ga0207698_10249881 | Ga0207698_102498812 | 37 |
| 347 | 3300027866 | Ga0209813_10007409 | Ga0209813_100074093 | 37 |
| 348 | 3300027866 | Ga0209813_10275482 | Ga0209813_102754821 | 37 |
| 349 | 3300028379 | Ga0268266_10003213 | Ga0268266_1000321313 | 37 |
| 350 | 3300028379 | Ga0268266_10230928 | Ga0268266_102309282 | 37 |
| 351 | 3300028379 | Ga0268266_11518262 | Ga0268266_115182622 | 37 |
| 352 | 3300028380 | Ga0268265_12301563 | Ga0268265_123015632 | 37 |
| 353 | 3300028381 | Ga0268264_10042164 | Ga0268264_100421643 | 37 |
| 354 | 3300028381 | Ga0268264_10506339 | Ga0268264_105063392 | 37 |
| 355 | 3300031548 | Ga0307408_100013214 | Ga0307408_1000132144 | 37 |
| 356 | 3300031548 | Ga0307408_100027969 | Ga0307408_1000279692 | 37 |
| 357 | 3300031731 | Ga0307405_10030754 | Ga0307405_100307544 | 37 |
| 358 | 3300031731 | Ga0307405_10305389 | Ga0307405_103053892 | 37 |
| 359 | 3300031731 | Ga0307405_11047729 | Ga0307405_110477291 | 37 |
| 360 | 3300031824 | Ga0307413_10167808 | Ga0307413_101678082 | 37 |
| 361 | 3300031824 | Ga0307413_11663244 | Ga0307413_116632442 | 37 |
| 362 | 3300031852 | Ga0307410_10691607 | Ga0307410_106916072 | 37 |
| 363 | 3300031901 | Ga0307406_10123758 | Ga0307406_101237581 | 37 |
| 364 | 3300031901 | Ga0307406_11725975 | Ga0307406_117259752 | 37 |
| 365 | 3300031911 | Ga0307412_10318866 | Ga0307412_103188662 | 37 |
| 366 | 3300031911 | Ga0307412_10550836 | Ga0307412_105508362 | 37 |
| 367 | 3300031995 | Ga0307409_100140202 | Ga0307409_1001402023 | 37 |
| 368 | 3300031995 | Ga0307409_101612175 | Ga0307409_1016121752 | 37 |
| 369 | 3300032002 | Ga0307416_100009722 | Ga0307416_1000097222 | 37 |
| 370 | 3300032002 | Ga0307416_100024525 | Ga0307416_1000245253 | 37 |
| 371 | 3300032002 | Ga0307416_100383573 | Ga0307416_1003835732 | 37 |
| 372 | 3300032002 | Ga0307416_100647719 | Ga0307416_1006477192 | 37 |
| 373 | 3300032002 | Ga0307416_102349967 | Ga0307416_1023499672 | 37 |
| 374 | 3300032002 | Ga0307416_103055091 | Ga0307416_1030550911 | 37 |
| 375 | 3300032005 | Ga0307411_10215514 | Ga0307411_102155142 | 37 |
| 376 | 3300032005 | Ga0307411_10246394 | Ga0307411_102463942 | 37 |
| 377 | 3300032005 | Ga0307411_10879013 | Ga0307411_108790132 | 37 |
| 378 | 3300032005 | Ga0307411_11707954 | Ga0307411_117079542 | 37 |
| 379 | 3300032126 | Ga0307415_102360928 | Ga0307415_1023609282 | 37 |
| 380 | 3300041486 | Ga0451807_0280300 | Ga0451807_0280300_808_921 | 37 |
| 381 | 3300041494 | Ga0451837_1789254 | Ga0451837_1789254_68_181 | 37 |
| 382 | 3300042004 | Ga0439445_0197150 | Ga0439445_0197150_43_156 | 37 |
| 383 | 3300042122 | Ga0450920_046620 | Ga0450920_046620_439_552 | 37 |
| 384 | 3300042125 | Ga0450923_030572 | Ga0450923_030572_213_326 | 37 |
| 385 | 3300042133 | Ga0450896_028914 | Ga0450896_028914_673_786 | 37 |
| 386 | 3300042184 | Ga0450908_001910 | Ga0450908_001910_1121_1234 | 37 |
| 387 | 3300042436 | Ga0439435_0053004 | Ga0439435_0053004_128_241 | 37 |
| 388 | 3300042531 | Ga0450918_087500 | Ga0450918_087500_444_557 | 37 |
| 389 | 3300042876 | Ga0451577_0052742 | Ga0451577_0052742_2961_3074 | 37 |
| 390 | 3300042876 | Ga0451577_0405672 | Ga0451577_0405672_190_303 | 37 |
| 391 | 3300044712 | Ga0453684_0261550 | Ga0453684_0261550_960_1073 | 37 |
| 392 | 3300044712 | Ga0453684_0444621 | Ga0453684_0444621_448_561 | 37 |
| 393 | 3300048908 | Ga0496105_0420461 | Ga0496105_0420461_69_182 | 37 |
| 394 | 3300048909 | Ga0496106_0753649 | Ga0496106_0753649_402_515 | 37 |
| 395 | 3300048913 | Ga0496110_1405013 | Ga0496110_1405013_380_493 | 37 |
| 396 | 3300048917 | Ga0496114_0085681 | Ga0496114_0085681_2459_2572 | 37 |
| 397 | 3300048917 | Ga0496114_0760360 | Ga0496114_0760360_146_259 | 37 |
| 398 | 3300048918 | Ga0496115_0165716 | Ga0496115_0165716_379_492 | 37 |
| 399 | 3300049568 | Ga0501031_0118441 | Ga0501031_0118441_343_459 | 37 |
| 400 | 3300049568 | Ga0501031_0647549 | Ga0501031_0647549_263_376 | 37 |
| 401 | 3300049572 | Ga0501036_0066768 | Ga0501036_0066768_1729_1842 | 37 |
| 402 | 3300049572 | Ga0501036_0329285 | Ga0501036_0329285_30_143 | 37 |
| 403 | 3300049573 | Ga0501037_0183316 | Ga0501037_0183316_910_1026 | 37 |
| 404 | 3300049573 | Ga0501037_0579480 | Ga0501037_0579480_626_739 | 37 |
| 405 | 3300049575 | Ga0501039_0216911 | Ga0501039_0216911_361_474 | 37 |
| 406 | 3300049575 | Ga0501039_0471121 | Ga0501039_0471121_340_453 | 37 |
| 407 | 3300049576 | Ga0501040_0024917 | Ga0501040_0024917_111_224 | 37 |
| 408 | 3300049576 | Ga0501040_0060175 | Ga0501040_0060175_1225_1338 | 37 |
| 409 | 3300049577 | Ga0501041_0026587 | Ga0501041_0026587_355_468 | 37 |
| 410 | 3300049577 | Ga0501041_0042074 | Ga0501041_0042074_1919_2035 | 37 |
| 411 | 3300049577 | Ga0501041_0694033 | Ga0501041_0694033_340_453 | 37 |
| 412 | 3300049578 | Ga0501042_0050065 | Ga0501042_0050065_2198_2311 | 37 |
| 413 | 3300049578 | Ga0501042_0061110 | Ga0501042_0061110_598_711 | 37 |
| 414 | 3300049578 | Ga0501042_0075315 | Ga0501042_0075315_1506_1622 | 37 |
| 415 | 3300049578 | Ga0501042_0886076 | Ga0501042_0886076_202_315 | 37 |
| 416 | 3300049580 | Ga0501046_0138905 | Ga0501046_0138905_765_881 | 37 |
| 417 | 3300049582 | Ga0501048_0044900 | Ga0501048_0044900_1483_1596 | 37 |
| 418 | 3300049582 | Ga0501048_0094998 | Ga0501048_0094998_958_1074 | 37 |
| 419 | 3300049585 | Ga0501069_0250541 | Ga0501069_0250541_245_358 | 37 |
| 420 | 3300049585 | Ga0501069_0925292 | Ga0501069_0925292_292_405 | 37 |
| 421 | 3300049587 | Ga0501071_0007028 | Ga0501071_0007028_610_726 | 37 |
| 422 | 3300049587 | Ga0501071_0015190 | Ga0501071_0015190_3150_3263 | 37 |
| 423 | 3300049587 | Ga0501071_0110118 | Ga0501071_0110118_733_846 | 37 |
| 424 | 3300049587 | Ga0501071_0160521 | Ga0501071_0160521_1335_1448 | 37 |
| 425 | 3300049587 | Ga0501071_0723925 | Ga0501071_0723925_115_228 | 37 |
| 426 | 3300049588 | Ga0501072_0117533 | Ga0501072_0117533_401_514 | 37 |
| 427 | 3300049588 | Ga0501072_0120049 | Ga0501072_0120049_334_450 | 37 |
| 428 | 3300049589 | Ga0501073_0959862 | Ga0501073_0959862_420_533 | 37 |
| 429 | 3300049590 | Ga0501074_0359005 | Ga0501074_0359005_248_361 | 37 |
| 430 | 3300049591 | Ga0501075_0039986 | Ga0501075_0039986_1094_1207 | 37 |
| 431 | 3300049591 | Ga0501075_0275092 | Ga0501075_0275092_910_1026 | 37 |
| 432 | 3300049591 | Ga0501075_0503212 | Ga0501075_0503212_186_299 | 37 |
| 433 | 3300049591 | Ga0501075_0707090 | Ga0501075_0707090_160_273 | 37 |
| 434 | 3300049591 | Ga0501075_1424374 | Ga0501075_1424374_27_140 | 37 |
| 435 | 3300049592 | Ga0501076_0030654 | Ga0501076_0030654_1699_1812 | 37 |
| 436 | 3300049592 | Ga0501076_0041859 | Ga0501076_0041859_2362_2475 | 37 |
| 437 | 3300049592 | Ga0501076_0065861 | Ga0501076_0065861_657_773 | 37 |
| 438 | 3300049592 | Ga0501076_1783777 | Ga0501076_1783777_258_371 | 37 |
| 439 | 3300049593 | Ga0501077_0708849 | Ga0501077_0708849_413_526 | 37 |
| 440 | 3300049593 | Ga0501077_1109652 | Ga0501077_1109652_164_277 | 37 |
| 441 | 3300049593 | Ga0501077_1117431 | Ga0501077_1117431_335_451 | 37 |
| 442 | 3300049741 | Ga0501079_0059999 | Ga0501079_0059999_1349_1462 | 37 |
| 443 | 3300049741 | Ga0501079_0154399 | Ga0501079_0154399_1648_1764 | 37 |
| 444 | 3300049742 | Ga0501080_0213355 | Ga0501080_0213355_671_784 | 37 |
| 445 | 3300049742 | Ga0501080_0886294 | Ga0501080_0886294_469_585 | 37 |
| 446 | 3300049743 | Ga0501081_0328925 | Ga0501081_0328925_601_717 | 37 |
| 447 | 3300049744 | Ga0501083_0441652 | Ga0501083_0441652_466_582 | 37 |
| 448 | 3300049822 | Ga0501035_0878797 | Ga0501035_0878797_157_270 | 37 |
| 449 | 3300049824 | Ga0501045_0144576 | Ga0501045_0144576_1044_1157 | 37 |
| 450 | 3300049824 | Ga0501045_0145567 | Ga0501045_0145567_425_541 | 37 |
| 451 | 3300049824 | Ga0501045_0147501 | Ga0501045_0147501_1353_1466 | 37 |
| 452 | 3300049824 | Ga0501045_0591632 | Ga0501045_0591632_261_374 | 37 |
| 453 | 3300049851 | Ga0501212_083452 | Ga0501212_083452_167_280 | 37 |
| 454 | 3300050489 | nmdc:mga03683_444090_c1 | nmdc:mga03683_444090_c1_477_590 | 37 |
| 455 | 3300050490 | nmdc:mga03n38_442569_c1 | nmdc:mga03n38_442569_c1_519_632 | 37 |
| 456 | 3300050491 | nmdc:mga00v17_366946_c1 | nmdc:mga00v17_366946_c1_94_207 | 37 |
| 457 | 3300050491 | nmdc:mga00v17_469839_c1 | nmdc:mga00v17_469839_c1_667_780 | 37 |
| 458 | 3300050492 | nmdc:mga0yw44_796033_c1 | nmdc:mga0yw44_796033_c1_108_221 | 37 |
| 459 | 3300050492 | nmdc:mga0yw44_858971_c1 | nmdc:mga0yw44_858971_c1_97_210 | 37 |
| 460 | 3300050493 | nmdc:mga0k408_170202_c1 | nmdc:mga0k408_170202_c1_969_1082 | 37 |
| 461 | 3300050493 | nmdc:mga0k408_17218_c1 | nmdc:mga0k408_17218_c1_2750_2863 | 37 |
| 462 | 3300050493 | nmdc:mga0k408_594071_c1 | nmdc:mga0k408_594071_c1_318_431 | 37 |
| 463 | 3300050493 | nmdc:mga0k408_8093_c1 | nmdc:mga0k408_8093_c1_2532_2645 | 37 |
| 464 | 3300050494 | nmdc:mga06z11_105936_c1 | nmdc:mga06z11_105936_c1_1252_1365 | 37 |
| 465 | 3300050494 | nmdc:mga06z11_211157_c1 | nmdc:mga06z11_211157_c1_771_884 | 37 |
| 466 | 3300050494 | nmdc:mga06z11_322484_c1 | nmdc:mga06z11_322484_c1_550_663 | 37 |
| 467 | 3300050494 | nmdc:mga06z11_684648_c1 | nmdc:mga06z11_684648_c1_88_201 | 37 |
| 468 | 3300050495 | nmdc:mga04h51_204659_c1 | nmdc:mga04h51_204659_c1_609_722 | 37 |
| 469 | 3300050495 | nmdc:mga04h51_6639_c1 | nmdc:mga04h51_6639_c1_1624_1737 | 37 |
| 470 | 3300050496 | nmdc:mga07m45_27428_c2 | nmdc:mga07m45_27428_c2_457_570 | 37 |
| 471 | 3300050509 | nmdc:mga0qj67_1177722_c1 | nmdc:mga0qj67_1177722_c1_315_428 | 37 |
| 472 | 3300050509 | nmdc:mga0qj67_1600456_c1 | nmdc:mga0qj67_1600456_c1_369_482 | 37 |
| 473 | 3300050510 | nmdc:mga06r32_1120864_c1 | nmdc:mga06r32_1120864_c1_163_276 | 37 |
| 474 | 3300050510 | nmdc:mga06r32_375266_c1 | nmdc:mga06r32_375266_c1_1171_1284 | 37 |
| 475 | 3300050511 | nmdc:mga08y16_240261_c1 | nmdc:mga08y16_240261_c1_850_963 | 37 |
| 476 | 3300050512 | nmdc:mga0n895_1766861_c1 | nmdc:mga0n895_1766861_c1_44_157 | 37 |
| 477 | 3300050512 | nmdc:mga0n895_600911_c1 | nmdc:mga0n895_600911_c1_800_913 | 37 |
| 478 | 3300050516 | nmdc:mga0sz30_324056_c1 | nmdc:mga0sz30_324056_c1_149_262 | 37 |
| 479 | 3300054114 | Ga0501084_0060545 | Ga0501084_0060545_1510_1623 | 37 |
| 480 | 3300054114 | Ga0501084_0124121 | Ga0501084_0124121_767_883 | 37 |
| 481 | 3300059424 | Ga0590075_080469 | Ga0590075_080469_651_764 | 37 |
| 482 | 3300059424 | Ga0590075_097085 | Ga0590075_097085_37_150 | 37 |
| 483 | 3300060353 | Ga0501082_0140375 | Ga0501082_0140375_159_272 | 37 |
| 484 | 3300060353 | Ga0501082_0188947 | Ga0501082_0188947_96_209 | 37 |
| 485 | 3300060353 | Ga0501082_0317396 | Ga0501082_0317396_1081_1197 | 37 |
| 486 | 3300061734 | Ga0530510_0975406 | Ga0530510_0975406_149_262 | 37 |
| 487 | 3300061734 | Ga0530510_1046735 | Ga0530510_1046735_110_223 | 37 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar