F453403

General Info

Members Datasets Scaffolds Average Seq Length
487 383 974 163

Family's Representative Sequence

Representative Sequence 3300005336|Ga0070680_100041676|Ga0070680_1000416761
Length 176
Sequence MTTERVMTTELAVLAGGCFWGMQDLIRKLPGVISTQVGYTGGDVPNATYRNHGAHAEAIEINFDPSQTTYRRLLEFFFQIHDPTTLNRQGNDSGTSYRSAIYFTSNQQKAVALDTIADVDASGLWPGKVVTEVVSVGDFWVAEPEHQDYLERIPRGYTCHFARPNWVLPHRSGAAA

Samples

Sample ID Description Type Environment
1 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
14 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
17 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
21 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
22 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
28 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
29 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
33 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
34 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
36 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
37 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
39 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
43 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
49 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
50 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
53 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
59 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
60 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
61 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
62 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
63 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
64 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
99 3300029285 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.stno.R1 Metatranscriptome Rhizosphere
100 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
101 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
102 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
103 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
104 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
105 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
106 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
107 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
108 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
109 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
110 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
111 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
112 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
113 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
114 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
115 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
116 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
117 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
118 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
119 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
120 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
121 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
122 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
123 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
124 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
125 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
126 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
127 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
128 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
129 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
130 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
131 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
132 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
133 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
134 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
135 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
136 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
137 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
138 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
139 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
140 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
141 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
142 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
143 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
144 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
145 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
146 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
147 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
148 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
149 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
150 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
151 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
152 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
153 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
154 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
155 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
156 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
157 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
158 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
159 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
160 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
161 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
162 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
163 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
164 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
165 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
166 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
167 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
168 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
169 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
170 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
171 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
172 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
173 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
174 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
175 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
176 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
177 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
178 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
179 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
180 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
181 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
182 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
183 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
184 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
185 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
186 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
187 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
188 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
189 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
190 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
191 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
192 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
193 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
194 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
195 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
196 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
197 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
198 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
199 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
200 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
201 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
202 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
203 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
204 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
205 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
206 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
207 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
208 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
209 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
210 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
211 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
212 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
213 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
214 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
215 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
216 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
217 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
218 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
219 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
220 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
221 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
222 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
223 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
224 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
225 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
226 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
227 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
228 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
229 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
235 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
236 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
237 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
238 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
239 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
240 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
241 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
242 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
244 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
245 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
246 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
247 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
248 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
249 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
250 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
251 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
252 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
253 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
254 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
255 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
256 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
257 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
258 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
259 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
260 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
261 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
262 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
263 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
264 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
265 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
266 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
267 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
268 2509276019 Ensifer aridi TW10 Isolate Nodule
269 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
270 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
271 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
272 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
273 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
274 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
275 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
276 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
277 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
278 2571042365 Lysobacter oryzae DSM 21044 Isolate Rhizosphere
279 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
280 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
281 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
282 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
283 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
284 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
285 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
286 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
287 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
288 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
289 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
290 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
291 2862574272 Streptomyces sp. AcE210 Isolate Nodule
292 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
293 2899275550 Paracoccus hibiscisoli CCTCC AB2016182 Isolate Rhizosphere
294 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
295 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
296 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
297 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
298 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
299 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
300 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
301 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
302 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
303 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
304 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
305 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
306 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
307 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
308 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
309 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
310 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
311 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
312 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
313 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
314 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
315 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
316 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
317 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
318 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
319 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
320 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
321 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
322 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
323 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
324 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
325 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
326 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
327 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
328 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
329 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
330 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
331 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
332 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
333 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
334 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
335 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
336 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
337 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
338 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
339 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
340 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
341 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
342 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
343 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
344 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
345 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
346 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
347 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
348 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
349 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
350 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
351 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
352 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
353 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
354 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
355 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
356 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
357 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
358 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
359 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
360 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
361 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
362 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
363 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
364 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
365 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
366 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
367 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
368 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
369 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
370 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
371 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
372 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
373 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
374 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
375 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
376 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
377 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
378 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
379 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
380 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
381 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
382 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
383 8024501048 Rhizobium sp. H4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 72.48
Metatranscriptomes 3.29
Isolates 24.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.85
Nodule 23
Rhizoplane 5.54
Rhizosphere 67.56
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070680_100041676 3300005336 Bacteria 3722
2 Ga0070658_10497551 3300005327 Bacteria 1053
3 Ga0070676_10013208 3300005328 Bacteria 4524
4 Ga0070690_100019786 3300005330 Bacteria 4094
5 Ga0070666_10001351 3300005335 Bacteria 14888
6 Ga0070680_100113002 3300005336 Bacteria 2262
7 Ga0068868_100006955 3300005338 Bacteria 8041
8 Ga0070675_100000052 3300005354 Bacteria 71092
9 Ga0070671_100016835 3300005355 Bacteria 5911
10 Ga0070674_100291431 3300005356 Bacteria 1297
11 Ga0070688_100030393 3300005365 Bacteria 3242
12 Ga0070659_100224622 3300005366 Bacteria 1551
13 Ga0070667_100003469 3300005367 Bacteria 13431
14 Ga0070663_100007402 3300005455 Bacteria 6678
15 Ga0070663_100139312 3300005455 Bacteria 1850
16 Ga0070663_100188949 3300005455 Bacteria 1602
17 Ga0070663_100601613 3300005455 Bacteria 925
18 Ga0070678_100009502 3300005456 Bacteria 5897
19 Ga0070678_100436301 3300005456 Bacteria 1144
20 Ga0070681_10020142 3300005458 Bacteria 6686
21 Ga0070681_10060225 3300005458 Bacteria 3774
22 Ga0068867_100035124 3300005459 Bacteria 3635
23 Ga0070685_10003568 3300005466 Bacteria 7898
24 Ga0070679_100036645 3300005530 Bacteria 4868
25 Ga0070679_100212908 3300005530 Bacteria 1896
26 Ga0070679_100266843 3300005530 Bacteria 1667
27 Ga0070679_101225370 3300005530 Bacteria 696
28 Ga0070684_100318872 3300005535 Bacteria 1428
29 Ga0070672_100038576 3300005543 Bacteria 3651
30 Ga0070696_100004793 3300005546 Bacteria 9040
31 Ga0070693_100408010 3300005547 Bacteria 944
32 Ga0068855_100169148 3300005563 Bacteria 2476
33 Ga0068855_100261033 3300005563 Bacteria 1929
34 Ga0068855_101015315 3300005563 Bacteria 871
35 Ga0070664_100138104 3300005564 Bacteria 2145
36 Ga0068852_100226984 3300005616 Bacteria 1779
37 Ga0068859_100000624 3300005617 Bacteria 35420
38 Ga0068859_100805502 3300005617 Bacteria 1027
39 Ga0068864_100000276 3300005618 Bacteria 45759
40 Ga0068864_100562235 3300005618 Bacteria 1104
41 Ga0068851_10360411 3300005834 Bacteria 848
42 Ga0068863_100000744 3300005841 Bacteria 32582
43 Ga0068858_100000312 3300005842 Bacteria 51731
44 Ga0068858_100119785 3300005842 Bacteria 2461
45 Ga0068860_100087535 3300005843 Bacteria 2965
46 Ga0068860_100230385 3300005843 Bacteria 1800
47 Ga0081538_10001707 3300005981 Bacteria 22383
48 Ga0075365_10485827 3300006038 Bacteria 873
49 Ga0097621_100094897 3300006237 Bacteria 2501
50 Ga0097621_100211158 3300006237 Bacteria 1689
51 Ga0068871_100376999 3300006358 Bacteria 1259
52 Ga0075434_100220179 3300006871 Bacteria 1918
53 Ga0097620_100000624 3300006931 Bacteria 35420
54 Ga0097620_100805415 3300006931 Bacteria 1027
55 Ga0079104_1044310 3300006946 Bacteria 1020
56 Ga0105244_10172057 3300009036 Bacteria 1030
57 Ga0105240_10307957 3300009093 Bacteria 1810
58 Ga0105240_10432179 3300009093 Bacteria 1477
59 Ga0111539_10421572 3300009094 Bacteria 1554
60 Ga0105245_10021747 3300009098 Bacteria 5631
61 Ga0105241_10178457 3300009174 Bacteria 1760
62 Ga0105241_10191074 3300009174 Bacteria 1705
63 Ga0105248_10002353 3300009177 Bacteria 20987
64 Ga0105248_10423036 3300009177 Bacteria 1500
65 Ga0105248_10601076 3300009177 Bacteria 1241
66 Ga0105237_10104424 3300009545 Bacteria 2825
67 Ga0105249_10423131 3300009553 Bacteria 1366
68 Ga0105239_10380618 3300010375 Bacteria 1595
69 Ga0105246_10140625 3300011119 Bacteria 1815
70 Ga0157373_10021748 3300013100 Bacteria 4655
71 Ga0157370_11005240 3300013104 Bacteria 755
72 Ga0157369_10509813 3300013105 Bacteria 1244
73 Ga0157374_10079375 3300013296 Bacteria 3110
74 Ga0157378_10620329 3300013297 Bacteria 1094
75 Ga0163162_10050126 3300013306 Bacteria 4187
76 Ga0163162_12280122 3300013306 Bacteria 622
77 Ga0157372_10220532 3300013307 Bacteria 2198
78 Ga0157375_10034501 3300013308 Bacteria 4821
79 Ga0157375_10250969 3300013308 Bacteria 1930
80 Ga0157375_11500101 3300013308 Bacteria 796
81 Ga0163163_10000117 3300014325 Bacteria 84938
82 Ga0163163_10002909 3300014325 Bacteria 14495
83 Ga0163163_10335793 3300014325 Bacteria 1566
84 Ga0182008_10003732 3300014497 Bacteria 9076
85 Ga0157379_10052969 3300014968 Bacteria 3625
86 Ga0157379_10550038 3300014968 Bacteria 1074
87 Ga0157376_10006064 3300014969 Bacteria 8500
88 Ga0157376_10371085 3300014969 Bacteria 1375
89 Ga0182007_10001619 3300015262 Bacteria 11957
90 Ga0182005_1103522 3300015265 Bacteria 799
91 Ga0213876_10023376 3300021384 Bacteria 3265
92 Ga0207653_10001479 3300025885 Bacteria 7616
93 Ga0207682_10025980 3300025893 Bacteria 2324
94 Ga0207680_10000572 3300025903 Bacteria 17422
95 Ga0207680_10209146 3300025903 Bacteria 1333
96 Ga0207645_10022152 3300025907 Bacteria 4135
97 Ga0207654_10006231 3300025911 Bacteria 5995
98 Ga0207707_10005019 3300025912 Bacteria 11624
99 Ga0207707_10024781 3300025912 Bacteria 5248
100 Ga0207707_10030620 3300025912 Bacteria 4708
101 Ga0207707_10160277 3300025912 Bacteria 1967
102 Ga0207707_10291682 3300025912 Bacteria 1411
103 Ga0207707_10412823 3300025912 Bacteria 1158
104 Ga0207695_10560551 3300025913 Bacteria 1024
105 Ga0207671_10498702 3300025914 Bacteria 971
106 Ga0207660_10115983 3300025917 Bacteria 2022
107 Ga0207660_10162218 3300025917 Bacteria 1725
108 Ga0207652_10087029 3300025921 Bacteria 2740
109 Ga0207652_10157989 3300025921 Bacteria 2032
110 Ga0207652_10592971 3300025921 Bacteria 994
111 Ga0207652_11002142 3300025921 Bacteria 734
112 Ga0207681_10814171 3300025923 Bacteria 780
113 Ga0207650_10357026 3300025925 Bacteria 1203
114 Ga0207659_10000866 3300025926 Bacteria 17997
115 Ga0207664_10328406 3300025929 Bacteria 1350
116 Ga0207644_10024850 3300025931 Bacteria 4115
117 Ga0207706_10177179 3300025933 Bacteria 1873
118 Ga0207669_10219775 3300025937 Bacteria 1393
119 Ga0207691_10062980 3300025940 Bacteria 3364
120 Ga0207711_10001652 3300025941 Bacteria 20568
121 Ga0207711_10559234 3300025941 Bacteria 1067
122 Ga0207689_10088303 3300025942 Bacteria 2547
123 Ga0207679_10123535 3300025945 Bacteria 2065
124 Ga0207679_10163094 3300025945 Bacteria 1827
125 Ga0207667_10200359 3300025949 Bacteria 2048
126 Ga0207651_10000366 3300025960 Bacteria 19166
127 Ga0207658_10004857 3300025986 Bacteria 9286
128 Ga0207703_10002268 3300026035 Bacteria 16798
129 Ga0207703_10105049 3300026035 Bacteria 2400
130 Ga0207639_10123038 3300026041 Bacteria 2135
131 Ga0207678_10002601 3300026067 Bacteria 16444
132 Ga0207678_10072931 3300026067 Bacteria 2942
133 Ga0207678_10160493 3300026067 Bacteria 1920
134 Ga0207641_10000752 3300026088 Bacteria 34898
135 Ga0207676_10001107 3300026095 Bacteria 20368
136 Ga0207676_10633974 3300026095 Bacteria 1030
137 Ga0207674_10086409 3300026116 Bacteria 3131
138 Ga0207674_10250415 3300026116 Bacteria 1718
139 Ga0207683_10957554 3300026121 Bacteria 795
140 Ga0207698_10567876 3300026142 Bacteria 1114
141 Ga0268266_10180980 3300028379 Bacteria 1919
142 Ga0268264_10071127 3300028381 Bacteria 2947
143 Ga0265318_10016472 3300028577 Bacteria 3055
144 Ga0310981_1074752 3300029285 Bacteria 646
145 Ga0265328_10004688 3300031239 Bacteria 5909
146 Ga0265329_10017698 3300031242 Bacteria 2447
147 Ga0265331_10017134 3300031250 Bacteria 3785
148 Ga0265316_10153771 3300031344 Bacteria 1722
149 Ga0265314_10001290 3300031711 Bacteria 28462
150 Ga0265342_10028693 3300031712 Bacteria 3462
151 Ga0307410_10131615 3300031852 Bacteria 1838
152 Ga0307410_10737475 3300031852 Bacteria 833
153 Ga0307410_11484248 3300031852 Bacteria 597
154 Ga0307406_10094664 3300031901 Bacteria 2019
155 Ga0307416_100367212 3300032002 Bacteria 1464
156 Ga0373959_0202730 3300034820 Bacteria 525
157 Ga0316574_0067264 3300035398 Bacteria 2259
158 Ga0373931_0184075 3300035691 Bacteria 1239
159 Ga0395899_0200065 3300037312 Bacteria 1394
160 Ga0395899_0602129 3300037312 Bacteria 700
161 Ga0395900_0058474 3300037418 Bacteria 3969
162 Ga0395900_0132331 3300037418 Bacteria 2556
163 Ga0395898_0150394 3300037466 Bacteria 2228
164 Ga0395898_0373184 3300037466 Bacteria 1360
165 Ga0395905_0444360 3300037471 Bacteria 1194
166 Ga0395905_0508818 3300037471 Bacteria 1104
167 Ga0395901_0551536 3300038443 Bacteria 1168
168 Ga0395901_0644321 3300038443 Bacteria 1063
169 Ga0242420_094617 3300038996 Bacteria 630
170 Ga0400483_144412 3300039062 Bacteria 2339
171 Ga0436365_0821781 3300039437 Bacteria 1473
172 Ga0436361_0572681 3300039447 Bacteria 1325
173 Ga0436363_1477384 3300039450 Bacteria 1721
174 Ga0436362_0770534 3300039453 Bacteria 2256
175 Ga0439436_0019010 3300041404 Bacteria 2052
176 Ga0439438_090381 3300041405 Bacteria 746
177 Ga0439439_0016034 3300041406 Bacteria 1833
178 Ga0439466_0031676 3300041411 Bacteria 1807
179 Ga0439465_0021404 3300041413 Bacteria 2027
180 Ga0451791_0670657 3300041451 Bacteria 807
181 Ga0451837_1398031 3300041494 Bacteria 3008
182 Ga0439449_0031407 3300042007 Bacteria 1980
183 Ga0439450_195390 3300042008 Bacteria 540
184 Ga0439454_071399 3300042011 Bacteria 617
185 Ga0439456_116453 3300042013 Bacteria 611
186 Ga0466972_0048268 3300044658 Bacteria 2057
187 Ga0453683_0337631 3300044673 Bacteria 967
188 Ga0466963_0040355 3300044694 Bacteria 3059
189 Ga0466963_0519559 3300044694 Bacteria 841
190 Ga0466964_0221752 3300044706 Bacteria 919
191 Ga0466964_0480315 3300044706 Bacteria 664
192 Ga0451576_0536918 3300045051 Bacteria 1229
193 Ga0466967_0042264 3300045976 Bacteria 3937
194 Ga0495617_044665 3300046452 Bacteria 1478
195 Ga0495592_0014409 3300046454 Bacteria 6001
196 Ga0495603_0112128 3300046455 Bacteria 1591
197 Ga0495603_0309292 3300046455 Bacteria 907
198 Ga0495591_087671 3300046458 Bacteria 785
199 Ga0495629_0037911 3300046459 Bacteria 3396
200 Ga0495629_0248001 3300046459 Bacteria 1225
201 Ga0495638_0421080 3300046460 Bacteria 688
202 Ga0495651_0001990 3300046462 Bacteria 15824
203 Ga0495582_0013362 3300046473 Bacteria 4519
204 Ga0495605_0001894 3300046474 Bacteria 13362
205 Ga0495639_0148255 3300046475 Bacteria 1131
206 Ga0495664_0000836 3300046477 Bacteria 15787
207 Ga0495585_0445495 3300046492 Bacteria 620
208 Ga0495594_0046313 3300046499 Bacteria 2389
209 Ga0495607_0015535 3300046501 Bacteria 4932
210 Ga0495583_0014041 3300046506 Bacteria 4432
211 Ga0495606_0003789 3300046507 Bacteria 15713
212 Ga0495606_0446104 3300046507 Bacteria 664
213 Ga0495610_0066460 3300046512 Bacteria 1698
214 Ga0495616_0015186 3300046513 Bacteria 4285
215 Ga0495618_0112240 3300046514 Bacteria 1745
216 Ga0495620_0016354 3300046515 Bacteria 3724
217 Ga0495628_0489696 3300046516 Bacteria 889
218 Ga0495630_0869762 3300046517 Bacteria 687
219 Ga0495630_1228634 3300046517 Bacteria 566
220 Ga0495632_0310348 3300046519 Bacteria 698
221 Ga0495637_0046010 3300046520 Bacteria 1848
222 Ga0495643_0003638 3300046522 Bacteria 11196
223 Ga0495648_0020003 3300046524 Bacteria 4683
224 Ga0495648_0399616 3300046524 Bacteria 614
225 Ga0495666_0006320 3300046526 Bacteria 5966
226 Ga0495666_0080177 3300046526 Bacteria 1545
227 Ga0495642_0091041 3300046528 Bacteria 1291
228 Ga0495652_0169305 3300046529 Bacteria 1688
229 Ga0495654_0193046 3300046530 Bacteria 876
230 Ga0495665_0008771 3300046531 Bacteria 5488
231 Ga0495640_0004916 3300046533 Bacteria 10620
232 Ga0495586_0076114 3300046535 Bacteria 1838
233 Ga0495587_0018320 3300046536 Bacteria 4342
234 Ga0495609_0097790 3300046538 Bacteria 1273
235 Ga0495597_0011301 3300046542 Bacteria 4334
236 Ga0495645_0017241 3300046543 Bacteria 5173
237 Ga0495622_0002666 3300046557 Bacteria 8570
238 Ga0495622_0028898 3300046557 Bacteria 2590
239 Ga0495622_0034049 3300046557 Bacteria 2377
240 Ga0495667_0707792 3300046559 Bacteria 624
241 Ga0495668_0002512 3300046616 Bacteria 14990
242 Ga0495668_0132262 3300046616 Bacteria 1365
243 Ga0495634_0002539 3300046642 Bacteria 15099
244 Ga0495634_0424967 3300046642 Bacteria 787
245 Ga0495611_0011179 3300046648 Bacteria 3804
246 Ga0495611_0216004 3300046648 Bacteria 893
247 Ga0495625_0014357 3300046660 Bacteria 6327
248 Ga0495625_0024345 3300046660 Bacteria 4609
249 Ga0495635_0000821 3300046663 Bacteria 20349
250 Ga0495588_0018626 3300046674 Bacteria 3388
251 Ga0495588_0062593 3300046674 Bacteria 1929
252 Ga0495657_0007406 3300046675 Bacteria 8482
253 Ga0495646_0005549 3300046680 Bacteria 7978
254 Ga0495647_0524059 3300046681 Bacteria 553
255 Ga0495658_0096683 3300046683 Bacteria 1757
256 Ga0495613_0000661 3300046689 Bacteria 27309
257 Ga0495613_0002198 3300046689 Bacteria 14763
258 Ga0495613_0006802 3300046689 Bacteria 8537
259 Ga0495613_0427650 3300046689 Bacteria 900
260 Ga0495624_0003641 3300046690 Bacteria 11400
261 Ga0495624_0233958 3300046690 Bacteria 1112
262 Ga0495649_0022153 3300046694 Bacteria 3555
263 Ga0495649_0102322 3300046694 Bacteria 1522
264 Ga0495589_0022687 3300046794 Bacteria 3202
265 Ga0495589_0022811 3300046794 Bacteria 3191
266 Ga0495600_0060534 3300046809 Bacteria 2472
267 Ga0495600_0238142 3300046809 Bacteria 1160
268 Ga0495581_0008758 3300047315 Bacteria 5857
269 Ga0495581_0029915 3300047315 Bacteria 3157
270 Ga0495581_0310419 3300047315 Bacteria 922
271 Ga0495604_0001750 3300047317 Bacteria 17747
272 Ga0495636_0033666 3300047318 Bacteria 2106
273 Ga0495636_0281875 3300047318 Bacteria 774
274 Ga0495676_0005057 3300047321 Bacteria 12093
275 Ga0495676_0009523 3300047321 Bacteria 8844
276 Ga0495676_0039824 3300047321 Bacteria 3887
277 Ga0495676_0660610 3300047321 Bacteria 678
278 Ga0495687_010952 3300047443 Bacteria 4918
279 Ga0495687_028683 3300047443 Bacteria 2585
280 Ga0495675_0052499 3300047444 Bacteria 2588
281 Ga0495675_0119508 3300047444 Bacteria 1641
282 Ga0495677_0074538 3300047445 Bacteria 1267
283 Ga0495685_011634 3300047447 Bacteria 2973
284 Ga0495681_0009504 3300047470 Bacteria 5982
285 Ga0495681_0058339 3300047470 Bacteria 1789
286 Ga0495686_0361749 3300047472 Bacteria 786
287 Ga0495593_0009793 3300047673 Bacteria 5559
288 Ga0495593_0025851 3300047673 Bacteria 3248
289 Ga0495602_0051321 3300048088 Bacteria 3674
290 Ga0495614_0000232 3300048089 Bacteria 21631
291 Ga0495614_0006929 3300048089 Bacteria 5064
292 Ga0495614_0026302 3300048089 Bacteria 2508
293 Ga0495615_0123518 3300048090 Bacteria 751
294 Ga0495615_0154748 3300048090 Bacteria 685
295 Ga0496100_0099880 3300048903 Bacteria 1998
296 Ga0496101_0031517 3300048904 Bacteria 3728
297 Ga0496102_0002076 3300048905 Bacteria 17245
298 Ga0496102_0021787 3300048905 Bacteria 5671
299 Ga0496104_0284348 3300048907 Bacteria 1567
300 Ga0496105_0341030 3300048908 Bacteria 1198
301 Ga0496105_0435235 3300048908 Bacteria 1037
302 Ga0496105_0770209 3300048908 Bacteria 734
303 Ga0496106_0022659 3300048909 Bacteria 4667
304 Ga0496106_0249701 3300048909 Bacteria 1418
305 Ga0496106_0517809 3300048909 Bacteria 958
306 Ga0496107_0012291 3300048910 Bacteria 5976
307 Ga0496108_0008095 3300048911 Bacteria 8526
308 Ga0496108_0676991 3300048911 Bacteria 896
309 Ga0496109_0253019 3300048912 Bacteria 1659
310 Ga0496109_0284178 3300048912 Bacteria 1559
311 Ga0496109_0524842 3300048912 Bacteria 1117
312 Ga0496110_0788520 3300048913 Bacteria 854
313 Ga0496112_0001314 3300048915 Bacteria 18895
314 Ga0496112_0015143 3300048915 Bacteria 7186
315 Ga0496113_0194614 3300048916 Bacteria 1610
316 Ga0496113_0467289 3300048916 Bacteria 1014
317 Ga0496113_0590083 3300048916 Bacteria 890
318 Ga0496114_0135134 3300048917 Bacteria 2132
319 Ga0496115_0009063 3300048918 Bacteria 7383
320 Ga0496115_0198286 3300048918 Bacteria 1658
321 Ga0496123_0454191 3300048926 Bacteria 570
322 Ga0496126_0032593 3300048929 Bacteria 4907
323 Ga0495678_048542 3300049459 Bacteria 1655
324 Ga0501291_002098 3300049514 Bacteria 2361
325 Ga0501300_000409 3300049523 Bacteria 6497
326 Ga0501318_084509 3300049534 Bacteria 518
327 Ga0501320_040356 3300049536 Bacteria 610
328 Ga0501031_0861700 3300049568 Bacteria 580
329 Ga0501033_0021682 3300049570 Bacteria 4848
330 Ga0501034_0094677 3300049571 Bacteria 2983
331 Ga0501034_0393192 3300049571 Bacteria 1310
332 Ga0501043_0033902 3300049579 Bacteria 4017
333 Ga0501047_0092623 3300049581 Bacteria 2901
334 Ga0501070_0911586 3300049586 Bacteria 685
335 Ga0501074_0138990 3300049590 Bacteria 1738
336 Ga0501074_0395875 3300049590 Bacteria 980
337 Ga0501077_0289025 3300049593 Bacteria 1044
338 Ga0501217_330856 3300049661 Bacteria 509
339 Ga0501249_005968 3300049679 Bacteria 2499
340 Ga0501245_035951 3300049708 Bacteria 835
341 Ga0501080_1088561 3300049742 Bacteria 690
342 Ga0501280_000182 3300049776 Bacteria 15902
343 Ga0501035_0047343 3300049822 Bacteria 3860
344 Ga0501035_0333456 3300049822 Bacteria 1272
345 Ga0501044_0071433 3300049823 Bacteria 3529
346 nmdc:mga03n38_112789_c1 3300050490 Bacteria 1326
347 nmdc:mga00v17_188869_c1 3300050491 Bacteria 1330
348 nmdc:mga06z11_7831_c1 3300050494 Bacteria 4419
349 nmdc:mga04h51_46009_c1 3300050495 Bacteria 1445
350 nmdc:mga09592_662693_c1 3300050508 Bacteria 890
351 nmdc:mga0n895_1452245_c1 3300050512 Bacteria 653
352 Ga0495619_0321514 3300053085 Bacteria 1071
353 Ga0500640_045339 3300053095 Bacteria 1928
354 Ga0500560_013070 3300053107 Bacteria 2172
355 Ga0500618_041568 3300053125 Bacteria 1055
356 Ga0500636_0236661 3300053177 Bacteria 941
357 Ga0587070_023343 3300059491 Bacteria 1062
358 Ga0587073_0021402 3300059492 Bacteria 1244
359 Ga0587082_041015 3300059504 Bacteria 849
360 Ga0587082_041086 3300059504 Bacteria 848
361 Ga0587083_0042862 3300059505 Bacteria 955
362 Ga0587088_091541 3300059508 Bacteria 667
363 Ga0587091_041394 3300059511 Bacteria 910
364 Ga0587092_014359 3300059512 Bacteria 1145
365 Ga0587098_030040 3300059604 Bacteria 743
366 Ga0587075_007664 3300059644 Bacteria 1361
367 Ga0587076_073976 3300059645 Bacteria 713
368 Ga0587107_019280 3300059652 Bacteria 934
369 Ga0587114_012042 3300059655 Bacteria 1089
370 2503201411 2503198000 Bacteria 6884444
371 2509374944 2509276019 Bacteria 6802256
372 2513584500 2513237086 Bacteria 7265287
373 2513883150 2513237140 Bacteria 7076289
374 2513907108 2513237143 Bacteria 6664116
375 2514000590 2513237159 Bacteria 6810126
376 2551674883 2551306084 Bacteria 8942552
377 2551687135 2551306085 Bacteria 7347181
378 2551697328 2551306087 Bacteria 7351905
379 2551720076 2551306090 Bacteria 7953713
380 2551723583 2551306090 Bacteria 7953713
381 2551739704 2551306093 Bacteria 7064773
382 2572256003 2571042365 Bacteria 3289345
383 2805928551 2802429605 Bacteria 6875453
384 2838668912 2838668709 Bacteria 6671819
385 2838701428 2838701080 Bacteria 6669771
386 2842146507 2842146304 Bacteria 5957337
387 2842251263 2842250916 Bacteria 6579627
388 2842319511 2842317721 Bacteria 6793725
389 2842490862 2842489311 Bacteria 6620893
390 2842498726 2842495871 Bacteria 6820686
391 2842523577 2842521101 Bacteria 6569494
392 2850083844 2850079185 Bacteria 6848280
393 2855830424 2855825444 Bacteria 6785811
394 2858805197 2858800743 Bacteria 6603254
395 2862577910 2862574272 Bacteria 10567477
396 2889916540 2889914905 Bacteria 5702301
397 2899276775 2899275550 Bacteria 3958688
398 2915995542 2915993759 Bacteria 7016183
399 2916004103 2916000859 Bacteria 6865702
400 2916012507 2916007675 Bacteria 6898660
401 2916037298 2916035215 Bacteria 6755766
402 2916070079 2916068649 Bacteria 6943657
403 2916082442 2916076590 Bacteria 6596108
404 2919470724 2919468124 Bacteria 9133025
405 2921202476 2921201388 Bacteria 6926299
406 2921249627 2921244191 Bacteria 6568419
407 2921285028 2921282425 Bacteria 6826397
408 2921294174 2921289301 Bacteria 7316391
409 2921298969 2921296804 Bacteria 7176999
410 2924144355 2924144063 Bacteria 6883928
411 2924151574 2924150972 Bacteria 7169444
412 2924159451 2924158325 Bacteria 7188855
413 2924172573 2924165586 Bacteria 7260590
414 2924185803 2924179722 Bacteria 6843264
415 2924201304 2924200457 Bacteria 6757188
416 2924218876 2924214083 Bacteria 7080103
417 2924227662 2924221636 Bacteria 7113495
418 2924230915 2924228884 Bacteria 6633132
419 2937017985 2937016420 Bacteria 6782579
420 2937052477 2937049772 Bacteria 6757901
421 2937057256 2937056579 Bacteria 7107896
422 2937096404 2937091812 Bacteria 6979387
423 2937105738 2937098957 Bacteria 7249374
424 2937111334 2937106411 Bacteria 6947143
425 2957390254 2957388812 Bacteria 6778072
426 2957409434 2957408893 Bacteria 6558585
427 2957420506 2957415311 Bacteria 6991633
428 2957424459 2957422303 Bacteria 7172205
429 2957430260 2957430029 Bacteria 7022557
430 2957460029 2957457609 Bacteria 6967680
431 2957464972 2957464669 Bacteria 6568877
432 2957475262 2957471148 Bacteria 6797643
433 2957486828 2957484790 Bacteria 6703082
434 2957492931 2957491536 Bacteria 6695180
435 2957500162 2957498199 Bacteria 7126688
436 2957506104 2957505466 Bacteria 7253085
437 2960590756 2960584000 Bacteria 6864594
438 2960606227 2960603979 Bacteria 6898737
439 2960619126 2960617483 Bacteria 6727748
440 2960652572 2960645483 Bacteria 7211087
441 2964608886 2964607997 Bacteria 7101408
442 2964624563 2964621998 Bacteria 6834995
443 2964636549 2964636051 Bacteria 7091832
444 2964649720 2964643177 Bacteria 6820887
445 2964655667 2964649959 Bacteria 6675118
446 2964661256 2964656573 Bacteria 7100150
447 2964678940 2964678106 Bacteria 6792020
448 2964690247 2964685014 Bacteria 6839111
449 2964715947 2964712639 Bacteria 6695970
450 2964721757 2964719344 Bacteria 7286602
451 2967668747 2967664464 Bacteria 6948836
452 2967675056 2967671571 Bacteria 7021409
453 2967685471 2967678726 Bacteria 7264382
454 2967694162 2967693043 Bacteria 6804451
455 2967709617 2967706974 Bacteria 7186053
456 2967715960 2967714385 Bacteria 7000047
457 2967722739 2967721400 Bacteria 7073753
458 2967744198 2967742019 Bacteria 6794534
459 2967750269 2967748971 Bacteria 6733771
460 2967764723 2967762386 Bacteria 6923502
461 2967770090 2967769361 Bacteria 6587838
462 2970019950 2970019648 Bacteria 7072033
463 2970043194 2970040964 Bacteria 6731123
464 2970050283 2970047711 Bacteria 7088379
465 2970060679 2970054988 Bacteria 6611507
466 2970062965 2970061556 Bacteria 7099761
467 2970077752 2970076120 Bacteria 6697332
468 2970095118 2970088815 Bacteria 6933825
469 2970099531 2970095765 Bacteria 6936963
470 2970114031 2970109326 Bacteria 6863976
471 2970119896 2970116247 Bacteria 6501857
472 2970130797 2970129317 Bacteria 6806560
473 2970137992 2970136068 Bacteria 7207982
474 2970152659 2970149975 Bacteria 6779706
475 2970158257 2970156795 Bacteria 7168044
476 2970184759 2970184632 Bacteria 7054431
477 2970194010 2970191845 Bacteria 7032787
478 2977519904 2977516862 Bacteria 6940108
479 2977525229 2977523885 Bacteria 6960446
480 2977539298 2977537788 Bacteria 6929320
481 2977558740 2977551784 Bacteria 7125765
482 2977564255 2977558990 Bacteria 6863948
483 2977575102 2977572785 Bacteria 6763888
484 2977580622 2977579622 Bacteria 6772100
485 8005543243 8005542996 Bacteria 7077758
486 8005690484 8005688590 Bacteria 6610080
487 8024501853 8024501048 Bacteria 6427847
488 Ga0070680_100041676
489 Ga0070658_10497551
490 Ga0070676_10013208
491 Ga0070690_100019786
492 Ga0070666_10001351
493 Ga0070680_100113002
494 Ga0068868_100006955
495 Ga0070675_100000052
496 Ga0070671_100016835
497 Ga0070674_100291431
498 Ga0070688_100030393
499 Ga0070659_100224622
500 Ga0070667_100003469
501 Ga0070663_100007402
502 Ga0070663_100139312
503 Ga0070663_100188949
504 Ga0070663_100601613
505 Ga0070678_100009502
506 Ga0070678_100436301
507 Ga0070681_10020142
508 Ga0070681_10060225
509 Ga0068867_100035124
510 Ga0070685_10003568
511 Ga0070679_100036645
512 Ga0070679_100212908
513 Ga0070679_100266843
514 Ga0070679_101225370
515 Ga0070684_100318872
516 Ga0070672_100038576
517 Ga0070696_100004793
518 Ga0070693_100408010
519 Ga0068855_100169148
520 Ga0068855_100261033
521 Ga0068855_101015315
522 Ga0070664_100138104
523 Ga0068852_100226984
524 Ga0068859_100000624
525 Ga0068859_100805502
526 Ga0068864_100000276
527 Ga0068864_100562235
528 Ga0068851_10360411
529 Ga0068863_100000744
530 Ga0068858_100000312
531 Ga0068858_100119785
532 Ga0068860_100087535
533 Ga0068860_100230385
534 Ga0081538_10001707
535 Ga0075365_10485827
536 Ga0097621_100094897
537 Ga0097621_100211158
538 Ga0068871_100376999
539 Ga0075434_100220179
540 Ga0097620_100000624
541 Ga0097620_100805415
542 Ga0079104_1044310
543 Ga0105244_10172057
544 Ga0105240_10307957
545 Ga0105240_10432179
546 Ga0111539_10421572
547 Ga0105245_10021747
548 Ga0105241_10178457
549 Ga0105241_10191074
550 Ga0105248_10002353
551 Ga0105248_10423036
552 Ga0105248_10601076
553 Ga0105237_10104424
554 Ga0105249_10423131
555 Ga0105239_10380618
556 Ga0105246_10140625
557 Ga0157373_10021748
558 Ga0157370_11005240
559 Ga0157369_10509813
560 Ga0157374_10079375
561 Ga0157378_10620329
562 Ga0163162_10050126
563 Ga0163162_12280122
564 Ga0157372_10220532
565 Ga0157375_10034501
566 Ga0157375_10250969
567 Ga0157375_11500101
568 Ga0163163_10000117
569 Ga0163163_10002909
570 Ga0163163_10335793
571 Ga0182008_10003732
572 Ga0157379_10052969
573 Ga0157379_10550038
574 Ga0157376_10006064
575 Ga0157376_10371085
576 Ga0182007_10001619
577 Ga0182005_1103522
578 Ga0213876_10023376
579 Ga0207653_10001479
580 Ga0207682_10025980
581 Ga0207680_10000572
582 Ga0207680_10209146
583 Ga0207645_10022152
584 Ga0207654_10006231
585 Ga0207707_10005019
586 Ga0207707_10024781
587 Ga0207707_10030620
588 Ga0207707_10160277
589 Ga0207707_10291682
590 Ga0207707_10412823
591 Ga0207695_10560551
592 Ga0207671_10498702
593 Ga0207660_10115983
594 Ga0207660_10162218
595 Ga0207652_10087029
596 Ga0207652_10157989
597 Ga0207652_10592971
598 Ga0207652_11002142
599 Ga0207681_10814171
600 Ga0207650_10357026
601 Ga0207659_10000866
602 Ga0207664_10328406
603 Ga0207644_10024850
604 Ga0207706_10177179
605 Ga0207669_10219775
606 Ga0207691_10062980
607 Ga0207711_10001652
608 Ga0207711_10559234
609 Ga0207689_10088303
610 Ga0207679_10123535
611 Ga0207679_10163094
612 Ga0207667_10200359
613 Ga0207651_10000366
614 Ga0207658_10004857
615 Ga0207703_10002268
616 Ga0207703_10105049
617 Ga0207639_10123038
618 Ga0207678_10002601
619 Ga0207678_10072931
620 Ga0207678_10160493
621 Ga0207641_10000752
622 Ga0207676_10001107
623 Ga0207676_10633974
624 Ga0207674_10086409
625 Ga0207674_10250415
626 Ga0207683_10957554
627 Ga0207698_10567876
628 Ga0268266_10180980
629 Ga0268264_10071127
630 Ga0265318_10016472
631 Ga0310981_1074752
632 Ga0265328_10004688
633 Ga0265329_10017698
634 Ga0265331_10017134
635 Ga0265316_10153771
636 Ga0265314_10001290
637 Ga0265342_10028693
638 Ga0307410_10131615
639 Ga0307410_10737475
640 Ga0307410_11484248
641 Ga0307406_10094664
642 Ga0307416_100367212
643 Ga0373959_0202730
644 Ga0316574_0067264
645 Ga0373931_0184075
646 Ga0395899_0200065
647 Ga0395899_0602129
648 Ga0395900_0058474
649 Ga0395900_0132331
650 Ga0395898_0150394
651 Ga0395898_0373184
652 Ga0395905_0444360
653 Ga0395905_0508818
654 Ga0395901_0551536
655 Ga0395901_0644321
656 Ga0242420_094617
657 Ga0400483_144412
658 Ga0436365_0821781
659 Ga0436361_0572681
660 Ga0436363_1477384
661 Ga0436362_0770534
662 Ga0439436_0019010
663 Ga0439438_090381
664 Ga0439439_0016034
665 Ga0439466_0031676
666 Ga0439465_0021404
667 Ga0451791_0670657
668 Ga0451837_1398031
669 Ga0439449_0031407
670 Ga0439450_195390
671 Ga0439454_071399
672 Ga0439456_116453
673 Ga0466972_0048268
674 Ga0453683_0337631
675 Ga0466963_0040355
676 Ga0466963_0519559
677 Ga0466964_0221752
678 Ga0466964_0480315
679 Ga0451576_0536918
680 Ga0466967_0042264
681 Ga0495617_044665
682 Ga0495592_0014409
683 Ga0495603_0112128
684 Ga0495603_0309292
685 Ga0495591_087671
686 Ga0495629_0037911
687 Ga0495629_0248001
688 Ga0495638_0421080
689 Ga0495651_0001990
690 Ga0495582_0013362
691 Ga0495605_0001894
692 Ga0495639_0148255
693 Ga0495664_0000836
694 Ga0495585_0445495
695 Ga0495594_0046313
696 Ga0495607_0015535
697 Ga0495583_0014041
698 Ga0495606_0003789
699 Ga0495606_0446104
700 Ga0495610_0066460
701 Ga0495616_0015186
702 Ga0495618_0112240
703 Ga0495620_0016354
704 Ga0495628_0489696
705 Ga0495630_0869762
706 Ga0495630_1228634
707 Ga0495632_0310348
708 Ga0495637_0046010
709 Ga0495643_0003638
710 Ga0495648_0020003
711 Ga0495648_0399616
712 Ga0495666_0006320
713 Ga0495666_0080177
714 Ga0495642_0091041
715 Ga0495652_0169305
716 Ga0495654_0193046
717 Ga0495665_0008771
718 Ga0495640_0004916
719 Ga0495586_0076114
720 Ga0495587_0018320
721 Ga0495609_0097790
722 Ga0495597_0011301
723 Ga0495645_0017241
724 Ga0495622_0002666
725 Ga0495622_0028898
726 Ga0495622_0034049
727 Ga0495667_0707792
728 Ga0495668_0002512
729 Ga0495668_0132262
730 Ga0495634_0002539
731 Ga0495634_0424967
732 Ga0495611_0011179
733 Ga0495611_0216004
734 Ga0495625_0014357
735 Ga0495625_0024345
736 Ga0495635_0000821
737 Ga0495588_0018626
738 Ga0495588_0062593
739 Ga0495657_0007406
740 Ga0495646_0005549
741 Ga0495647_0524059
742 Ga0495658_0096683
743 Ga0495613_0000661
744 Ga0495613_0002198
745 Ga0495613_0006802
746 Ga0495613_0427650
747 Ga0495624_0003641
748 Ga0495624_0233958
749 Ga0495649_0022153
750 Ga0495649_0102322
751 Ga0495589_0022687
752 Ga0495589_0022811
753 Ga0495600_0060534
754 Ga0495600_0238142
755 Ga0495581_0008758
756 Ga0495581_0029915
757 Ga0495581_0310419
758 Ga0495604_0001750
759 Ga0495636_0033666
760 Ga0495636_0281875
761 Ga0495676_0005057
762 Ga0495676_0009523
763 Ga0495676_0039824
764 Ga0495676_0660610
765 Ga0495687_010952
766 Ga0495687_028683
767 Ga0495675_0052499
768 Ga0495675_0119508
769 Ga0495677_0074538
770 Ga0495685_011634
771 Ga0495681_0009504
772 Ga0495681_0058339
773 Ga0495686_0361749
774 Ga0495593_0009793
775 Ga0495593_0025851
776 Ga0495602_0051321
777 Ga0495614_0000232
778 Ga0495614_0006929
779 Ga0495614_0026302
780 Ga0495615_0123518
781 Ga0495615_0154748
782 Ga0496100_0099880
783 Ga0496101_0031517
784 Ga0496102_0002076
785 Ga0496102_0021787
786 Ga0496104_0284348
787 Ga0496105_0341030
788 Ga0496105_0435235
789 Ga0496105_0770209
790 Ga0496106_0022659
791 Ga0496106_0249701
792 Ga0496106_0517809
793 Ga0496107_0012291
794 Ga0496108_0008095
795 Ga0496108_0676991
796 Ga0496109_0253019
797 Ga0496109_0284178
798 Ga0496109_0524842
799 Ga0496110_0788520
800 Ga0496112_0001314
801 Ga0496112_0015143
802 Ga0496113_0194614
803 Ga0496113_0467289
804 Ga0496113_0590083
805 Ga0496114_0135134
806 Ga0496115_0009063
807 Ga0496115_0198286
808 Ga0496123_0454191
809 Ga0496126_0032593
810 Ga0495678_048542
811 Ga0501291_002098
812 Ga0501300_000409
813 Ga0501318_084509
814 Ga0501320_040356
815 Ga0501031_0861700
816 Ga0501033_0021682
817 Ga0501034_0094677
818 Ga0501034_0393192
819 Ga0501043_0033902
820 Ga0501047_0092623
821 Ga0501070_0911586
822 Ga0501074_0138990
823 Ga0501074_0395875
824 Ga0501077_0289025
825 Ga0501217_330856
826 Ga0501249_005968
827 Ga0501245_035951
828 Ga0501080_1088561
829 Ga0501280_000182
830 Ga0501035_0047343
831 Ga0501035_0333456
832 Ga0501044_0071433
833 nmdc:mga03n38_112789_c1
834 nmdc:mga00v17_188869_c1
835 nmdc:mga06z11_7831_c1
836 nmdc:mga04h51_46009_c1
837 nmdc:mga09592_662693_c1
838 nmdc:mga0n895_1452245_c1
839 Ga0495619_0321514
840 Ga0500640_045339
841 Ga0500560_013070
842 Ga0500618_041568
843 Ga0500636_0236661
844 Ga0587070_023343
845 Ga0587073_0021402
846 Ga0587082_041015
847 Ga0587082_041086
848 Ga0587083_0042862
849 Ga0587088_091541
850 Ga0587091_041394
851 Ga0587092_014359
852 Ga0587098_030040
853 Ga0587075_007664
854 Ga0587076_073976
855 Ga0587107_019280
856 Ga0587114_012042
857 2503201411
858 2509374944
859 2513584500
860 2513883150
861 2513907108
862 2514000590
863 2551674883
864 2551687135
865 2551697328
866 2551720076
867 2551723583
868 2551739704
869 2572256003
870 2805928551
871 2838668912
872 2838701428
873 2842146507
874 2842251263
875 2842319511
876 2842490862
877 2842498726
878 2842523577
879 2850083844
880 2855830424
881 2858805197
882 2862577910
883 2889916540
884 2899276775
885 2915995542
886 2916004103
887 2916012507
888 2916037298
889 2916070079
890 2916082442
891 2919470724
892 2921202476
893 2921249627
894 2921285028
895 2921294174
896 2921298969
897 2924144355
898 2924151574
899 2924159451
900 2924172573
901 2924185803
902 2924201304
903 2924218876
904 2924227662
905 2924230915
906 2937017985
907 2937052477
908 2937057256
909 2937096404
910 2937105738
911 2937111334
912 2957390254
913 2957409434
914 2957420506
915 2957424459
916 2957430260
917 2957460029
918 2957464972
919 2957475262
920 2957486828
921 2957492931
922 2957500162
923 2957506104
924 2960590756
925 2960606227
926 2960619126
927 2960652572
928 2964608886
929 2964624563
930 2964636549
931 2964649720
932 2964655667
933 2964661256
934 2964678940
935 2964690247
936 2964715947
937 2964721757
938 2967668747
939 2967675056
940 2967685471
941 2967694162
942 2967709617
943 2967715960
944 2967722739
945 2967744198
946 2967750269
947 2967764723
948 2967770090
949 2970019950
950 2970043194
951 2970050283
952 2970060679
953 2970062965
954 2970077752
955 2970095118
956 2970099531
957 2970114031
958 2970119896
959 2970130797
960 2970137992
961 2970152659
962 2970158257
963 2970184759
964 2970194010
965 2977519904
966 2977525229
967 2977539298
968 2977558740
969 2977564255
970 2977575102
971 2977580622
972 8005543243
973 8005690484
974 8024501853

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01625

PMSR

Peptide methionine sulfoxide reductase

11

160

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2j89-assembly1.cif.gz_A functional and structural aspects of poplar cytosolic and plastidial type a methionine sulfoxide reductases 0.9562 9 152
1nwa-assembly1.cif.gz_A structure of mycobacterium tuberculosis methionine sulfoxide reductase a in complex with protein-bound methionine 0.9541 6 171
6yev-assembly4.cif.gz_D crystal structure of msra c206 and trx c35s complex from escherichia coli 0.9532 9 157
1ff3-assembly3.cif.gz_C structure of the peptide methionine sulfoxide reductase from escherichia coli 0.9502 9 151
4gwb-assembly1.cif.gz_A-2 crystal structure of putative peptide methionine sulfoxide reductase from sinorhizobium meliloti 1021 0.9495 10 172
ID Description Score Start End Superfamily
af_P0A086_1_166_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.9683 7 154 3.30.1060.10
af_P9WJM5_1_166_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.9572 9 171 3.30.1060.10
af_Q551H3_1_147_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.9553 10 152 3.30.1060.10
af_P0A084_1_166_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.9523 7 155 3.30.1060.10
af_Q5AD39_5_182_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.9422 8 164 3.30.1060.10
ID Description Score Start End GO Terms
AF-A0A4Q3HS60-F1-model_v4 deleted 0.9831 7 161
AF-A0A7C1YCT6-F1-model_v4 peptide-methionine (S)-S-oxide reductase (EC 1.8.4.11) 0.9817 7 162 GO:0008113
AF-K4QSG8-F1-model_v4 Peptide methionine sulfoxide reductase MsrA (Protein-methionine-S-oxide reductase) (EC 1.8.4.11) (Peptide-methionine (S)-S-oxide reductase) (Peptide Met(O) reductase) 0.9801 17 146 GO:0008113
GO:0033744
GO:0036211
AF-A0A524GBY9-F1-model_v4 peptide-methionine (S)-S-oxide reductase (EC 1.8.4.11) 0.9795 9 143 GO:0008113
GO:0033744
AF-A0A1F4BYR3-F1-model_v4 peptide-methionine (S)-S-oxide reductase (EC 1.8.4.11) 0.9791 9 155 GO:0008113

Map