F453393

General Info

Members Datasets Scaffolds Average Seq Length
487 229 974 92

Family's Representative Sequence

Representative Sequence 3300005327|Ga0070658_10333152|Ga0070658_103331522
Length 104
Sequence VITSATPLTPWENSCVCRNIKPLFNFDPPVTEEEVRAASLQFVRKISGFNKPSKSNEHAFLAAVDEIAGVSVRLLTSLETHAPPKNREEEAQKAKLRAAQRFGA

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
49 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
50 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
51 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
65 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
70 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
82 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
88 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
89 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
90 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
91 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
92 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
139 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
140 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
141 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
142 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
143 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
144 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
145 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
146 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
147 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
148 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
149 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
150 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
151 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
152 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
153 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
154 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
155 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
156 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
157 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
158 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
159 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
160 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
161 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
162 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
163 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
164 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
165 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
166 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
167 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
168 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
169 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
170 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
171 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
172 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
173 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
174 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
175 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
176 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
177 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
178 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
179 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
180 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
181 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
182 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
183 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
184 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
185 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
186 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
187 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
188 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
189 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
190 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
191 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
192 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
193 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
194 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
195 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
196 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
197 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
198 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
199 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
200 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
201 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
202 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
203 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
204 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
205 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
206 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
207 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
208 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
209 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
210 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
211 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
212 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
213 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
214 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
215 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
216 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
217 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
218 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
219 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
220 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
221 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
222 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
223 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
224 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
225 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
226 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
227 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
228 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
229 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.92
Metatranscriptomes 3.08
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.21
Nodule 0
Rhizoplane 1.23
Rhizosphere 95.07
Stem 0
Stem Tuber 0
Unclassified 22.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10333152 3300005327 Bacteria 1297
2 rootH2_10076688 3300003320 Bacteria 3110
3 rootH2_10131376 3300003320 Unclassified 1826
4 rootH1_10019471 3300003323 Bacteria 1849
5 Ga0058862_12885716 3300004803 Unclassified 938
6 Ga0070658_10897205 3300005327 Unclassified 771
7 Ga0070683_100011451 3300005329 Bacteria 7668
8 Ga0070683_100015740 3300005329 Bacteria 6648
9 Ga0070683_100051602 3300005329 Bacteria 3809
10 Ga0070670_100069062 3300005331 Unclassified 3033
11 Ga0068869_100035612 3300005334 Bacteria 3529
12 Ga0068869_101997524 3300005334 Unclassified 520
13 Ga0070680_100027031 3300005336 Bacteria 4593
14 Ga0070680_100072227 3300005336 Bacteria 2836
15 Ga0070680_100488726 3300005336 Bacteria 1053
16 Ga0068868_100028307 3300005338 Unclassified 4283
17 Ga0070660_100072201 3300005339 Bacteria 2696
18 Ga0070660_100549786 3300005339 Bacteria 963
19 Ga0070689_100125554 3300005340 Bacteria 2053
20 Ga0070691_10010588 3300005341 Bacteria 4211
21 Ga0070687_100447590 3300005343 Bacteria 858
22 Ga0070687_101195166 3300005343 Unclassified 560
23 Ga0070661_100004795 3300005344 Bacteria 9314
24 Ga0070661_100116276 3300005344 Bacteria 2000
25 Ga0070661_100405802 3300005344 Bacteria 1078
26 Ga0070661_100555533 3300005344 Unclassified 924
27 Ga0070675_100483190 3300005354 Unclassified 1114
28 Ga0070671_100307838 3300005355 Bacteria 1349
29 Ga0070671_100498582 3300005355 Bacteria 1047
30 Ga0070673_100108421 3300005364 Bacteria 2299
31 Ga0070659_100257689 3300005366 Bacteria 1447
32 Ga0070709_10105858 3300005434 Bacteria 1882
33 Ga0070709_10765853 3300005434 Unclassified 755
34 Ga0070714_100186362 3300005435 Bacteria 1891
35 Ga0070714_100239551 3300005435 Unclassified 1674
36 Ga0070713_100026344 3300005436 Unclassified 4563
37 Ga0070713_100434551 3300005436 Bacteria 1230
38 Ga0070710_10023499 3300005437 Bacteria 3242
39 Ga0070710_11230241 3300005437 Bacteria 554
40 Ga0070711_100042397 3300005439 Bacteria 3076
41 Ga0070711_101560667 3300005439 Bacteria 577
42 Ga0070663_100033250 3300005455 Bacteria 3561
43 Ga0070681_10012532 3300005458 Bacteria 8414
44 Ga0070681_10179111 3300005458 Bacteria 2041
45 Ga0070681_10389260 3300005458 Bacteria 1305
46 Ga0068867_100508823 3300005459 Unclassified 1036
47 Ga0070706_101424351 3300005467 Unclassified 634
48 Ga0070679_100018221 3300005530 Bacteria 6809
49 Ga0070679_100078065 3300005530 Bacteria 3300
50 Ga0070684_100013490 3300005535 Bacteria 6592
51 Ga0070684_100014136 3300005535 Bacteria 6456
52 Ga0070684_100017410 3300005535 Bacteria 5897
53 Ga0070684_100125035 3300005535 Bacteria 2316
54 Ga0070684_100323346 3300005535 Bacteria 1417
55 Ga0070684_100397156 3300005535 Bacteria 1271
56 Ga0070697_100047796 3300005536 Unclassified 3469
57 Ga0068853_100000119 3300005539 Bacteria 53488
58 Ga0068853_100037463 3300005539 Bacteria 4126
59 Ga0068853_100114491 3300005539 Bacteria 2399
60 Ga0068853_100131314 3300005539 Bacteria 2242
61 Ga0068853_100620222 3300005539 Bacteria 1028
62 Ga0068853_101471064 3300005539 Bacteria 659
63 Ga0070686_101583473 3300005544 Unclassified 554
64 Ga0070696_100183279 3300005546 Bacteria 1554
65 Ga0070693_100960290 3300005547 Bacteria 644
66 Ga0070665_100005407 3300005548 Bacteria 13177
67 Ga0070704_100453934 3300005549 Bacteria 1104
68 Ga0068855_100000589 3300005563 Bacteria 44536
69 Ga0068855_100053368 3300005563 Bacteria 4756
70 Ga0068855_100198335 3300005563 Bacteria 2261
71 Ga0070664_100138312 3300005564 Unclassified 2143
72 Ga0070664_101537117 3300005564 Unclassified 630
73 Ga0068857_100001079 3300005577 Bacteria 21112
74 Ga0068857_100007597 3300005577 Bacteria 9331
75 Ga0068857_100452192 3300005577 Unclassified 1201
76 Ga0068857_101014505 3300005577 Bacteria 799
77 Ga0068854_100083948 3300005578 Bacteria 2356
78 Ga0068856_100001598 3300005614 Bacteria 23676
79 Ga0068856_100007610 3300005614 Bacteria 10571
80 Ga0068856_100035233 3300005614 Bacteria 4904
81 Ga0068856_100545120 3300005614 Bacteria 1181
82 Ga0068856_100793188 3300005614 Unclassified 967
83 Ga0068856_101175867 3300005614 Bacteria 783
84 Ga0068852_100000025 3300005616 Bacteria 115410
85 Ga0068852_100000053 3300005616 Bacteria 79046
86 Ga0068852_100003646 3300005616 Bacteria 10786
87 Ga0068852_100105427 3300005616 Bacteria 2554
88 Ga0068852_100162848 3300005616 Bacteria 2084
89 Ga0068852_101254980 3300005616 Unclassified 762
90 Ga0068852_101655413 3300005616 Unclassified 662
91 Ga0068859_100072452 3300005617 Bacteria 3482
92 Ga0068859_100197838 3300005617 Bacteria 2094
93 Ga0068859_100487033 3300005617 Unclassified 1329
94 Ga0068859_101299075 3300005617 Bacteria 802
95 Ga0068864_100442922 3300005618 Bacteria 1241
96 Ga0068864_100735131 3300005618 Unclassified 966
97 Ga0068864_102417127 3300005618 Bacteria 532
98 Ga0068851_10044022 3300005834 Unclassified 2252
99 Ga0068851_10047998 3300005834 Bacteria 2163
100 Ga0068851_10336674 3300005834 Bacteria 875
101 Ga0068858_100097506 3300005842 Bacteria 2740
102 Ga0068858_100173740 3300005842 Unclassified 2033
103 Ga0068858_100792507 3300005842 Bacteria 924
104 Ga0068860_100954073 3300005843 Bacteria 875
105 Ga0070717_10190576 3300006028 Bacteria 1791
106 Ga0070717_10667149 3300006028 Unclassified 944
107 Ga0070715_10089753 3300006163 Bacteria 1412
108 Ga0070715_10971925 3300006163 Unclassified 527
109 Ga0070716_100236043 3300006173 Bacteria 1237
110 Ga0070716_100246824 3300006173 Bacteria 1214
111 Ga0070712_100045766 3300006175 Bacteria 3022
112 Ga0070712_100469989 3300006175 Bacteria 1050
113 Ga0097621_100054499 3300006237 Bacteria 3262
114 Ga0097621_100816012 3300006237 Bacteria 865
115 Ga0068871_100029606 3300006358 Bacteria 4302
116 Ga0068871_100836513 3300006358 Bacteria 850
117 Ga0075436_101386627 3300006914 Bacteria 533
118 Ga0097620_100072453 3300006931 Bacteria 3482
119 Ga0097620_100197836 3300006931 Bacteria 2094
120 Ga0097620_100487042 3300006931 Unclassified 1329
121 Ga0097620_101298956 3300006931 Bacteria 802
122 Ga0099795_10026350 3300007788 Bacteria 1958
123 Ga0105240_10000280 3300009093 Bacteria 100888
124 Ga0105240_10001293 3300009093 Bacteria 43254
125 Ga0105240_10012036 3300009093 Bacteria 11994
126 Ga0105240_10023371 3300009093 Bacteria 8176
127 Ga0105240_10072255 3300009093 Bacteria 4264
128 Ga0105240_10174777 3300009093 Unclassified 2540
129 Ga0105240_10236386 3300009093 Bacteria 2120
130 Ga0105245_10058479 3300009098 Bacteria 3470
131 Ga0105245_10085236 3300009098 Bacteria 2896
132 Ga0105245_12418331 3300009098 Bacteria 579
133 Ga0105247_10110668 3300009101 Bacteria 1768
134 Ga0105247_10553148 3300009101 Bacteria 846
135 Ga0105247_11827423 3300009101 Bacteria 506
136 Ga0105243_12308589 3300009148 Bacteria 576
137 Ga0105241_10000170 3300009174 Bacteria 47986
138 Ga0105241_10003203 3300009174 Bacteria 12180
139 Ga0105241_10004098 3300009174 Bacteria 10763
140 Ga0105241_10597275 3300009174 Bacteria 997
141 Ga0105241_10729949 3300009174 Bacteria 907
142 Ga0105242_10086150 3300009176 Bacteria 2636
143 Ga0105242_10161162 3300009176 Bacteria 1964
144 Ga0105242_10665827 3300009176 Bacteria 1014
145 Ga0105248_10001884 3300009177 Bacteria 23269
146 Ga0105248_10268351 3300009177 Bacteria 1921
147 Ga0105248_10726398 3300009177 Unclassified 1121
148 Ga0105248_12277037 3300009177 Unclassified 617
149 Ga0105248_12950377 3300009177 Unclassified 542
150 Ga0105237_10001051 3300009545 Bacteria 37069
151 Ga0105237_10002468 3300009545 Bacteria 22939
152 Ga0105237_10016587 3300009545 Bacteria 7651
153 Ga0105237_10029469 3300009545 Bacteria 5580
154 Ga0105237_10046506 3300009545 Bacteria 4365
155 Ga0105237_10595173 3300009545 Bacteria 1113
156 Ga0105238_10000296 3300009551 Bacteria 54882
157 Ga0105238_10005512 3300009551 Bacteria 12500
158 Ga0105238_10031537 3300009551 Bacteria 5396
159 Ga0105238_10136952 3300009551 Bacteria 2426
160 Ga0105238_10501108 3300009551 Bacteria 1215
161 Ga0105238_10812955 3300009551 Bacteria 951
162 Ga0105249_13234637 3300009553 Bacteria 524
163 Ga0105239_10001425 3300010375 Bacteria 31903
164 Ga0105239_10005790 3300010375 Bacteria 14418
165 Ga0105239_10006402 3300010375 Bacteria 13672
166 Ga0105239_10018773 3300010375 Bacteria 7639
167 Ga0105239_10363242 3300010375 Bacteria 1635
168 Ga0105239_11299809 3300010375 Unclassified 839
169 Ga0105239_13174637 3300010375 Bacteria 535
170 Ga0105246_10523545 3300011119 Bacteria 1011
171 Ga0157373_10522249 3300013100 Unclassified 859
172 Ga0157371_10066607 3300013102 Bacteria 2550
173 Ga0157371_10902427 3300013102 Bacteria 670
174 Ga0157370_10000012 3300013104 Bacteria 201181
175 Ga0157370_10055317 3300013104 Bacteria 3781
176 Ga0157370_10229253 3300013104 Bacteria 1719
177 Ga0157369_10000096 3300013105 Bacteria 121542
178 Ga0157369_10000595 3300013105 Bacteria 46959
179 Ga0157369_10002355 3300013105 Bacteria 22728
180 Ga0157369_10003654 3300013105 Bacteria 18257
181 Ga0157369_10030866 3300013105 Bacteria 5908
182 Ga0157369_10613947 3300013105 Unclassified 1122
183 Ga0157369_10849317 3300013105 Bacteria 937
184 Ga0157374_10005572 3300013296 Bacteria 10601
185 Ga0157374_10035858 3300013296 Unclassified 4540
186 Ga0157374_10427753 3300013296 Bacteria 1323
187 Ga0157378_10018658 3300013297 Bacteria 6099
188 Ga0157378_10030824 3300013297 Bacteria 4735
189 Ga0157378_10056416 3300013297 Bacteria 3500
190 Ga0157378_10507354 3300013297 Bacteria 1206
191 Ga0157378_10593070 3300013297 Unclassified 1118
192 Ga0163162_10109120 3300013306 Bacteria 2864
193 Ga0163162_10694469 3300013306 Bacteria 1139
194 Ga0157372_10000066 3300013307 Bacteria 113120
195 Ga0157372_10002221 3300013307 Bacteria 21060
196 Ga0157372_10037339 3300013307 Bacteria 5358
197 Ga0157372_10043971 3300013307 Unclassified 4947
198 Ga0157372_10051459 3300013307 Bacteria 4584
199 Ga0157372_10054342 3300013307 Unclassified 4467
200 Ga0157372_10701845 3300013307 Bacteria 1177
201 Ga0157372_13387007 3300013307 Bacteria 507
202 Ga0157375_10069681 3300013308 Bacteria 3524
203 Ga0163163_10084815 3300014325 Bacteria 3175
204 Ga0163163_10181700 3300014325 Bacteria 2151
205 Ga0163163_12209343 3300014325 Bacteria 609
206 Ga0157380_10540843 3300014326 Unclassified 1140
207 Ga0157376_10042622 3300014969 Bacteria 3721
208 Ga0157376_10150312 3300014969 Unclassified 2099
209 Ga0157376_12423379 3300014969 Unclassified 564
210 Ga0182007_10047626 3300015262 Bacteria 1417
211 Ga0197907_10088349 3300020069 Bacteria 1314
212 Ga0206356_10153564 3300020070 Bacteria 1297
213 Ga0206352_10604974 3300020078 Unclassified 777
214 Ga0206350_10121294 3300020080 Bacteria 4163
215 Ga0206350_10810932 3300020080 Bacteria 1080
216 Ga0206350_10880689 3300020080 Bacteria 1155
217 Ga0206353_11553564 3300020082 Unclassified 873
218 Ga0154015_1118116 3300020610 Unclassified 978
219 Ga0154015_1186407 3300020610 Bacteria 2395
220 Ga0213873_10080191 3300021358 Bacteria 912
221 Ga0213874_10050273 3300021377 Bacteria 1277
222 Ga0213874_10066604 3300021377 Unclassified 1140
223 Ga0213875_10115921 3300021388 Bacteria 1251
224 Ga0213875_10349325 3300021388 Bacteria 702
225 Ga0213871_10020763 3300021441 Bacteria 1631
226 Ga0224712_10048120 3300022467 Unclassified 1644
227 Ga0224712_10294646 3300022467 Unclassified 758
228 Ga0207656_10006720 3300025321 Bacteria 4155
229 Ga0207656_10129031 3300025321 Unclassified 1183
230 Ga0207656_10286081 3300025321 Bacteria 814
231 Ga0207692_10680867 3300025898 Bacteria 666
232 Ga0207710_10068626 3300025900 Bacteria 1621
233 Ga0207685_10039416 3300025905 Unclassified 1753
234 Ga0207699_10103280 3300025906 Bacteria 1813
235 Ga0207705_10173793 3300025909 Bacteria 1623
236 Ga0207684_11403996 3300025910 Unclassified 571
237 Ga0207654_10000189 3300025911 Bacteria 37996
238 Ga0207654_10011803 3300025911 Bacteria 4462
239 Ga0207654_10060821 3300025911 Bacteria 2208
240 Ga0207654_10079743 3300025911 Unclassified 1967
241 Ga0207654_10598964 3300025911 Bacteria 786
242 Ga0207654_10760332 3300025911 Bacteria 698
243 Ga0207707_10000698 3300025912 Bacteria 33306
244 Ga0207707_10274623 3300025912 Unclassified 1460
245 Ga0207707_10556819 3300025912 Bacteria 974
246 Ga0207707_10859495 3300025912 Bacteria 752
247 Ga0207695_10000028 3300025913 Bacteria 551835
248 Ga0207695_10000759 3300025913 Bacteria 61895
249 Ga0207695_10001101 3300025913 Bacteria 46990
250 Ga0207695_10001481 3300025913 Bacteria 39284
251 Ga0207695_10001613 3300025913 Bacteria 36581
252 Ga0207695_10079402 3300025913 Bacteria 3326
253 Ga0207695_10222438 3300025913 Unclassified 1795
254 Ga0207695_10226121 3300025913 Unclassified 1777
255 Ga0207695_10281788 3300025913 Bacteria 1556
256 Ga0207671_10000173 3300025914 Bacteria 99428
257 Ga0207671_10000187 3300025914 Bacteria 95484
258 Ga0207671_10010471 3300025914 Bacteria 7646
259 Ga0207671_10075330 3300025914 Bacteria 2524
260 Ga0207671_10179593 3300025914 Bacteria 1647
261 Ga0207671_10390245 3300025914 Bacteria 1106
262 Ga0207671_10548352 3300025914 Bacteria 922
263 Ga0207693_10019599 3300025915 Bacteria 5379
264 Ga0207693_10226112 3300025915 Bacteria 1470
265 Ga0207663_10080190 3300025916 Bacteria 2133
266 Ga0207663_10234675 3300025916 Bacteria 1342
267 Ga0207660_10070476 3300025917 Unclassified 2542
268 Ga0207660_10221901 3300025917 Bacteria 1484
269 Ga0207660_10662603 3300025917 Unclassified 851
270 Ga0207657_10168835 3300025919 Bacteria 1774
271 Ga0207649_10004452 3300025920 Bacteria 7605
272 Ga0207652_10004401 3300025921 Bacteria 11477
273 Ga0207652_10199837 3300025921 Unclassified 1799
274 Ga0207652_10377533 3300025921 Bacteria 1279
275 Ga0207652_10680081 3300025921 Unclassified 919
276 Ga0207694_10000174 3300025924 Bacteria 66687
277 Ga0207694_10003566 3300025924 Bacteria 12349
278 Ga0207694_10014703 3300025924 Bacteria 5901
279 Ga0207694_10163724 3300025924 Bacteria 1798
280 Ga0207694_10254695 3300025924 Bacteria 1437
281 Ga0207694_11705588 3300025924 Bacteria 530
282 Ga0207650_10804390 3300025925 Archaea 797
283 Ga0207659_10447147 3300025926 Unclassified 1088
284 Ga0207659_11804788 3300025926 Unclassified 519
285 Ga0207687_10034872 3300025927 Bacteria 3420
286 Ga0207687_10775636 3300025927 Bacteria 817
287 Ga0207687_11108182 3300025927 Bacteria 680
288 Ga0207700_10019179 3300025928 Unclassified 4616
289 Ga0207700_10119552 3300025928 Bacteria 2134
290 Ga0207664_10099818 3300025929 Bacteria 2396
291 Ga0207664_10109364 3300025929 Bacteria 2296
292 Ga0207644_10943512 3300025931 Bacteria 723
293 Ga0207690_10750485 3300025932 Bacteria 804
294 Ga0207686_10089145 3300025934 Unclassified 2033
295 Ga0207665_10101841 3300025939 Bacteria 2006
296 Ga0207665_10485840 3300025939 Bacteria 952
297 Ga0207711_10005604 3300025941 Bacteria 10611
298 Ga0207711_10479382 3300025941 Bacteria 1159
299 Ga0207689_10048087 3300025942 Bacteria 3519
300 Ga0207689_11194600 3300025942 Bacteria 640
301 Ga0207661_10033096 3300025944 Archaea 4010
302 Ga0207661_10035060 3300025944 Bacteria 3907
303 Ga0207661_10044036 3300025944 Bacteria 3525
304 Ga0207661_10110212 3300025944 Unclassified 2326
305 Ga0207661_11211508 3300025944 Unclassified 695
306 Ga0207661_11374196 3300025944 Bacteria 648
307 Ga0207661_11980411 3300025944 Bacteria 528
308 Ga0207679_10398772 3300025945 Bacteria 1210
309 Ga0207679_10764711 3300025945 Unclassified 879
310 Ga0207679_11395773 3300025945 Unclassified 643
311 Ga0207667_10000253 3300025949 Bacteria 75314
312 Ga0207667_10001049 3300025949 Bacteria 35167
313 Ga0207667_10004163 3300025949 Bacteria 17772
314 Ga0207667_10548477 3300025949 Bacteria 1169
315 Ga0207667_10790656 3300025949 Bacteria 946
316 Ga0207640_10073651 3300025981 Unclassified 2308
317 Ga0207677_10293798 3300026023 Bacteria 1340
318 Ga0207703_10039568 3300026035 Bacteria 3768
319 Ga0207703_10680380 3300026035 Bacteria 977
320 Ga0207639_10000062 3300026041 Bacteria 107537
321 Ga0207639_10014031 3300026041 Bacteria 5624
322 Ga0207639_10455418 3300026041 Bacteria 1162
323 Ga0207639_10468249 3300026041 Bacteria 1147
324 Ga0207678_10020203 3300026067 Bacteria 5847
325 Ga0207702_10007579 3300026078 Bacteria 9242
326 Ga0207702_10025247 3300026078 Unclassified 4930
327 Ga0207702_10048921 3300026078 Bacteria 3567
328 Ga0207702_10127576 3300026078 Unclassified 2286
329 Ga0207702_11693797 3300026078 Bacteria 625
330 Ga0207648_10137997 3300026089 Bacteria 2148
331 Ga0207676_10157497 3300026095 Bacteria 1964
332 Ga0207676_10490735 3300026095 Bacteria 1165
333 Ga0207676_12624125 3300026095 Unclassified 500
334 Ga0207674_10000097 3300026116 Bacteria 98549
335 Ga0207674_10000133 3300026116 Bacteria 87556
336 Ga0207674_10534493 3300026116 Unclassified 1133
337 Ga0207698_10000029 3300026142 Bacteria 116462
338 Ga0207698_10000181 3300026142 Bacteria 38658
339 Ga0207698_10023291 3300026142 Bacteria 4323
340 Ga0207698_10134512 3300026142 Bacteria 2119
341 Ga0207698_12049197 3300026142 Unclassified 586
342 Ga0209588_1020182 3300027671 Bacteria 2086
343 Ga0268266_10035557 3300028379 Bacteria 4238
344 Ga0268264_11275621 3300028381 Bacteria 745
345 Ga0265318_10254880 3300028577 Unclassified 640
346 Ga0265760_10011722 3300031090 Unclassified 2505
347 Ga0265330_10417893 3300031235 Bacteria 568
348 Ga0265332_10066893 3300031238 Bacteria 1532
349 Ga0265328_10090614 3300031239 Bacteria 1129
350 Ga0265328_10117298 3300031239 Bacteria 991
351 Ga0265320_10029009 3300031240 Bacteria 2867
352 Ga0265339_10000441 3300031249 Bacteria 32457
353 Ga0265331_10003725 3300031250 Bacteria 9691
354 Ga0265331_10038005 3300031250 Unclassified 2355
355 Ga0265331_10073205 3300031250 Bacteria 1600
356 Ga0265316_10073413 3300031344 Bacteria 2635
357 Ga0265313_10061979 3300031595 Bacteria 1748
358 Ga0316575_10147382 3300031665 Bacteria 970
359 Ga0265314_10000434 3300031711 Bacteria 55920
360 Ga0265314_10004667 3300031711 Bacteria 12588
361 Ga0265314_10334349 3300031711 Unclassified 839
362 Ga0265342_10050014 3300031712 Bacteria 2499
363 Ga0265342_10212188 3300031712 Bacteria 1046
364 Ga0307413_10978482 3300031824 Unclassified 724
365 Ga0307410_11715526 3300031852 Bacteria 557
366 Ga0307415_102492966 3300032126 Bacteria 509
367 Ga0373934_0000814 3300035086 Bacteria 11267
368 Ga0373934_0351153 3300035086 Bacteria 614
369 Ga0373923_0318765 3300035111 Bacteria 738
370 Ga0373923_0641364 3300035111 Unclassified 525
371 Ga0373945_0076892 3300035116 Bacteria 1273
372 Ga0373953_0032142 3300035117 Bacteria 2045
373 Ga0373953_0133882 3300035117 Bacteria 1058
374 Ga0373954_0020166 3300035118 Bacteria 3013
375 Ga0373954_0266273 3300035118 Unclassified 844
376 Ga0373957_0107974 3300035120 Unclassified 1119
377 Ga0373957_0438442 3300035120 Bacteria 565
378 Ga0373943_0411343 3300035170 Unclassified 782
379 Ga0373946_0568354 3300035171 Bacteria 586
380 Ga0373955_0007769 3300035172 Bacteria 4943
381 Ga0373924_0145897 3300035410 Bacteria 1034
382 Ga0373935_0851018 3300035692 Bacteria 674
383 Ga0373927_0001132 3300035695 Bacteria 20177
384 Ga0373927_0382825 3300035695 Unclassified 928
385 Ga0373927_0532292 3300035695 Bacteria 777
386 Ga0373933_0162916 3300035724 Bacteria 1417
387 Ga0373933_0661570 3300035724 Bacteria 687
388 Ga0373947_0371670 3300035725 Bacteria 961
389 Ga0373947_0380887 3300035725 Bacteria 950
390 Ga0373937_0035454 3300036401 Unclassified 4541
391 Ga0373937_0042056 3300036401 Bacteria 4170
392 Ga0373937_0744728 3300036401 Bacteria 927
393 Ga0373937_0755328 3300036401 Bacteria 920
394 Ga0373937_1907922 3300036401 Unclassified 540
395 Ga0316584_0301530 3300036712 Unclassified 1160
396 Ga0373925_0022653 3300037068 Bacteria 4583
397 Ga0395899_0810523 3300037312 Bacteria 578
398 Ga0395898_0288076 3300037466 Bacteria 1567
399 Ga0436364_0447990 3300037853 Bacteria 1955
400 Ga0436364_0868234 3300037853 Bacteria 2532
401 Ga0436364_0890864 3300037853 Bacteria 67172
402 Ga0395901_1524099 3300038443 Unclassified 624
403 Ga0436365_1090602 3300039437 Unclassified 824
404 Ga0436360_0060713 3300039438 Bacteria 6633
405 Ga0436361_0169832 3300039447 Unclassified 900
406 Ga0436361_1020074 3300039447 Bacteria 4738
407 Ga0436363_0351844 3300039450 Unclassified 1502
408 Ga0436363_0498587 3300039450 Unclassified 4286
409 Ga0436363_0540794 3300039450 Bacteria 1517
410 Ga0436363_1246516 3300039450 Bacteria 1540
411 Ga0436363_1349957 3300039450 Unclassified 2303
412 Ga0436362_0360155 3300039453 Bacteria 1301
413 Ga0436362_0441409 3300039453 Unclassified 731
414 Ga0436362_1033448 3300039453 Unclassified 1934
415 Ga0451839_1057874 3300041496 Unclassified 651
416 Ga0466963_0000988 3300044694 Bacteria 14650
417 Ga0453684_2147922 3300044712 Bacteria 559
418 Ga0466957_0338286 3300044842 Unclassified 1019
419 Ga0466957_0501126 3300044842 Unclassified 842
420 Ga0466959_0852859 3300045049 Bacteria 608
421 Ga0451576_0768410 3300045051 Bacteria 1012
422 Ga0451576_1276620 3300045051 Bacteria 766
423 Ga0466958_0178877 3300045836 Bacteria 1346
424 Ga0466958_0333330 3300045836 Bacteria 976
425 Ga0466967_0007272 3300045976 Bacteria 7967
426 Ga0466967_0015202 3300045976 Bacteria 6027
427 Ga0495592_0009301 3300046454 Bacteria 7391
428 Ga0495592_0129398 3300046454 Bacteria 1767
429 Ga0495651_0030099 3300046462 Bacteria 4233
430 Ga0495651_0060957 3300046462 Bacteria 2888
431 Ga0495651_0193386 3300046462 Bacteria 1430
432 Ga0495580_0134228 3300046472 Bacteria 1716
433 Ga0495580_0566628 3300046472 Unclassified 753
434 Ga0495582_0001867 3300046473 Bacteria 11888
435 Ga0495662_0178884 3300046476 Bacteria 1045
436 Ga0495664_0027116 3300046477 Bacteria 3339
437 Ga0495664_0079538 3300046477 Bacteria 1965
438 Ga0495594_0016511 3300046499 Bacteria 3890
439 Ga0495608_0047792 3300046511 Bacteria 2844
440 Ga0495618_0054869 3300046514 Bacteria 2523
441 Ga0495628_0055965 3300046516 Bacteria 3106
442 Ga0495628_0867104 3300046516 Unclassified 628
443 Ga0495630_0118416 3300046517 Bacteria 2008
444 Ga0495652_0029610 3300046529 Bacteria 4809
445 Ga0495665_0019496 3300046531 Bacteria 3648
446 Ga0495665_0202409 3300046531 Bacteria 1029
447 Ga0495640_0690497 3300046533 Unclassified 613
448 Ga0495586_0081670 3300046535 Bacteria 1776
449 Ga0495587_0005152 3300046536 Bacteria 8546
450 Ga0495645_0014141 3300046543 Bacteria 5657
451 Ga0495645_0416962 3300046543 Bacteria 853
452 Ga0495645_0882521 3300046543 Bacteria 532
453 Ga0495667_0031996 3300046559 Bacteria 3528
454 Ga0495667_0036476 3300046559 Bacteria 3282
455 Ga0495667_1001661 3300046559 Bacteria 510
456 Ga0495634_0059687 3300046642 Unclassified 2540
457 Ga0495634_0510430 3300046642 Unclassified 704
458 Ga0495635_0131763 3300046663 Bacteria 1704
459 Ga0495635_1089441 3300046663 Unclassified 506
460 Ga0495657_0722000 3300046675 Bacteria 572
461 Ga0495599_0341844 3300046678 Bacteria 898
462 Ga0495623_0049112 3300046679 Bacteria 2674
463 Ga0495623_0210810 3300046679 Bacteria 1112
464 Ga0495646_0525214 3300046680 Bacteria 606
465 Ga0495658_0133888 3300046683 Bacteria 1511
466 Ga0495581_0088457 3300047315 Bacteria 1796
467 Ga0495674_0083572 3300047319 Bacteria 2736
468 Ga0495674_1381527 3300047319 Unclassified 525
469 Ga0495680_0247862 3300047322 Bacteria 1263
470 Ga0495675_0061694 3300047444 Bacteria 2375
471 Ga0495684_0121941 3300047471 Bacteria 1962
472 Ga0495684_0138373 3300047471 Bacteria 1826
473 Ga0495602_0007078 3300048088 Bacteria 11775
474 Ga0495602_0311057 3300048088 Bacteria 1149
475 Ga0495614_0248813 3300048089 Bacteria 813
476 Ga0496102_0532834 3300048905 Bacteria 1097
477 Ga0496104_0051214 3300048907 Unclassified 3897
478 Ga0496104_1605965 3300048907 Bacteria 553
479 Ga0496112_0629370 3300048915 Unclassified 1004
480 Ga0496113_0682908 3300048916 Unclassified 820
481 Ga0496114_1520950 3300048917 Unclassified 557
482 nmdc:mga08x19_1241822_c1 3300050514 Unclassified 528
483 Ga0495619_0441483 3300053085 Unclassified 897
484 Ga0495619_0701705 3300053085 Bacteria 688
485 Ga0500604_0272989 3300053151 Bacteria 586
486 Ga0587083_0075022 3300059505 Bacteria 793
487 Ga0587076_065003 3300059645 Bacteria 744
488 Ga0070658_10333152
489 rootH2_10076688
490 rootH2_10131376
491 rootH1_10019471
492 Ga0058862_12885716
493 Ga0070658_10897205
494 Ga0070683_100011451
495 Ga0070683_100015740
496 Ga0070683_100051602
497 Ga0070670_100069062
498 Ga0068869_100035612
499 Ga0068869_101997524
500 Ga0070680_100027031
501 Ga0070680_100072227
502 Ga0070680_100488726
503 Ga0068868_100028307
504 Ga0070660_100072201
505 Ga0070660_100549786
506 Ga0070689_100125554
507 Ga0070691_10010588
508 Ga0070687_100447590
509 Ga0070687_101195166
510 Ga0070661_100004795
511 Ga0070661_100116276
512 Ga0070661_100405802
513 Ga0070661_100555533
514 Ga0070675_100483190
515 Ga0070671_100307838
516 Ga0070671_100498582
517 Ga0070673_100108421
518 Ga0070659_100257689
519 Ga0070709_10105858
520 Ga0070709_10765853
521 Ga0070714_100186362
522 Ga0070714_100239551
523 Ga0070713_100026344
524 Ga0070713_100434551
525 Ga0070710_10023499
526 Ga0070710_11230241
527 Ga0070711_100042397
528 Ga0070711_101560667
529 Ga0070663_100033250
530 Ga0070681_10012532
531 Ga0070681_10179111
532 Ga0070681_10389260
533 Ga0068867_100508823
534 Ga0070706_101424351
535 Ga0070679_100018221
536 Ga0070679_100078065
537 Ga0070684_100013490
538 Ga0070684_100014136
539 Ga0070684_100017410
540 Ga0070684_100125035
541 Ga0070684_100323346
542 Ga0070684_100397156
543 Ga0070697_100047796
544 Ga0068853_100000119
545 Ga0068853_100037463
546 Ga0068853_100114491
547 Ga0068853_100131314
548 Ga0068853_100620222
549 Ga0068853_101471064
550 Ga0070686_101583473
551 Ga0070696_100183279
552 Ga0070693_100960290
553 Ga0070665_100005407
554 Ga0070704_100453934
555 Ga0068855_100000589
556 Ga0068855_100053368
557 Ga0068855_100198335
558 Ga0070664_100138312
559 Ga0070664_101537117
560 Ga0068857_100001079
561 Ga0068857_100007597
562 Ga0068857_100452192
563 Ga0068857_101014505
564 Ga0068854_100083948
565 Ga0068856_100001598
566 Ga0068856_100007610
567 Ga0068856_100035233
568 Ga0068856_100545120
569 Ga0068856_100793188
570 Ga0068856_101175867
571 Ga0068852_100000025
572 Ga0068852_100000053
573 Ga0068852_100003646
574 Ga0068852_100105427
575 Ga0068852_100162848
576 Ga0068852_101254980
577 Ga0068852_101655413
578 Ga0068859_100072452
579 Ga0068859_100197838
580 Ga0068859_100487033
581 Ga0068859_101299075
582 Ga0068864_100442922
583 Ga0068864_100735131
584 Ga0068864_102417127
585 Ga0068851_10044022
586 Ga0068851_10047998
587 Ga0068851_10336674
588 Ga0068858_100097506
589 Ga0068858_100173740
590 Ga0068858_100792507
591 Ga0068860_100954073
592 Ga0070717_10190576
593 Ga0070717_10667149
594 Ga0070715_10089753
595 Ga0070715_10971925
596 Ga0070716_100236043
597 Ga0070716_100246824
598 Ga0070712_100045766
599 Ga0070712_100469989
600 Ga0097621_100054499
601 Ga0097621_100816012
602 Ga0068871_100029606
603 Ga0068871_100836513
604 Ga0075436_101386627
605 Ga0097620_100072453
606 Ga0097620_100197836
607 Ga0097620_100487042
608 Ga0097620_101298956
609 Ga0099795_10026350
610 Ga0105240_10000280
611 Ga0105240_10001293
612 Ga0105240_10012036
613 Ga0105240_10023371
614 Ga0105240_10072255
615 Ga0105240_10174777
616 Ga0105240_10236386
617 Ga0105245_10058479
618 Ga0105245_10085236
619 Ga0105245_12418331
620 Ga0105247_10110668
621 Ga0105247_10553148
622 Ga0105247_11827423
623 Ga0105243_12308589
624 Ga0105241_10000170
625 Ga0105241_10003203
626 Ga0105241_10004098
627 Ga0105241_10597275
628 Ga0105241_10729949
629 Ga0105242_10086150
630 Ga0105242_10161162
631 Ga0105242_10665827
632 Ga0105248_10001884
633 Ga0105248_10268351
634 Ga0105248_10726398
635 Ga0105248_12277037
636 Ga0105248_12950377
637 Ga0105237_10001051
638 Ga0105237_10002468
639 Ga0105237_10016587
640 Ga0105237_10029469
641 Ga0105237_10046506
642 Ga0105237_10595173
643 Ga0105238_10000296
644 Ga0105238_10005512
645 Ga0105238_10031537
646 Ga0105238_10136952
647 Ga0105238_10501108
648 Ga0105238_10812955
649 Ga0105249_13234637
650 Ga0105239_10001425
651 Ga0105239_10005790
652 Ga0105239_10006402
653 Ga0105239_10018773
654 Ga0105239_10363242
655 Ga0105239_11299809
656 Ga0105239_13174637
657 Ga0105246_10523545
658 Ga0157373_10522249
659 Ga0157371_10066607
660 Ga0157371_10902427
661 Ga0157370_10000012
662 Ga0157370_10055317
663 Ga0157370_10229253
664 Ga0157369_10000096
665 Ga0157369_10000595
666 Ga0157369_10002355
667 Ga0157369_10003654
668 Ga0157369_10030866
669 Ga0157369_10613947
670 Ga0157369_10849317
671 Ga0157374_10005572
672 Ga0157374_10035858
673 Ga0157374_10427753
674 Ga0157378_10018658
675 Ga0157378_10030824
676 Ga0157378_10056416
677 Ga0157378_10507354
678 Ga0157378_10593070
679 Ga0163162_10109120
680 Ga0163162_10694469
681 Ga0157372_10000066
682 Ga0157372_10002221
683 Ga0157372_10037339
684 Ga0157372_10043971
685 Ga0157372_10051459
686 Ga0157372_10054342
687 Ga0157372_10701845
688 Ga0157372_13387007
689 Ga0157375_10069681
690 Ga0163163_10084815
691 Ga0163163_10181700
692 Ga0163163_12209343
693 Ga0157380_10540843
694 Ga0157376_10042622
695 Ga0157376_10150312
696 Ga0157376_12423379
697 Ga0182007_10047626
698 Ga0197907_10088349
699 Ga0206356_10153564
700 Ga0206352_10604974
701 Ga0206350_10121294
702 Ga0206350_10810932
703 Ga0206350_10880689
704 Ga0206353_11553564
705 Ga0154015_1118116
706 Ga0154015_1186407
707 Ga0213873_10080191
708 Ga0213874_10050273
709 Ga0213874_10066604
710 Ga0213875_10115921
711 Ga0213875_10349325
712 Ga0213871_10020763
713 Ga0224712_10048120
714 Ga0224712_10294646
715 Ga0207656_10006720
716 Ga0207656_10129031
717 Ga0207656_10286081
718 Ga0207692_10680867
719 Ga0207710_10068626
720 Ga0207685_10039416
721 Ga0207699_10103280
722 Ga0207705_10173793
723 Ga0207684_11403996
724 Ga0207654_10000189
725 Ga0207654_10011803
726 Ga0207654_10060821
727 Ga0207654_10079743
728 Ga0207654_10598964
729 Ga0207654_10760332
730 Ga0207707_10000698
731 Ga0207707_10274623
732 Ga0207707_10556819
733 Ga0207707_10859495
734 Ga0207695_10000028
735 Ga0207695_10000759
736 Ga0207695_10001101
737 Ga0207695_10001481
738 Ga0207695_10001613
739 Ga0207695_10079402
740 Ga0207695_10222438
741 Ga0207695_10226121
742 Ga0207695_10281788
743 Ga0207671_10000173
744 Ga0207671_10000187
745 Ga0207671_10010471
746 Ga0207671_10075330
747 Ga0207671_10179593
748 Ga0207671_10390245
749 Ga0207671_10548352
750 Ga0207693_10019599
751 Ga0207693_10226112
752 Ga0207663_10080190
753 Ga0207663_10234675
754 Ga0207660_10070476
755 Ga0207660_10221901
756 Ga0207660_10662603
757 Ga0207657_10168835
758 Ga0207649_10004452
759 Ga0207652_10004401
760 Ga0207652_10199837
761 Ga0207652_10377533
762 Ga0207652_10680081
763 Ga0207694_10000174
764 Ga0207694_10003566
765 Ga0207694_10014703
766 Ga0207694_10163724
767 Ga0207694_10254695
768 Ga0207694_11705588
769 Ga0207650_10804390
770 Ga0207659_10447147
771 Ga0207659_11804788
772 Ga0207687_10034872
773 Ga0207687_10775636
774 Ga0207687_11108182
775 Ga0207700_10019179
776 Ga0207700_10119552
777 Ga0207664_10099818
778 Ga0207664_10109364
779 Ga0207644_10943512
780 Ga0207690_10750485
781 Ga0207686_10089145
782 Ga0207665_10101841
783 Ga0207665_10485840
784 Ga0207711_10005604
785 Ga0207711_10479382
786 Ga0207689_10048087
787 Ga0207689_11194600
788 Ga0207661_10033096
789 Ga0207661_10035060
790 Ga0207661_10044036
791 Ga0207661_10110212
792 Ga0207661_11211508
793 Ga0207661_11374196
794 Ga0207661_11980411
795 Ga0207679_10398772
796 Ga0207679_10764711
797 Ga0207679_11395773
798 Ga0207667_10000253
799 Ga0207667_10001049
800 Ga0207667_10004163
801 Ga0207667_10548477
802 Ga0207667_10790656
803 Ga0207640_10073651
804 Ga0207677_10293798
805 Ga0207703_10039568
806 Ga0207703_10680380
807 Ga0207639_10000062
808 Ga0207639_10014031
809 Ga0207639_10455418
810 Ga0207639_10468249
811 Ga0207678_10020203
812 Ga0207702_10007579
813 Ga0207702_10025247
814 Ga0207702_10048921
815 Ga0207702_10127576
816 Ga0207702_11693797
817 Ga0207648_10137997
818 Ga0207676_10157497
819 Ga0207676_10490735
820 Ga0207676_12624125
821 Ga0207674_10000097
822 Ga0207674_10000133
823 Ga0207674_10534493
824 Ga0207698_10000029
825 Ga0207698_10000181
826 Ga0207698_10023291
827 Ga0207698_10134512
828 Ga0207698_12049197
829 Ga0209588_1020182
830 Ga0268266_10035557
831 Ga0268264_11275621
832 Ga0265318_10254880
833 Ga0265760_10011722
834 Ga0265330_10417893
835 Ga0265332_10066893
836 Ga0265328_10090614
837 Ga0265328_10117298
838 Ga0265320_10029009
839 Ga0265339_10000441
840 Ga0265331_10003725
841 Ga0265331_10038005
842 Ga0265331_10073205
843 Ga0265316_10073413
844 Ga0265313_10061979
845 Ga0316575_10147382
846 Ga0265314_10000434
847 Ga0265314_10004667
848 Ga0265314_10334349
849 Ga0265342_10050014
850 Ga0265342_10212188
851 Ga0307413_10978482
852 Ga0307410_11715526
853 Ga0307415_102492966
854 Ga0373934_0000814
855 Ga0373934_0351153
856 Ga0373923_0318765
857 Ga0373923_0641364
858 Ga0373945_0076892
859 Ga0373953_0032142
860 Ga0373953_0133882
861 Ga0373954_0020166
862 Ga0373954_0266273
863 Ga0373957_0107974
864 Ga0373957_0438442
865 Ga0373943_0411343
866 Ga0373946_0568354
867 Ga0373955_0007769
868 Ga0373924_0145897
869 Ga0373935_0851018
870 Ga0373927_0001132
871 Ga0373927_0382825
872 Ga0373927_0532292
873 Ga0373933_0162916
874 Ga0373933_0661570
875 Ga0373947_0371670
876 Ga0373947_0380887
877 Ga0373937_0035454
878 Ga0373937_0042056
879 Ga0373937_0744728
880 Ga0373937_0755328
881 Ga0373937_1907922
882 Ga0316584_0301530
883 Ga0373925_0022653
884 Ga0395899_0810523
885 Ga0395898_0288076
886 Ga0436364_0447990
887 Ga0436364_0868234
888 Ga0436364_0890864
889 Ga0395901_1524099
890 Ga0436365_1090602
891 Ga0436360_0060713
892 Ga0436361_0169832
893 Ga0436361_1020074
894 Ga0436363_0351844
895 Ga0436363_0498587
896 Ga0436363_0540794
897 Ga0436363_1246516
898 Ga0436363_1349957
899 Ga0436362_0360155
900 Ga0436362_0441409
901 Ga0436362_1033448
902 Ga0451839_1057874
903 Ga0466963_0000988
904 Ga0453684_2147922
905 Ga0466957_0338286
906 Ga0466957_0501126
907 Ga0466959_0852859
908 Ga0451576_0768410
909 Ga0451576_1276620
910 Ga0466958_0178877
911 Ga0466958_0333330
912 Ga0466967_0007272
913 Ga0466967_0015202
914 Ga0495592_0009301
915 Ga0495592_0129398
916 Ga0495651_0030099
917 Ga0495651_0060957
918 Ga0495651_0193386
919 Ga0495580_0134228
920 Ga0495580_0566628
921 Ga0495582_0001867
922 Ga0495662_0178884
923 Ga0495664_0027116
924 Ga0495664_0079538
925 Ga0495594_0016511
926 Ga0495608_0047792
927 Ga0495618_0054869
928 Ga0495628_0055965
929 Ga0495628_0867104
930 Ga0495630_0118416
931 Ga0495652_0029610
932 Ga0495665_0019496
933 Ga0495665_0202409
934 Ga0495640_0690497
935 Ga0495586_0081670
936 Ga0495587_0005152
937 Ga0495645_0014141
938 Ga0495645_0416962
939 Ga0495645_0882521
940 Ga0495667_0031996
941 Ga0495667_0036476
942 Ga0495667_1001661
943 Ga0495634_0059687
944 Ga0495634_0510430
945 Ga0495635_0131763
946 Ga0495635_1089441
947 Ga0495657_0722000
948 Ga0495599_0341844
949 Ga0495623_0049112
950 Ga0495623_0210810
951 Ga0495646_0525214
952 Ga0495658_0133888
953 Ga0495581_0088457
954 Ga0495674_0083572
955 Ga0495674_1381527
956 Ga0495680_0247862
957 Ga0495675_0061694
958 Ga0495684_0121941
959 Ga0495684_0138373
960 Ga0495602_0007078
961 Ga0495602_0311057
962 Ga0495614_0248813
963 Ga0496102_0532834
964 Ga0496104_0051214
965 Ga0496104_1605965
966 Ga0496112_0629370
967 Ga0496113_0682908
968 Ga0496114_1520950
969 nmdc:mga08x19_1241822_c1
970 Ga0495619_0441483
971 Ga0495619_0701705
972 Ga0500604_0272989
973 Ga0587083_0075022
974 Ga0587076_065003

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10041

DUF2277

Uncharacterized conserved protein (DUF2277)

16

93

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
5wi4-assembly1.cif.gz_C crystal structure of dynlt1/tctex-1 in complex with arhgef2 0.6511 15 61
5wi4-assembly1.cif.gz_A crystal structure of dynlt1/tctex-1 in complex with arhgef2 0.6492 15 61
5wi4-assembly1.cif.gz_B crystal structure of dynlt1/tctex-1 in complex with arhgef2 0.6469 15 61
8j07-assembly1.cif.gz_n8 96nm repeat of human respiratory doublet microtubule and associated axonemal complexes 0.6439 15 61
5hxl-assembly1.cif.gz_A-2 structure based function annotation of a hypothetical protein mgg_01005 related to the development of rice blast fungus 0.5985 15 69
ID Description Score Start End Superfamily
af_Q94AC8_62_254_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8085 15 55 3.40.630.30
af_K7MMN4_29_89_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.758 15 57 1.10.10.60
af_Q6TGT3_15_113_3.30.1140.40 Alpha Beta;2-Layer Sandwich;Ribosomal protein S3 C-terminal domain;Tctex-1 0.6317 18 56 3.30.1140.40
af_Q22226_44_143_3.30.1140.40 Alpha Beta;2-Layer Sandwich;Ribosomal protein S3 C-terminal domain;Tctex-1 0.5926 18 64 3.30.1140.40
af_Q94255_26_115_1.10.225.10 Mainly Alpha;Orthogonal Bundle;NK-Lysin;Saposin-like 0.5544 17 82 1.10.225.10
ID Description Score Start End GO Terms
AF-A0A561UPG7-F1-model_v4 Uncharacterized protein DUF2277 0.9892 15 67
AF-A0A1I1YSE1-F1-model_v4 Uncharacterized conserved protein 0.9892 17 67
AF-A0A327TKT2-F1-model_v4 Uncharacterized protein DUF2277 0.983 16 67
AF-A0A1C6PQF1-F1-model_v4 DUF2277 domain-containing protein 0.9746 15 67
AF-A0A3E0HAY8-F1-model_v4 DUF2277 family protein 0.9733 15 67

Map