F453377

General Info

Members Datasets Scaffolds Average Seq Length
486 316 972 315

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|8033684223|8033686948
Length 361
Sequence VVWFVLIAVLWTGYFFLEGFDFGVGVLTRVLARNRAERRVLINTIGPVWDGNEVWLLTAGGATFAAFPDWYATLFSGFYLPLLLILVCLIIRGVAFEYRAKRPEEHWQRNWELAIFWASLLPAFLWGVAFANIVRGVQIGPDKEYVGDVFDLLNPFALLGGLVTLFLFTFHGAVFTALKTVGDIRRRARRLATVLGTATAALALGFLLWLQTDTGDGRSLVTLIAAVAALFCAIGAVAAGREGWSFLYSGVTIIATVATLFLALYPDVMPSSLNPAWSLTAENASSTPYTLKIMTWCAGIATPVVLLYQGWTYWVFRKRIGTQHLAPEAHAAVAAGGSGADGPPAADGAGADGTGTGGAGR

Samples

Sample ID Description Type Environment
1 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
4 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
5 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
6 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
7 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
8 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
9 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
10 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
11 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
12 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
13 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
14 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
15 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
16 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
17 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
18 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
19 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
20 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
21 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
22 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
23 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
24 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
25 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
26 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
32 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
33 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
35 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
36 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
37 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
38 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
39 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
40 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
41 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
42 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
43 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
44 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
45 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
46 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
47 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
48 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
49 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
50 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
51 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
52 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
53 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
54 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
55 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
56 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
57 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
58 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
59 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
60 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
61 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
62 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
63 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
64 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
65 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
66 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
67 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
68 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
69 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
70 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
71 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
72 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
73 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
74 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
75 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
76 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
77 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
78 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
79 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
80 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
81 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
82 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
83 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
84 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
85 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
86 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
87 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
88 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
89 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
90 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
91 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
92 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
93 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
94 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
95 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
96 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
97 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
98 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
99 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
100 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
101 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
102 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
103 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
104 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
105 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
106 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
107 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
108 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
109 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
110 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
111 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
112 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
113 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
114 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
115 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
116 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
117 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
118 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
119 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
120 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
121 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
122 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
123 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
124 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
125 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
126 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
127 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
128 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
129 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
130 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
131 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
132 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
133 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
134 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
135 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
136 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
137 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
138 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
139 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
140 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
141 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
142 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
143 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
144 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
145 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
146 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
147 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
148 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
149 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
150 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
151 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
152 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
153 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
154 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
155 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
156 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
157 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
158 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
159 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
160 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
161 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
162 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
163 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
164 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
165 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
166 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
167 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
181 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
182 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
183 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
184 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
185 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
188 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
189 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
190 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
191 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
192 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
193 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
194 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
195 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
196 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
197 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
198 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
199 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
200 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
201 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
202 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
203 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
204 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
205 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
206 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
207 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
208 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
209 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
210 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
211 2563366752 Paenibacillus pini JCM 16418 Isolate Rhizosphere
212 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
213 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
214 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
215 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
216 2643221647 Streptomyces sp. Root369 Isolate Unclassified
217 2643221670 Streptomyces sp. Root431 Isolate Unclassified
218 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
219 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
220 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
221 2643221714 Streptomyces sp. Root264 Isolate Unclassified
222 2721755693 Paenibacillus polymyxa YC0573 Isolate Rhizosphere
223 2728369359 Paenibacillus polymyxa YC0136 Isolate Rhizosphere
224 2751185905 Paenibacillus kribbensis 6hRe76 Isolate Unclassified
225 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
226 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
227 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
228 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
229 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
230 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
231 2802428803 Paenibacillus peoriae NMA1017 Isolate Rhizosphere
232 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
233 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
234 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
235 2808606448 Streptomyces sp. 193411 Isolate Unclassified
236 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
237 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
238 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
239 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
240 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
241 2858438669 Leuconostoc mesenteroides YL48 Isolate Unclassified
242 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
243 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
244 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
245 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
246 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
247 2862574272 Streptomyces sp. AcE210 Isolate Nodule
248 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
249 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
250 2867369537 Streptomyces sp. Z26 Isolate Unclassified
251 2867428634 Streptomyces sp. RP5T Isolate Unclassified
252 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
253 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
254 2881633906 Lactiplantibacillus garii FI11369 Isolate Unclassified
255 2889276214 Paenibacillus sp. PvR133 Isolate Rhizosphere
256 2904595352 Paenibacillus sp. 1182 Isolate Unclassified
257 2907202186 Paenibacillus sp. HJL G12 Isolate Unclassified
258 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
259 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
260 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
261 2919160200 Paenibacillus sp. 2003 Isolate Unclassified
262 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
263 2928519762 Leuconostoc citreum 1377 Isolate Rhizosphere
264 2939615513 Lactococcus lactis 1925 Isolate Rhizosphere
265 2939702853 Paenibacillus sp. PvR008 Isolate Rhizosphere
266 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
267 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
268 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
269 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
270 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
271 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
272 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
273 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
274 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
275 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
276 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
277 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
278 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
279 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
280 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
281 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
282 2984527788 Paenibacillus sp. SORGH_AS306 Isolate Aerial Root
283 2984532647 Paenibacillus sp. SORGH_AS338 Isolate Aerial Root
284 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
285 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
286 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
287 2996706504 Paenibacillus sp. OT2-17 Isolate Rhizosphere
288 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
289 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
290 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
291 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
292 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
293 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
294 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
295 648028048 Paenibacillus polymyxa E681 Isolate Rhizosphere
296 8007371054 Clostridium sp. YIM B02515 Isolate Unclassified
297 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
298 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
299 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
300 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
301 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
302 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
303 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
304 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
305 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
306 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
307 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
308 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
309 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
310 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
311 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
312 8054795415 Paenibacillus periandrae PM10 Isolate Nodule
313 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
314 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
315 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere
316 8057977335 Paenibacillus oenotherae DT7-4 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 76.95
Metatranscriptomes 0.41
Isolates 22.63

Biome Distribution

Category Percentage (%)
Aerial Root 0.41
Bulb 0
Endosphere 4.94
Nodule 1.23
Rhizoplane 1.44
Rhizosphere 73.66
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10036822 3300001989 Bacteria 1651
2 JGI24737J22298_10008205 3300001990 Bacteria 3504
3 JGI25162J39368_1007948 3300002737 Bacteria 1576
4 Ga0006562J51391_1009724 3300003578 Bacteria 4689
5 Ga0006562J51391_1011898 3300003578 Bacteria 3199
6 Ga0055541_1000231 3300003841 Bacteria 21251
7 Ga0070665_100152182 3300005548 Bacteria 2316
8 Ga0068855_100367530 3300005563 Bacteria 1582
9 Ga0075368_10001223 3300006042 Bacteria 8116
10 Ga0075367_10005968 3300006178 Bacteria 6116
11 Ga0079104_1000084 3300006946 Bacteria 136884
12 Ga0105251_10015248 3300009011 Bacteria 4210
13 Ga0105244_10138960 3300009036 Bacteria 1169
14 Ga0105245_10190777 3300009098 Bacteria 1963
15 Ga0105247_10141222 3300009101 Bacteria 1578
16 Ga0105239_10524368 3300010375 Bacteria 1348
17 Ga0105246_10000694 3300011119 Bacteria 18971
18 Ga0157369_10100731 3300013105 Bacteria 3079
19 Ga0157375_10193075 3300013308 Bacteria 2191
20 Ga0182008_10002519 3300014497 Bacteria 11416
21 Ga0157376_10192808 3300014969 Bacteria 1870
22 Ga0182007_10008909 3300015262 Bacteria 4088
23 Ga0183367_1008 3300015688 Bacteria 490626
24 Ga0213875_10002125 3300021388 Bacteria 12131
25 Ga0209025_1001171 3300025294 Bacteria 37155
26 Ga0207426_1000755 3300025302 Bacteria 36197
27 Ga0207426_1001179 3300025302 Bacteria 23362
28 Ga0207713_1019821 3300025735 Bacteria 3277
29 Ga0207710_10082543 3300025900 Bacteria 1493
30 Ga0207647_10033085 3300025904 Bacteria 3315
31 Ga0207687_10128931 3300025927 Bacteria 1903
32 Ga0207709_10034182 3300025935 Bacteria 2994
33 Ga0207667_10224804 3300025949 Bacteria 1923
34 Ga0209281_1000154 3300027111 Bacteria 166618
35 Ga0268266_10116684 3300028379 Bacteria 2371
36 Ga0307517_10002974 3300028786 Bacteria 26783
37 Ga0307515_10002535 3300028794 Bacteria 39481
38 Ga0307515_10121178 3300028794 Bacteria 2961
39 Ga0307511_10008788 3300030521 Bacteria 10090
40 Ga0307511_10050774 3300030521 Bacteria 3335
41 Ga0307512_10002787 3300030522 Bacteria 21303
42 Ga0307512_10104073 3300030522 Bacteria 1906
43 Ga0307513_10053248 3300031456 Bacteria 4351
44 Ga0307509_10007593 3300031507 Bacteria 14117
45 Ga0307509_10034323 3300031507 Bacteria 5573
46 Ga0307508_10058777 3300031616 Bacteria 3402
47 Ga0307508_10179829 3300031616 Bacteria 1717
48 Ga0307508_10195563 3300031616 Bacteria 1623
49 Ga0307514_10003166 3300031649 Bacteria 16124
50 Ga0307514_10030362 3300031649 Bacteria 4339
51 Ga0307514_10096337 3300031649 Bacteria 2138
52 Ga0307514_10104751 3300031649 Bacteria 2022
53 Ga0307516_10005462 3300031730 Bacteria 15192
54 Ga0307516_10019811 3300031730 Bacteria 6957
55 Ga0307507_10013803 3300033179 Bacteria 9740
56 Ga0307507_10061227 3300033179 Bacteria 3505
57 Ga0307507_10153969 3300033179 Bacteria 1720
58 Ga0307510_10018938 3300033180 Bacteria 8080
59 Ga0307510_10022814 3300033180 Bacteria 7260
60 Ga0307510_10027636 3300033180 Bacteria 6493
61 Ga0316574_0195012 3300035398 Bacteria 1302
62 Ga0395898_0002856 3300037466 Bacteria 19744
63 Ga0395905_0123273 3300037471 Bacteria 2437
64 Ga0436364_1343911 3300037853 Bacteria 54356
65 Ga0436364_1467910 3300037853 Bacteria 36038
66 Ga0439436_0012561 3300041404 Bacteria 2569
67 Ga0439436_0016815 3300041404 Bacteria 2192
68 Ga0439439_0000665 3300041406 Bacteria 6043
69 Ga0439439_0028471 3300041406 Bacteria 1415
70 Ga0439466_0054941 3300041411 Bacteria 1296
71 Ga0451789_0126413 3300041443 Bacteria 1370
72 Ga0451802_0355034 3300041460 Bacteria 1563
73 Ga0439433_0000144 3300041999 Bacteria 10822
74 Ga0439442_008907 3300042002 Bacteria 2028
75 Ga0439448_0032662 3300042005 Bacteria 1657
76 Ga0439449_0007628 3300042007 Bacteria 4113
77 Ga0439455_0001971 3300042012 Bacteria 3621
78 Ga0439457_000220 3300042014 Bacteria 15237
79 Ga0439462_0006554 3300042015 Bacteria 2895
80 Ga0439462_0018354 3300042015 Bacteria 1817
81 Ga0450898_000294 3300042134 Bacteria 5604
82 Ga0450899_001287 3300042135 Bacteria 2824
83 Ga0450903_000306 3300042138 Bacteria 10804
84 Ga0450906_000071 3300042145 Bacteria 16241
85 Ga0439458_0003848 3300042157 Bacteria 3470
86 Ga0450908_018530 3300042184 Bacteria 1230
87 Ga0466969_0003006 3300044656 Bacteria 8984
88 Ga0466969_0003660 3300044656 Bacteria 8181
89 Ga0466972_0002633 3300044658 Bacteria 8895
90 Ga0466966_0002421 3300044684 Bacteria 12191
91 Ga0466961_0008698 3300044693 Bacteria 6471
92 Ga0466961_0010848 3300044693 Bacteria 5819
93 Ga0466961_0255872 3300044693 Bacteria 1074
94 Ga0466963_0004352 3300044694 Bacteria 8221
95 Ga0466963_0154041 3300044694 Bacteria 1597
96 Ga0466964_0056321 3300044706 Bacteria 1625
97 Ga0453684_0268738 3300044712 Bacteria 1950
98 Ga0466971_0000678 3300044719 Bacteria 13595
99 Ga0466971_0000983 3300044719 Bacteria 11741
100 Ga0466971_0017892 3300044719 Bacteria 3139
101 Ga0466970_0001249 3300044765 Bacteria 12322
102 Ga0466970_0001480 3300044765 Bacteria 11339
103 Ga0466957_0000165 3300044842 Bacteria 29339
104 Ga0466959_0018677 3300045049 Bacteria 5091
105 Ga0466958_0001539 3300045836 Bacteria 11045
106 Ga0466967_0000917 3300045976 Bacteria 15838
107 Ga0466967_0009344 3300045976 Bacteria 7268
108 Ga0466967_0237079 3300045976 Bacteria 1739
109 Ga0495617_009949 3300046452 Bacteria 3260
110 Ga0495592_0002603 3300046454 Bacteria 12750
111 Ga0495592_0010044 3300046454 Bacteria 7130
112 Ga0495592_0013660 3300046454 Bacteria 6175
113 Ga0495592_0028011 3300046454 Bacteria 4267
114 Ga0495603_0045179 3300046455 Bacteria 2627
115 Ga0495603_0047256 3300046455 Bacteria 2563
116 Ga0495629_0002452 3300046459 Bacteria 14237
117 Ga0495629_0004761 3300046459 Bacteria 10171
118 Ga0495629_0009635 3300046459 Bacteria 7055
119 Ga0495629_0010651 3300046459 Bacteria 6688
120 Ga0495629_0021220 3300046459 Bacteria 4635
121 Ga0495629_0113716 3300046459 Bacteria 1886
122 Ga0495638_0040668 3300046460 Bacteria 2945
123 Ga0495651_0009570 3300046462 Bacteria 7445
124 Ga0495651_0027096 3300046462 Bacteria 4463
125 Ga0495651_0030852 3300046462 Bacteria 4179
126 Ga0495651_0034058 3300046462 Bacteria 3971
127 Ga0495651_0152891 3300046462 Bacteria 1661
128 Ga0495653_0010397 3300046463 Bacteria 7612
129 Ga0495653_0079754 3300046463 Bacteria 2423
130 Ga0495580_0006852 3300046472 Bacteria 9223
131 Ga0495582_0013303 3300046473 Bacteria 4531
132 Ga0495605_0146594 3300046474 Bacteria 1055
133 Ga0495662_0002268 3300046476 Bacteria 9694
134 Ga0495662_0003128 3300046476 Bacteria 8348
135 Ga0495662_0044378 3300046476 Bacteria 2146
136 Ga0495662_0055292 3300046476 Bacteria 1917
137 Ga0495664_0000206 3300046477 Bacteria 28424
138 Ga0495664_0005985 3300046477 Bacteria 6704
139 Ga0495664_0038984 3300046477 Bacteria 2807
140 Ga0495585_0006248 3300046492 Bacteria 7419
141 Ga0495594_0010536 3300046499 Bacteria 4795
142 Ga0495594_0030790 3300046499 Bacteria 2906
143 Ga0495594_0038584 3300046499 Bacteria 2609
144 Ga0495594_0131607 3300046499 Bacteria 1417
145 Ga0495596_0036220 3300046500 Bacteria 1955
146 Ga0495607_0029669 3300046501 Bacteria 3364
147 Ga0495607_0123497 3300046501 Bacteria 1356
148 Ga0495583_0081641 3300046506 Bacteria 1403
149 Ga0495606_0008761 3300046507 Bacteria 8692
150 Ga0495608_0008596 3300046511 Bacteria 7150
151 Ga0495608_0011443 3300046511 Bacteria 6175
152 Ga0495608_0064900 3300046511 Bacteria 2392
153 Ga0495610_0092188 3300046512 Bacteria 1371
154 Ga0495616_0013615 3300046513 Bacteria 4582
155 Ga0495618_0004488 3300046514 Bacteria 8582
156 Ga0495618_0019164 3300046514 Bacteria 4207
157 Ga0495620_0010620 3300046515 Bacteria 4850
158 Ga0495628_0002817 3300046516 Bacteria 15606
159 Ga0495628_0009739 3300046516 Bacteria 8195
160 Ga0495628_0016744 3300046516 Bacteria 6112
161 Ga0495628_0037809 3300046516 Bacteria 3867
162 Ga0495630_0002609 3300046517 Bacteria 12488
163 Ga0495630_0112508 3300046517 Bacteria 2062
164 Ga0495630_0242304 3300046517 Bacteria 1377
165 Ga0495631_0048388 3300046518 Bacteria 1864
166 Ga0495632_0066167 3300046519 Bacteria 1744
167 Ga0495643_0002191 3300046522 Bacteria 15967
168 Ga0495648_0087405 3300046524 Bacteria 1755
169 Ga0495648_0126280 3300046524 Bacteria 1366
170 Ga0495666_0005484 3300046526 Bacteria 6389
171 Ga0495666_0008618 3300046526 Bacteria 5108
172 Ga0495652_0024457 3300046529 Bacteria 5345
173 Ga0495652_0026229 3300046529 Bacteria 5150
174 Ga0495654_0021855 3300046530 Bacteria 3327
175 Ga0495665_0018698 3300046531 Bacteria 3722
176 Ga0495665_0075618 3300046531 Bacteria 1773
177 Ga0495640_0020588 3300046533 Bacteria 4852
178 Ga0495640_0025855 3300046533 Bacteria 4251
179 Ga0495640_0032806 3300046533 Bacteria 3695
180 Ga0495640_0077991 3300046533 Bacteria 2207
181 Ga0495586_0004241 3300046535 Bacteria 7667
182 Ga0495586_0006095 3300046535 Bacteria 6447
183 Ga0495587_0002754 3300046536 Bacteria 11731
184 Ga0495587_0051379 3300046536 Bacteria 2437
185 Ga0495587_0166580 3300046536 Bacteria 1252
186 Ga0495597_0021341 3300046542 Bacteria 3010
187 Ga0495645_0009292 3300046543 Bacteria 6877
188 Ga0495645_0024242 3300046543 Bacteria 4401
189 Ga0495645_0085934 3300046543 Bacteria 2251
190 Ga0495645_0188061 3300046543 Bacteria 1409
191 Ga0495667_0133849 3300046559 Bacteria 1598
192 Ga0495656_0075988 3300046615 Bacteria 1504
193 Ga0495668_0162221 3300046616 Bacteria 1224
194 Ga0495634_0001617 3300046642 Bacteria 19632
195 Ga0495634_0040738 3300046642 Bacteria 3156
196 Ga0495634_0057405 3300046642 Bacteria 2598
197 Ga0495611_0058850 3300046648 Bacteria 1743
198 Ga0495625_0008385 3300046660 Bacteria 8823
199 Ga0495625_0012460 3300046660 Bacteria 6890
200 Ga0495635_0000427 3300046663 Bacteria 26692
201 Ga0495635_0012927 3300046663 Bacteria 5845
202 Ga0495635_0013138 3300046663 Bacteria 5797
203 Ga0495635_0021910 3300046663 Bacteria 4452
204 Ga0495588_0004860 3300046674 Bacteria 5951
205 Ga0495588_0065268 3300046674 Bacteria 1888
206 Ga0495657_0001293 3300046675 Bacteria 21757
207 Ga0495657_0009338 3300046675 Bacteria 7441
208 Ga0495657_0014586 3300046675 Bacteria 5766
209 Ga0495657_0073925 3300046675 Bacteria 2218
210 Ga0495599_0026410 3300046678 Bacteria 3638
211 Ga0495599_0156539 3300046678 Bacteria 1409
212 Ga0495623_0020203 3300046679 Bacteria 4304
213 Ga0495623_0025938 3300046679 Bacteria 3774
214 Ga0495623_0030283 3300046679 Bacteria 3481
215 Ga0495646_0004397 3300046680 Bacteria 8877
216 Ga0495646_0034901 3300046680 Bacteria 3121
217 Ga0495646_0069495 3300046680 Bacteria 2077
218 Ga0495613_0000629 3300046689 Bacteria 28044
219 Ga0495613_0009807 3300046689 Bacteria 7120
220 Ga0495613_0022366 3300046689 Bacteria 4711
221 Ga0495624_0044229 3300046690 Bacteria 2839
222 Ga0495624_0105714 3300046690 Bacteria 1732
223 Ga0495624_0128769 3300046690 Bacteria 1552
224 Ga0495670_0001986 3300046691 Bacteria 10045
225 Ga0495589_0010210 3300046794 Bacteria 4878
226 Ga0495589_0045052 3300046794 Bacteria 2192
227 Ga0495589_0084614 3300046794 Bacteria 1541
228 Ga0495589_0094576 3300046794 Bacteria 1450
229 Ga0495600_0094594 3300046809 Bacteria 1948
230 Ga0495660_0009654 3300046810 Bacteria 5625
231 Ga0495660_0017355 3300046810 Bacteria 4144
232 Ga0495581_0006518 3300047315 Bacteria 6771
233 Ga0495581_0060570 3300047315 Bacteria 2187
234 Ga0495604_0000921 3300047317 Bacteria 24499
235 Ga0495604_0001487 3300047317 Bacteria 19323
236 Ga0495604_0005137 3300047317 Bacteria 10362
237 Ga0495604_0016402 3300047317 Bacteria 5920
238 Ga0495604_0061301 3300047317 Bacteria 2877
239 Ga0495636_0001385 3300047318 Bacteria 9161
240 Ga0495674_0017999 3300047319 Bacteria 6576
241 Ga0495674_0096440 3300047319 Bacteria 2520
242 Ga0495672_0015389 3300047320 Bacteria 5195
243 Ga0495672_0073582 3300047320 Bacteria 1926
244 Ga0495676_0000609 3300047321 Bacteria 29564
245 Ga0495676_0005128 3300047321 Bacteria 12007
246 Ga0495676_0045240 3300047321 Bacteria 3584
247 Ga0495680_0006426 3300047322 Bacteria 10922
248 Ga0495687_001793 3300047443 Bacteria 18950
249 Ga0495687_001814 3300047443 Bacteria 18789
250 Ga0495687_039327 3300047443 Bacteria 2093
251 Ga0495687_065156 3300047443 Bacteria 1484
252 Ga0495675_0001796 3300047444 Bacteria 12784
253 Ga0495675_0006812 3300047444 Bacteria 7009
254 Ga0495675_0036541 3300047444 Bacteria 3132
255 Ga0495675_0059332 3300047444 Bacteria 2425
256 Ga0495675_0089583 3300047444 Bacteria 1931
257 Ga0495675_0124915 3300047444 Bacteria 1601
258 Ga0495677_0013253 3300047445 Bacteria 3000
259 Ga0495685_002985 3300047447 Bacteria 5357
260 Ga0495685_004142 3300047447 Bacteria 4665
261 Ga0495685_004572 3300047447 Bacteria 4483
262 Ga0495685_006915 3300047447 Bacteria 3731
263 Ga0495685_029867 3300047447 Bacteria 1874
264 Ga0495681_0000624 3300047470 Bacteria 26943
265 Ga0495681_0001025 3300047470 Bacteria 21366
266 Ga0495686_0027618 3300047472 Bacteria 3704
267 Ga0495593_0000665 3300047673 Bacteria 19809
268 Ga0495593_0012392 3300047673 Bacteria 4874
269 Ga0495602_0007354 3300048088 Bacteria 11532
270 Ga0495614_0027091 3300048089 Bacteria 2471
271 Ga0495614_0027940 3300048089 Bacteria 2431
272 Ga0495614_0062899 3300048089 Bacteria 1595
273 Ga0496106_0371412 3300048909 Bacteria 1149
274 Ga0496108_0080503 3300048911 Bacteria 2759
275 Ga0496109_0008940 3300048912 Bacteria 8535
276 Ga0496110_0099306 3300048913 Bacteria 2609
277 Ga0496117_0000087 3300048920 Bacteria 211708
278 Ga0496117_0031038 3300048920 Bacteria 4087
279 Ga0496118_0013371 3300048921 Bacteria 7769
280 Ga0496119_0021942 3300048922 Bacteria 4591
281 Ga0496120_0006597 3300048923 Bacteria 8856
282 Ga0496121_0096879 3300048924 Bacteria 2287
283 Ga0496122_0010471 3300048925 Bacteria 9550
284 Ga0496123_0047729 3300048926 Bacteria 2889
285 Ga0496124_0141021 3300048927 Bacteria 1902
286 Ga0496125_0001276 3300048928 Bacteria 37428
287 Ga0496125_0001704 3300048928 Bacteria 30635
288 Ga0496125_0004091 3300048928 Bacteria 17067
289 Ga0496126_0000078 3300048929 Bacteria 231046
290 Ga0496126_0027113 3300048929 Bacteria 5478
291 Ga0495682_0007782 3300049460 Bacteria 4245
292 Ga0501031_0004293 3300049568 Bacteria 9219
293 Ga0501031_0028049 3300049568 Bacteria 3670
294 Ga0501031_0039609 3300049568 Bacteria 3076
295 Ga0501032_0105631 3300049569 Bacteria 1865
296 Ga0501033_0010326 3300049570 Bacteria 7167
297 Ga0501033_0060234 3300049570 Bacteria 2801
298 Ga0501033_0087627 3300049570 Bacteria 2278
299 Ga0501034_0001636 3300049571 Bacteria 28989
300 Ga0501034_0008626 3300049571 Bacteria 10754
301 Ga0501034_0083682 3300049571 Bacteria 3192
302 Ga0501034_0123545 3300049571 Bacteria 2574
303 Ga0501034_0265196 3300049571 Bacteria 1659
304 Ga0501034_0461487 3300049571 Bacteria 1187
305 Ga0501036_0008399 3300049572 Bacteria 8461
306 Ga0501036_0039085 3300049572 Bacteria 4017
307 Ga0501036_0079254 3300049572 Bacteria 2778
308 Ga0501037_0021801 3300049573 Bacteria 4740
309 Ga0501038_0004360 3300049574 Bacteria 13163
310 Ga0501038_0013950 3300049574 Bacteria 7324
311 Ga0501038_0063034 3300049574 Bacteria 3166
312 Ga0501038_0066534 3300049574 Bacteria 3068
313 Ga0501039_0015906 3300049575 Bacteria 5759
314 Ga0501039_0100003 3300049575 Bacteria 2263
315 Ga0501039_0147091 3300049575 Bacteria 1851
316 Ga0501042_0006236 3300049578 Bacteria 7741
317 Ga0501042_0127022 3300049578 Bacteria 1836
318 Ga0501043_0032662 3300049579 Bacteria 4093
319 Ga0501043_0042406 3300049579 Bacteria 3576
320 Ga0501043_0094138 3300049579 Bacteria 2355
321 Ga0501046_0329736 3300049580 Bacteria 1111
322 Ga0501047_0000359 3300049581 Bacteria 51862
323 Ga0501047_0021368 3300049581 Bacteria 6212
324 Ga0501047_0025052 3300049581 Bacteria 5731
325 Ga0501047_0045719 3300049581 Bacteria 4232
326 Ga0501047_0193632 3300049581 Bacteria 1896
327 Ga0501047_0197208 3300049581 Bacteria 1875
328 Ga0501048_0005419 3300049582 Bacteria 9700
329 Ga0501070_0012456 3300049586 Bacteria 7173
330 Ga0501070_0040291 3300049586 Bacteria 3895
331 Ga0501070_0087875 3300049586 Bacteria 2573
332 Ga0501073_0021651 3300049589 Bacteria 4632
333 Ga0501073_0120941 3300049589 Bacteria 1815
334 Ga0501074_0000828 3300049590 Bacteria 19614
335 Ga0501074_0001789 3300049590 Bacteria 14699
336 Ga0501217_039544 3300049661 Bacteria 1196
337 Ga0501080_0345274 3300049742 Bacteria 1345
338 Ga0501035_0002379 3300049822 Bacteria 18485
339 Ga0501035_0012195 3300049822 Bacteria 7947
340 Ga0501035_0029471 3300049822 Bacteria 5004
341 Ga0501035_0033752 3300049822 Bacteria 4651
342 Ga0501035_0083670 3300049822 Bacteria 2815
343 Ga0501035_0125182 3300049822 Bacteria 2244
344 Ga0501035_0210757 3300049822 Bacteria 1662
345 Ga0501044_0001603 3300049823 Bacteria 26463
346 Ga0501044_0014195 3300049823 Bacteria 8603
347 Ga0501044_0016389 3300049823 Bacteria 7958
348 Ga0501044_0170781 3300049823 Bacteria 2146
349 Ga0501044_0173903 3300049823 Bacteria 2123
350 Ga0501044_0439719 3300049823 Bacteria 1212
351 Ga0501045_0082487 3300049824 Bacteria 2371
352 nmdc:mga06z11_4066_c1 3300050494 Bacteria 5718
353 nmdc:mga04h51_1141_c1 3300050495 Bacteria 6133
354 Ga0495601_0007363 3300053077 Bacteria 6454
355 Ga0495612_0076412 3300053078 Bacteria 1403
356 Ga0495612_0086080 3300053078 Bacteria 1325
357 Ga0495655_0004167 3300053083 Bacteria 2452
358 Ga0495619_0033970 3300053085 Bacteria 3314
359 Ga0500640_000839 3300053095 Bacteria 8475
360 Ga0500654_058276 3300053099 Bacteria 2004
361 Ga0500553_016944 3300053101 Bacteria 3699
362 Ga0500553_032009 3300053101 Bacteria 2621
363 Ga0500560_005581 3300053107 Bacteria 2798
364 Ga0500560_037256 3300053107 Bacteria 1506
365 Ga0500569_012056 3300053109 Bacteria 2082
366 Ga0500572_012633 3300053111 Bacteria 2073
367 Ga0500614_031955 3300053123 Bacteria 1292
368 Ga0500628_001229 3300053129 Bacteria 4423
369 Ga0500652_035276 3300053131 Bacteria 1986
370 Ga0500573_0054022 3300053140 Bacteria 2307
371 Ga0500574_016604 3300053141 Bacteria 1782
372 Ga0500634_0013238 3300053161 Bacteria 4321
373 Ga0500636_0160315 3300053177 Bacteria 1227
374 Ga0466962_0000132 3300061719 Bacteria 30670
375 Ga0466962_0001361 3300061719 Bacteria 11314
376 Ga0466962_0056610 3300061719 Bacteria 1872
377 8033686948 8033684223 Bacteria 6906479
378 2547406059 2547132111 Bacteria 8013147
379 2554257547 2554235005 Bacteria 6457341
380 2563930032 2563366752 Bacteria 4961801
381 2585310836 2582581313 Bacteria 10042643
382 2585314525 2582581314 Bacteria 11452267
383 2616700328 2616644814 Bacteria 11555299
384 2643947881 2643221587 Bacteria 7586415
385 2644262905 2643221647 Bacteria 10741251
386 2644390682 2643221670 Bacteria 6497041
387 2644405649 2643221673 Bacteria 9196637
388 2644433747 2643221677 Bacteria 7584031
389 2644443114 2643221678 Bacteria 9540101
390 2644627078 2643221714 Bacteria 9015452
391 2723605984 2721755693 Bacteria 6126117
392 2730136648 2728369359 Bacteria 5621728
393 2753811402 2751185905 Bacteria 6142767
394 2768642380 2767802112 Bacteria 6465194
395 2784589003 2784132148 Bacteria 8627943
396 2785342847 2784746763 Bacteria 9783172
397 2785369956 2784746768 Bacteria 10036182
398 2786671029 2786546132 Bacteria 10419719
399 2793979117 2791355406 Bacteria 11364898
400 2802439735 2802428803 Bacteria 5806948
401 2804846382 2802429296 Bacteria 7227771
402 2808842447 2808606359 Bacteria 9866990
403 2808920960 2808606375 Bacteria 9466072
404 2809232604 2808606448 Bacteria 8656184
405 2811845772 2808606982 Bacteria 7791042
406 2812357651 2811994879 Bacteria 9313447
407 2812480171 2811994917 Bacteria 7761064
408 2819741445 2818991472 Bacteria 10089953
409 2852637270 2852635781 Bacteria 8251373
410 2858438759 2858438669 Bacteria 2058402
411 2862178975 2862178590 Bacteria 8583590
412 2862286053 2862281513 Bacteria 9621493
413 2862291357 2862290372 Bacteria 7471434
414 2862390487 2862382967 Bacteria 10317375
415 2862508110 2862507626 Bacteria 9425308
416 2862578863 2862574272 Bacteria 10567477
417 2862708387 2862705112 Bacteria 6563286
418 2863412734 2863404153 Bacteria 9672205
419 2867372506 2867369537 Bacteria 6501581
420 2867434821 2867428634 Bacteria 9590268
421 2873155349 2873151551 Bacteria 8625867
422 2877680673 2877676314 Bacteria 9512378
423 2881635587 2881633906 Bacteria 2972201
424 2889276535 2889276214 Bacteria 5979355
425 2904599781 2904595352 Bacteria 6124848
426 2907207114 2907202186 Bacteria 6632024
427 2912719389 2912715099 Bacteria 9460473
428 2912731400 2912723979 Bacteria 8557534
429 2912761278 2912757875 Bacteria 7940295
430 2919164225 2919160200 Bacteria 6929020
431 2919471888 2919468124 Bacteria 9133025
432 2928520554 2928519762 Bacteria 1953908
433 2939617778 2939615513 Bacteria 2384962
434 2939704892 2939702853 Bacteria 5139229
435 2946049506 2946045630 Bacteria 8527308
436 2946068205 2946064051 Bacteria 8957905
437 2946076339 2946072368 Bacteria 8999607
438 2947228717 2947224130 Bacteria 9938529
439 2954006802 2954002825 Bacteria 9173742
440 2954385801 2954380949 Bacteria 10050426
441 2954677356 2954673503 Bacteria 9685905
442 2954686796 2954682443 Bacteria 9862841
443 2954696447 2954691527 Bacteria 10720516
444 2954705831 2954701450 Bacteria 10834262
445 2954715802 2954711539 Bacteria 10867210
446 2954725739 2954721474 Bacteria 10456478
447 2954736061 2954731030 Bacteria 10243860
448 2954744695 2954740390 Bacteria 10229294
449 2954754921 2954749733 Bacteria 10366972
450 2954763660 2954759201 Bacteria 9358192
451 2984529711 2984527788 Bacteria 5288478
452 2984535818 2984532647 Bacteria 5288506
453 2990049870 2990044586 Bacteria 6603797
454 2990067685 2990059506 Bacteria 9321252
455 2990090655 2990088156 Bacteria 6657676
456 2996712067 2996706504 Bacteria 5757485
457 2997459071 2997451912 Bacteria 8492419
458 2997604708 2997600082 Bacteria 9896405
459 3006325703 3006321560 Bacteria 8247479
460 3006395420 3006393351 Bacteria 6615579
461 3006399617 3006393351 Bacteria 6615579
462 3006425729 3006425503 Bacteria 6491253
463 3006490208 3006486233 Bacteria 8157040
464 3006499383 3006493962 Bacteria 8825450
465 648171996 648028048 Bacteria 5394884
466 8007373205 8007371054 Bacteria 4849201
467 8008486064 8008485437 Bacteria 7198341
468 8008566843 8008558824 Bacteria 10610750
469 8008578532 8008574985 Bacteria 7815457
470 8023630490 8023623736 Bacteria 8593882
471 8025419866 8025413630 Bacteria 7014048
472 8025482600 8025478263 Bacteria 8209203
473 8025525380 8025524527 Bacteria 7197316
474 8025534408 8025530807 Bacteria 8495698
475 8047897614 8047893842 Bacteria 11723082
476 8048129650 8048127548 Bacteria 11053136
477 8048361256 8048356638 Bacteria 11044339
478 8048374601 8048369669 Bacteria 11666822
479 8048383621 8048379754 Bacteria 11877923
480 8048411503 8048406513 Bacteria 8936924
481 8054167395 8054160619 Bacteria 7783213
482 8054796204 8054795415 Bacteria 9785225
483 8056450619 8056447290 Bacteria 7680491
484 8056672006 8056667051 Bacteria 6953971
485 8056833290 8056829672 Bacteria 9045328
486 8057980929 8057977335 Bacteria 5694872
487 JGI24739J22299_10036822
488 JGI24737J22298_10008205
489 JGI25162J39368_1007948
490 Ga0006562J51391_1009724
491 Ga0006562J51391_1011898
492 Ga0055541_1000231
493 Ga0070665_100152182
494 Ga0068855_100367530
495 Ga0075368_10001223
496 Ga0075367_10005968
497 Ga0079104_1000084
498 Ga0105251_10015248
499 Ga0105244_10138960
500 Ga0105245_10190777
501 Ga0105247_10141222
502 Ga0105239_10524368
503 Ga0105246_10000694
504 Ga0157369_10100731
505 Ga0157375_10193075
506 Ga0182008_10002519
507 Ga0157376_10192808
508 Ga0182007_10008909
509 Ga0183367_1008
510 Ga0213875_10002125
511 Ga0209025_1001171
512 Ga0207426_1000755
513 Ga0207426_1001179
514 Ga0207713_1019821
515 Ga0207710_10082543
516 Ga0207647_10033085
517 Ga0207687_10128931
518 Ga0207709_10034182
519 Ga0207667_10224804
520 Ga0209281_1000154
521 Ga0268266_10116684
522 Ga0307517_10002974
523 Ga0307515_10002535
524 Ga0307515_10121178
525 Ga0307511_10008788
526 Ga0307511_10050774
527 Ga0307512_10002787
528 Ga0307512_10104073
529 Ga0307513_10053248
530 Ga0307509_10007593
531 Ga0307509_10034323
532 Ga0307508_10058777
533 Ga0307508_10179829
534 Ga0307508_10195563
535 Ga0307514_10003166
536 Ga0307514_10030362
537 Ga0307514_10096337
538 Ga0307514_10104751
539 Ga0307516_10005462
540 Ga0307516_10019811
541 Ga0307507_10013803
542 Ga0307507_10061227
543 Ga0307507_10153969
544 Ga0307510_10018938
545 Ga0307510_10022814
546 Ga0307510_10027636
547 Ga0316574_0195012
548 Ga0395898_0002856
549 Ga0395905_0123273
550 Ga0436364_1343911
551 Ga0436364_1467910
552 Ga0439436_0012561
553 Ga0439436_0016815
554 Ga0439439_0000665
555 Ga0439439_0028471
556 Ga0439466_0054941
557 Ga0451789_0126413
558 Ga0451802_0355034
559 Ga0439433_0000144
560 Ga0439442_008907
561 Ga0439448_0032662
562 Ga0439449_0007628
563 Ga0439455_0001971
564 Ga0439457_000220
565 Ga0439462_0006554
566 Ga0439462_0018354
567 Ga0450898_000294
568 Ga0450899_001287
569 Ga0450903_000306
570 Ga0450906_000071
571 Ga0439458_0003848
572 Ga0450908_018530
573 Ga0466969_0003006
574 Ga0466969_0003660
575 Ga0466972_0002633
576 Ga0466966_0002421
577 Ga0466961_0008698
578 Ga0466961_0010848
579 Ga0466961_0255872
580 Ga0466963_0004352
581 Ga0466963_0154041
582 Ga0466964_0056321
583 Ga0453684_0268738
584 Ga0466971_0000678
585 Ga0466971_0000983
586 Ga0466971_0017892
587 Ga0466970_0001249
588 Ga0466970_0001480
589 Ga0466957_0000165
590 Ga0466959_0018677
591 Ga0466958_0001539
592 Ga0466967_0000917
593 Ga0466967_0009344
594 Ga0466967_0237079
595 Ga0495617_009949
596 Ga0495592_0002603
597 Ga0495592_0010044
598 Ga0495592_0013660
599 Ga0495592_0028011
600 Ga0495603_0045179
601 Ga0495603_0047256
602 Ga0495629_0002452
603 Ga0495629_0004761
604 Ga0495629_0009635
605 Ga0495629_0010651
606 Ga0495629_0021220
607 Ga0495629_0113716
608 Ga0495638_0040668
609 Ga0495651_0009570
610 Ga0495651_0027096
611 Ga0495651_0030852
612 Ga0495651_0034058
613 Ga0495651_0152891
614 Ga0495653_0010397
615 Ga0495653_0079754
616 Ga0495580_0006852
617 Ga0495582_0013303
618 Ga0495605_0146594
619 Ga0495662_0002268
620 Ga0495662_0003128
621 Ga0495662_0044378
622 Ga0495662_0055292
623 Ga0495664_0000206
624 Ga0495664_0005985
625 Ga0495664_0038984
626 Ga0495585_0006248
627 Ga0495594_0010536
628 Ga0495594_0030790
629 Ga0495594_0038584
630 Ga0495594_0131607
631 Ga0495596_0036220
632 Ga0495607_0029669
633 Ga0495607_0123497
634 Ga0495583_0081641
635 Ga0495606_0008761
636 Ga0495608_0008596
637 Ga0495608_0011443
638 Ga0495608_0064900
639 Ga0495610_0092188
640 Ga0495616_0013615
641 Ga0495618_0004488
642 Ga0495618_0019164
643 Ga0495620_0010620
644 Ga0495628_0002817
645 Ga0495628_0009739
646 Ga0495628_0016744
647 Ga0495628_0037809
648 Ga0495630_0002609
649 Ga0495630_0112508
650 Ga0495630_0242304
651 Ga0495631_0048388
652 Ga0495632_0066167
653 Ga0495643_0002191
654 Ga0495648_0087405
655 Ga0495648_0126280
656 Ga0495666_0005484
657 Ga0495666_0008618
658 Ga0495652_0024457
659 Ga0495652_0026229
660 Ga0495654_0021855
661 Ga0495665_0018698
662 Ga0495665_0075618
663 Ga0495640_0020588
664 Ga0495640_0025855
665 Ga0495640_0032806
666 Ga0495640_0077991
667 Ga0495586_0004241
668 Ga0495586_0006095
669 Ga0495587_0002754
670 Ga0495587_0051379
671 Ga0495587_0166580
672 Ga0495597_0021341
673 Ga0495645_0009292
674 Ga0495645_0024242
675 Ga0495645_0085934
676 Ga0495645_0188061
677 Ga0495667_0133849
678 Ga0495656_0075988
679 Ga0495668_0162221
680 Ga0495634_0001617
681 Ga0495634_0040738
682 Ga0495634_0057405
683 Ga0495611_0058850
684 Ga0495625_0008385
685 Ga0495625_0012460
686 Ga0495635_0000427
687 Ga0495635_0012927
688 Ga0495635_0013138
689 Ga0495635_0021910
690 Ga0495588_0004860
691 Ga0495588_0065268
692 Ga0495657_0001293
693 Ga0495657_0009338
694 Ga0495657_0014586
695 Ga0495657_0073925
696 Ga0495599_0026410
697 Ga0495599_0156539
698 Ga0495623_0020203
699 Ga0495623_0025938
700 Ga0495623_0030283
701 Ga0495646_0004397
702 Ga0495646_0034901
703 Ga0495646_0069495
704 Ga0495613_0000629
705 Ga0495613_0009807
706 Ga0495613_0022366
707 Ga0495624_0044229
708 Ga0495624_0105714
709 Ga0495624_0128769
710 Ga0495670_0001986
711 Ga0495589_0010210
712 Ga0495589_0045052
713 Ga0495589_0084614
714 Ga0495589_0094576
715 Ga0495600_0094594
716 Ga0495660_0009654
717 Ga0495660_0017355
718 Ga0495581_0006518
719 Ga0495581_0060570
720 Ga0495604_0000921
721 Ga0495604_0001487
722 Ga0495604_0005137
723 Ga0495604_0016402
724 Ga0495604_0061301
725 Ga0495636_0001385
726 Ga0495674_0017999
727 Ga0495674_0096440
728 Ga0495672_0015389
729 Ga0495672_0073582
730 Ga0495676_0000609
731 Ga0495676_0005128
732 Ga0495676_0045240
733 Ga0495680_0006426
734 Ga0495687_001793
735 Ga0495687_001814
736 Ga0495687_039327
737 Ga0495687_065156
738 Ga0495675_0001796
739 Ga0495675_0006812
740 Ga0495675_0036541
741 Ga0495675_0059332
742 Ga0495675_0089583
743 Ga0495675_0124915
744 Ga0495677_0013253
745 Ga0495685_002985
746 Ga0495685_004142
747 Ga0495685_004572
748 Ga0495685_006915
749 Ga0495685_029867
750 Ga0495681_0000624
751 Ga0495681_0001025
752 Ga0495686_0027618
753 Ga0495593_0000665
754 Ga0495593_0012392
755 Ga0495602_0007354
756 Ga0495614_0027091
757 Ga0495614_0027940
758 Ga0495614_0062899
759 Ga0496106_0371412
760 Ga0496108_0080503
761 Ga0496109_0008940
762 Ga0496110_0099306
763 Ga0496117_0000087
764 Ga0496117_0031038
765 Ga0496118_0013371
766 Ga0496119_0021942
767 Ga0496120_0006597
768 Ga0496121_0096879
769 Ga0496122_0010471
770 Ga0496123_0047729
771 Ga0496124_0141021
772 Ga0496125_0001276
773 Ga0496125_0001704
774 Ga0496125_0004091
775 Ga0496126_0000078
776 Ga0496126_0027113
777 Ga0495682_0007782
778 Ga0501031_0004293
779 Ga0501031_0028049
780 Ga0501031_0039609
781 Ga0501032_0105631
782 Ga0501033_0010326
783 Ga0501033_0060234
784 Ga0501033_0087627
785 Ga0501034_0001636
786 Ga0501034_0008626
787 Ga0501034_0083682
788 Ga0501034_0123545
789 Ga0501034_0265196
790 Ga0501034_0461487
791 Ga0501036_0008399
792 Ga0501036_0039085
793 Ga0501036_0079254
794 Ga0501037_0021801
795 Ga0501038_0004360
796 Ga0501038_0013950
797 Ga0501038_0063034
798 Ga0501038_0066534
799 Ga0501039_0015906
800 Ga0501039_0100003
801 Ga0501039_0147091
802 Ga0501042_0006236
803 Ga0501042_0127022
804 Ga0501043_0032662
805 Ga0501043_0042406
806 Ga0501043_0094138
807 Ga0501046_0329736
808 Ga0501047_0000359
809 Ga0501047_0021368
810 Ga0501047_0025052
811 Ga0501047_0045719
812 Ga0501047_0193632
813 Ga0501047_0197208
814 Ga0501048_0005419
815 Ga0501070_0012456
816 Ga0501070_0040291
817 Ga0501070_0087875
818 Ga0501073_0021651
819 Ga0501073_0120941
820 Ga0501074_0000828
821 Ga0501074_0001789
822 Ga0501217_039544
823 Ga0501080_0345274
824 Ga0501035_0002379
825 Ga0501035_0012195
826 Ga0501035_0029471
827 Ga0501035_0033752
828 Ga0501035_0083670
829 Ga0501035_0125182
830 Ga0501035_0210757
831 Ga0501044_0001603
832 Ga0501044_0014195
833 Ga0501044_0016389
834 Ga0501044_0170781
835 Ga0501044_0173903
836 Ga0501044_0439719
837 Ga0501045_0082487
838 nmdc:mga06z11_4066_c1
839 nmdc:mga04h51_1141_c1
840 Ga0495601_0007363
841 Ga0495612_0076412
842 Ga0495612_0086080
843 Ga0495655_0004167
844 Ga0495619_0033970
845 Ga0500640_000839
846 Ga0500654_058276
847 Ga0500553_016944
848 Ga0500553_032009
849 Ga0500560_005581
850 Ga0500560_037256
851 Ga0500569_012056
852 Ga0500572_012633
853 Ga0500614_031955
854 Ga0500628_001229
855 Ga0500652_035276
856 Ga0500573_0054022
857 Ga0500574_016604
858 Ga0500634_0013238
859 Ga0500636_0160315
860 Ga0466962_0000132
861 Ga0466962_0001361
862 Ga0466962_0056610
863 8033686948
864 2547406059
865 2554257547
866 2563930032
867 2585310836
868 2585314525
869 2616700328
870 2643947881
871 2644262905
872 2644390682
873 2644405649
874 2644433747
875 2644443114
876 2644627078
877 2723605984
878 2730136648
879 2753811402
880 2768642380
881 2784589003
882 2785342847
883 2785369956
884 2786671029
885 2793979117
886 2802439735
887 2804846382
888 2808842447
889 2808920960
890 2809232604
891 2811845772
892 2812357651
893 2812480171
894 2819741445
895 2852637270
896 2858438759
897 2862178975
898 2862286053
899 2862291357
900 2862390487
901 2862508110
902 2862578863
903 2862708387
904 2863412734
905 2867372506
906 2867434821
907 2873155349
908 2877680673
909 2881635587
910 2889276535
911 2904599781
912 2907207114
913 2912719389
914 2912731400
915 2912761278
916 2919164225
917 2919471888
918 2928520554
919 2939617778
920 2939704892
921 2946049506
922 2946068205
923 2946076339
924 2947228717
925 2954006802
926 2954385801
927 2954677356
928 2954686796
929 2954696447
930 2954705831
931 2954715802
932 2954725739
933 2954736061
934 2954744695
935 2954754921
936 2954763660
937 2984529711
938 2984535818
939 2990049870
940 2990067685
941 2990090655
942 2996712067
943 2997459071
944 2997604708
945 3006325703
946 3006395420
947 3006399617
948 3006425729
949 3006490208
950 3006499383
951 648171996
952 8007373205
953 8008486064
954 8008566843
955 8008578532
956 8023630490
957 8025419866
958 8025482600
959 8025525380
960 8025534408
961 8047897614
962 8048129650
963 8048361256
964 8048374601
965 8048383621
966 8048411503
967 8054167395
968 8054796204
969 8056450619
970 8056672006
971 8056833290
972 8057980929

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02322

Cyt_bd_oxida_II

Cytochrome bd terminal oxidase subunit II

1

316

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6rko-assembly1.cif.gz_B cryo-em structure of the e. coli cytochrome bd-i oxidase at 2.68 a resolution 0.9012 3 272
7nkz-assembly1.cif.gz_B cryo-em structure of the cytochrome bd oxidase from m. tuberculosis at 2.5 a resolution 0.8997 1 275
7d5i-assembly1.cif.gz_B structure of mycobacterium smegmatis bd complex in the apo-form. 0.8979 1 274
7ose-assembly1.cif.gz_B cytochrome bd-ii type oxidase with bound aurachin d 0.8943 3 274
8b4o-assembly1.cif.gz_B cryo-em structure of cytochrome bd oxidase from c. glutamicum 0.8787 1 275
ID Description Score Start End Superfamily
1k40A00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Nucleotidyltransferases 0.5476 18 129 1.20.120.330
af_I1KY01_6_220_1.20.120.1770 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.5329 4 175 1.20.120.1770
af_Q54HM5_62_190_1.20.58.70 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.5227 4 124 1.20.58.70
af_A0A1D6MCX1_7_216_1.20.120.1770 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.5165 5 220 1.20.120.1770
af_O80854_5_217_1.20.120.1770 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.5041 4 219 1.20.120.1770
ID Description Score Start End GO Terms
AF-A0A353CTB7-F1-model_v4 Cytochrome d ubiquinol oxidase subunit II 0.9829 1 191 GO:0005886
GO:0009055
GO:0016682
GO:0019646
GO:0046872
GO:0070069
AF-A0A1L8ZQL0-F1-model_v4 deleted 0.9805 49 197
AF-A0A6I5D7Y8-F1-model_v4 deleted 0.9792 1 258
AF-A0A0D7KP08-F1-model_v4 Cytochrome d ubiquinol oxidase subunit II 0.9784 1 162 GO:0005886
GO:0009055
GO:0016682
GO:0019646
GO:0046872
GO:0070069
AF-F3MU01-F1-model_v4 deleted 0.9752 9 131

Map