F453330

General Info

Members Datasets Scaffolds Average Seq Length
486 332 972 263

Family's Representative Sequence

Representative Sequence 3300046648|Ga0495611_0023040|Ga0495611_0023040_1010_1960
Length 296
Sequence MPPAKKRTRTYDPAKTRAAVLAQFGHIREAVPALTPERLALPTRLGDWTVRELVAHVGTTLAAVARLLDKPEPARQDATVLDWPFATSANSGAIADTAHRLAEEHPDLVAFLADVEWDFTAHLDAHHGSRLLATSAGAMPLADCLVTRTVELVVHTDDLNAAVPGLDIPYDRQALAACTRLLADALAMKAPGASTEVRIPPYAVVQCVEGPRHTRGTPPNVVETDPLTWIRLATGRTEWETALDEAKVSASGERADLGGLLPLMGGTHPRNPPAEPTRSEANRRXXGHPPSWTSSD

Samples

Sample ID Description Type Environment
1 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
5 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
32 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
36 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
37 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
38 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
40 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
41 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
42 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
43 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
44 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
45 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
46 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
54 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
55 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
56 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
57 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
58 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
59 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
60 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
61 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
62 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
63 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
89 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
91 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
92 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
93 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
94 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
95 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
96 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
97 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
98 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
99 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
100 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
101 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
102 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
103 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
104 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
105 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
106 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
107 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
108 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
109 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
110 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
111 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
112 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
113 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
114 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
115 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
116 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
117 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
118 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
119 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
120 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
121 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
122 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
123 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
124 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
125 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
126 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
127 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
128 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
129 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
130 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
131 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
132 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
133 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
134 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
135 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
136 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
137 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
138 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
139 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
140 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
141 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
142 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
143 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
144 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
145 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
146 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
147 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
148 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
149 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
150 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
151 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
152 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
153 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
154 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
155 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
156 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
157 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
158 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
159 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
160 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
161 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
162 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
163 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
164 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
165 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
166 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
167 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
168 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
169 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
170 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
171 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
172 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
173 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
174 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
175 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
176 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
177 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
178 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
179 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
180 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
181 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
182 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
183 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
184 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
185 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
186 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
187 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
188 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
189 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
190 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
191 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
192 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
193 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
194 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
195 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
196 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
197 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
198 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
199 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
200 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
201 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
202 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
203 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
204 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
205 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
206 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
207 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
208 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
209 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
210 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
211 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
212 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
213 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
214 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
215 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
228 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
229 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
230 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
232 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
233 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
234 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
235 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
236 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
237 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
238 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
239 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
240 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
241 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
242 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
243 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
244 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
245 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
246 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
247 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
248 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
249 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
250 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
251 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
252 2643221548 Streptomyces sp. Root55 Isolate Unclassified
253 2643221578 Streptomyces sp. Root63 Isolate Unclassified
254 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
255 2643221647 Streptomyces sp. Root369 Isolate Unclassified
256 2643221670 Streptomyces sp. Root431 Isolate Unclassified
257 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
258 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
259 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
260 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
261 2643221714 Streptomyces sp. Root264 Isolate Unclassified
262 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
263 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
264 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
265 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
266 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
267 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
268 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
269 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
270 2808606448 Streptomyces sp. 193411 Isolate Unclassified
271 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
272 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
273 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
274 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
275 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
276 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
277 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
278 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
279 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
280 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
281 2862574272 Streptomyces sp. AcE210 Isolate Nodule
282 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
283 2867428634 Streptomyces sp. RP5T Isolate Unclassified
284 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
285 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
286 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
287 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
288 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
289 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
290 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
291 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
292 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
293 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
294 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
295 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
296 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
297 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
298 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
299 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
300 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
301 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
302 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
303 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
304 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
305 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
306 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
307 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
308 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
309 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
310 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
311 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
312 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
313 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
314 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
315 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
316 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
317 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
318 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
319 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
320 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
321 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
322 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
323 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
324 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
325 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
326 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
327 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
328 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
329 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
330 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
331 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
332 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 81.48
Metatranscriptomes 0.41
Isolates 18.11

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.26
Nodule 0.82
Rhizoplane 3.91
Rhizosphere 78.6
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495611_0023040 3300046648 Bacteria 2698
2 rootH2_10143930 3300003320 Bacteria 2696
3 rootH1_10019499 3300003323 Bacteria 2771
4 JGI25160J50197_1017028 3300003354 Bacteria 2319
5 Ga0006562J51391_1116883 3300003578 Bacteria 4350
6 Ga0006562J51391_1116884 3300003578 Bacteria 4710
7 Ga0070658_10007866 3300005327 Bacteria 8588
8 Ga0070676_10010901 3300005328 Bacteria 4937
9 Ga0070670_100015180 3300005331 Bacteria 6611
10 Ga0070682_100031691 3300005337 Bacteria 3198
11 Ga0070660_100092483 3300005339 Bacteria 2387
12 Ga0070691_10017540 3300005341 Bacteria 3294
13 Ga0070675_100069227 3300005354 Bacteria 2923
14 Ga0070671_100007992 3300005355 Bacteria 8466
15 Ga0070673_100007062 3300005364 Bacteria 7368
16 Ga0070659_100105254 3300005366 Bacteria 2273
17 Ga0070667_100067460 3300005367 Bacteria 3042
18 Ga0070709_10022354 3300005434 Bacteria 3698
19 Ga0070714_100107381 3300005435 Bacteria 2467
20 Ga0070711_100065318 3300005439 Bacteria 2545
21 Ga0070705_100145470 3300005440 Bacteria 1565
22 Ga0070678_100081207 3300005456 Bacteria 2457
23 Ga0070662_100169057 3300005457 Bacteria 1716
24 Ga0070679_100012776 3300005530 Bacteria 8034
25 Ga0070693_100007017 3300005547 Bacteria 5484
26 Ga0070665_100099463 3300005548 Bacteria 2913
27 Ga0070665_100210538 3300005548 Bacteria 1945
28 Ga0068855_100077932 3300005563 Bacteria 3845
29 Ga0068857_100327493 3300005577 Bacteria 1415
30 Ga0068856_100016265 3300005614 Bacteria 7197
31 Ga0068856_100159353 3300005614 Bacteria 2267
32 Ga0068852_100002958 3300005616 Bacteria 11804
33 Ga0068864_100021141 3300005618 Bacteria 5448
34 Ga0068861_100055767 3300005719 Bacteria 3015
35 Ga0068870_10000054 3300005840 Bacteria 36323
36 Ga0068858_100007344 3300005842 Bacteria 10665
37 Ga0068860_100064197 3300005843 Bacteria 3488
38 Ga0081455_10023343 3300005937 Bacteria 5757
39 Ga0070716_100057409 3300006173 Bacteria 2237
40 Ga0075367_10015626 3300006178 Bacteria 4131
41 Ga0097621_100009324 3300006237 Bacteria 7124
42 Ga0068871_100064158 3300006358 Bacteria 3006
43 Ga0068865_100200745 3300006881 Bacteria 1548
44 Ga0075436_100024024 3300006914 Bacteria 4189
45 Ga0099826_10152429 3300006948 Bacteria 1320
46 Ga0075435_100000557 3300007076 Bacteria 22898
47 Ga0105251_10013609 3300009011 Bacteria 4545
48 Ga0105244_10050585 3300009036 Bacteria 2119
49 Ga0105250_10102502 3300009092 Bacteria 1168
50 Ga0105240_10132824 3300009093 Bacteria 2983
51 Ga0105245_10340704 3300009098 Bacteria 1483
52 Ga0114129_10594527 3300009147 Bacteria 1434
53 Ga0105237_10130783 3300009545 Bacteria 2504
54 Ga0105238_10049337 3300009551 Bacteria 4240
55 Ga0105249_11055192 3300009553 Bacteria 882
56 Ga0105246_10000193 3300011119 Bacteria 30407
57 Ga0105246_10001651 3300011119 Bacteria 13303
58 Ga0105246_10209430 3300011119 Bacteria 1521
59 Ga0157373_10082062 3300013100 Bacteria 2272
60 Ga0157371_10088767 3300013102 Bacteria 2189
61 Ga0157374_10016370 3300013296 Bacteria 6513
62 Ga0157372_10064688 3300013307 Bacteria 4104
63 Ga0163163_10289146 3300014325 Bacteria 1691
64 Ga0157379_10037089 3300014968 Bacteria 4347
65 Ga0182007_10001033 3300015262 Bacteria 15217
66 Ga0183367_1008 3300015688 Bacteria 490626
67 Ga0207426_1019480 3300025302 Bacteria 2371
68 Ga0207426_1025340 3300025302 Bacteria 1998
69 Ga0207688_10002910 3300025901 Bacteria 9306
70 Ga0207647_10044926 3300025904 Bacteria 2758
71 Ga0207699_10090418 3300025906 Bacteria 1921
72 Ga0207643_10000326 3300025908 Bacteria 32686
73 Ga0207654_10020343 3300025911 Bacteria 3517
74 Ga0207707_10063123 3300025912 Bacteria 3224
75 Ga0207663_10040128 3300025916 Bacteria 2843
76 Ga0207657_10076507 3300025919 Bacteria 2823
77 Ga0207649_10004261 3300025920 Bacteria 7792
78 Ga0207649_10252761 3300025920 Bacteria 1270
79 Ga0207650_10002452 3300025925 Bacteria 12912
80 Ga0207687_10007290 3300025927 Bacteria 7296
81 Ga0207644_10007119 3300025931 Bacteria 7292
82 Ga0207706_10060013 3300025933 Bacteria 3350
83 Ga0207704_10094530 3300025938 Bacteria 1974
84 Ga0207665_10052502 3300025939 Bacteria 2746
85 Ga0207689_10000818 3300025942 Bacteria 29960
86 Ga0207661_10287176 3300025944 Bacteria 1471
87 Ga0207679_10008493 3300025945 Bacteria 6544
88 Ga0207640_10592846 3300025981 Bacteria 937
89 Ga0207658_10078714 3300025986 Bacteria 2520
90 Ga0207678_10000468 3300026067 Bacteria 36559
91 Ga0207702_10000541 3300026078 Bacteria 42221
92 Ga0207702_10201380 3300026078 Bacteria 1846
93 Ga0207674_10365567 3300026116 Bacteria 1395
94 Ga0207674_10366520 3300026116 Bacteria 1393
95 Ga0207675_100048539 3300026118 Bacteria 3962
96 Ga0207683_10005467 3300026121 Bacteria 10883
97 Ga0207428_10010152 3300027907 Bacteria 8421
98 Ga0268264_10330061 3300028381 Bacteria 1445
99 Ga0307515_10000596 3300028794 Bacteria 84243
100 Ga0307515_10022623 3300028794 Bacteria 11066
101 Ga0307511_10000678 3300030521 Bacteria 36277
102 Ga0307511_10156319 3300030521 Bacteria 1293
103 Ga0307511_10213423 3300030521 Bacteria 981
104 Ga0307512_10018160 3300030522 Bacteria 6431
105 Ga0307512_10023043 3300030522 Bacteria 5572
106 Ga0265327_10028278 3300031251 Bacteria 3211
107 Ga0307513_10040019 3300031456 Bacteria 5188
108 Ga0307513_10097338 3300031456 Bacteria 2977
109 Ga0307513_10107367 3300031456 Bacteria 2795
110 Ga0307509_10032103 3300031507 Bacteria 5789
111 Ga0307509_10121454 3300031507 Bacteria 2589
112 Ga0307509_10348473 3300031507 Bacteria 1205
113 Ga0307508_10005457 3300031616 Bacteria 12089
114 Ga0307508_10184935 3300031616 Bacteria 1686
115 Ga0307514_10005558 3300031649 Bacteria 11187
116 Ga0307514_10134828 3300031649 Bacteria 1692
117 Ga0307514_10245467 3300031649 Bacteria 1067
118 Ga0307516_10019666 3300031730 Bacteria 6989
119 Ga0307413_10110319 3300031824 Bacteria 1841
120 Ga0307518_10030010 3300031838 Bacteria 3936
121 Ga0307518_10065745 3300031838 Bacteria 2630
122 Ga0307518_10084002 3300031838 Bacteria 2295
123 Ga0307518_10090031 3300031838 Bacteria 2208
124 Ga0307518_10216282 3300031838 Bacteria 1256
125 Ga0307416_100794173 3300032002 Bacteria 1042
126 Ga0307416_101219540 3300032002 Bacteria 858
127 Ga0307411_10178058 3300032005 Bacteria 1611
128 Ga0307507_10041417 3300033179 Bacteria 4609
129 Ga0307507_10304288 3300033179 Bacteria 974
130 Ga0307510_10014944 3300033180 Bacteria 9182
131 Ga0307510_10092708 3300033180 Bacteria 2855
132 Ga0307510_10260786 3300033180 Bacteria 1214
133 Ga0395900_0338105 3300037418 Bacteria 1482
134 Ga0395898_0012933 3300037466 Bacteria 8609
135 Ga0395898_0087258 3300037466 Bacteria 3006
136 Ga0395901_0050246 3300038443 Bacteria 4333
137 Ga0439436_0008816 3300041404 Bacteria 3096
138 Ga0439436_0037629 3300041404 Bacteria 1393
139 Ga0439439_0002824 3300041406 Bacteria 3749
140 Ga0451837_0156484 3300041494 Bacteria 2558
141 Ga0451853_1140510 3300041512 Bacteria 5029
142 Ga0451853_2403763 3300041512 Bacteria 4652
143 Ga0451853_3244135 3300041512 Bacteria 2925
144 Ga0439449_0000357 3300042007 Bacteria 16784
145 Ga0439449_0035139 3300042007 Bacteria 1866
146 Ga0439449_0043436 3300042007 Bacteria 1669
147 Ga0439457_000476 3300042014 Bacteria 11566
148 Ga0439457_001782 3300042014 Bacteria 6362
149 Ga0439462_0001374 3300042015 Bacteria 5379
150 Ga0450903_000683 3300042138 Bacteria 6784
151 Ga0439458_0002763 3300042157 Bacteria 4228
152 Ga0439458_0035214 3300042157 Bacteria 1203
153 Ga0439459_0001957 3300042438 Bacteria 3129
154 Ga0466969_0016574 3300044656 Bacteria 3854
155 Ga0466969_0021118 3300044656 Bacteria 3369
156 Ga0466972_0004069 3300044658 Bacteria 7299
157 Ga0466972_0011410 3300044658 Bacteria 4459
158 Ga0466972_0155208 3300044658 Bacteria 1075
159 Ga0466972_0175766 3300044658 Bacteria 1004
160 Ga0466965_0005798 3300044683 Bacteria 5573
161 Ga0466966_0004948 3300044684 Bacteria 8756
162 Ga0466966_0034991 3300044684 Bacteria 3246
163 Ga0466961_0022060 3300044693 Bacteria 4097
164 Ga0466961_0028975 3300044693 Bacteria 3559
165 Ga0466963_0000277 3300044694 Bacteria 22841
166 Ga0466963_0005946 3300044694 Bacteria 7187
167 Ga0466963_0080886 3300044694 Bacteria 2200
168 Ga0466971_0002024 3300044719 Bacteria 8581
169 Ga0466971_0121483 3300044719 Bacteria 1209
170 Ga0466968_0012560 3300044735 Bacteria 3318
171 Ga0466970_0001383 3300044765 Bacteria 11691
172 Ga0466970_0002516 3300044765 Bacteria 8838
173 Ga0466957_0000471 3300044842 Bacteria 19989
174 Ga0466960_0008436 3300044901 Bacteria 4220
175 Ga0466960_0229018 3300044901 Bacteria 1025
176 Ga0466959_0003956 3300045049 Bacteria 9845
177 Ga0466958_0014838 3300045836 Bacteria 4453
178 Ga0466958_0109882 3300045836 Bacteria 1721
179 Ga0466967_0016997 3300045976 Bacteria 5756
180 Ga0466967_0043325 3300045976 Bacteria 3896
181 Ga0466967_0142258 3300045976 Bacteria 2235
182 Ga0495617_037141 3300046452 Bacteria 1632
183 Ga0495592_0013433 3300046454 Bacteria 6232
184 Ga0495592_0056981 3300046454 Bacteria 2885
185 Ga0495603_0025765 3300046455 Bacteria 3555
186 Ga0495603_0037992 3300046455 Bacteria 2888
187 Ga0495603_0077818 3300046455 Bacteria 1945
188 Ga0495590_0007591 3300046457 Bacteria 4170
189 Ga0495629_0020829 3300046459 Bacteria 4680
190 Ga0495629_0022040 3300046459 Bacteria 4542
191 Ga0495629_0034961 3300046459 Bacteria 3552
192 Ga0495629_0062697 3300046459 Bacteria 2596
193 Ga0495638_0047096 3300046460 Bacteria 2705
194 Ga0495638_0082859 3300046460 Bacteria 1944
195 Ga0495641_0026116 3300046461 Bacteria 2855
196 Ga0495651_0027294 3300046462 Bacteria 4447
197 Ga0495651_0134545 3300046462 Bacteria 1800
198 Ga0495653_0154254 3300046463 Bacteria 1601
199 Ga0495580_0041149 3300046472 Bacteria 3296
200 Ga0495605_0001970 3300046474 Bacteria 13015
201 Ga0495639_0012113 3300046475 Bacteria 3717
202 Ga0495662_0000832 3300046476 Bacteria 14975
203 Ga0495662_0024586 3300046476 Bacteria 2906
204 Ga0495662_0037484 3300046476 Bacteria 2341
205 Ga0495662_0055108 3300046476 Bacteria 1921
206 Ga0495662_0073137 3300046476 Bacteria 1662
207 Ga0495664_0017392 3300046477 Bacteria 4109
208 Ga0495585_0121876 3300046492 Bacteria 1379
209 Ga0495594_0000230 3300046499 Bacteria 27077
210 Ga0495594_0004764 3300046499 Bacteria 6987
211 Ga0495594_0017279 3300046499 Bacteria 3809
212 Ga0495594_0231208 3300046499 Bacteria 1054
213 Ga0495596_0052076 3300046500 Bacteria 1603
214 Ga0495607_0046733 3300046501 Bacteria 2539
215 Ga0495583_0106065 3300046506 Bacteria 1194
216 Ga0495606_0030387 3300046507 Bacteria 3775
217 Ga0495608_0139659 3300046511 Bacteria 1547
218 Ga0495616_0003636 3300046513 Bacteria 9849
219 Ga0495618_0031062 3300046514 Bacteria 3339
220 Ga0495618_0053894 3300046514 Bacteria 2543
221 Ga0495620_0011996 3300046515 Bacteria 4499
222 Ga0495628_0062160 3300046516 Bacteria 2927
223 Ga0495628_0082353 3300046516 Bacteria 2499
224 Ga0495628_0267889 3300046516 Bacteria 1271
225 Ga0495630_0035453 3300046517 Bacteria 3728
226 Ga0495631_0004858 3300046518 Bacteria 7073
227 Ga0495637_0021076 3300046520 Bacteria 2991
228 Ga0495643_0015313 3300046522 Bacteria 4534
229 Ga0495648_0157464 3300046524 Bacteria 1178
230 Ga0495666_0011783 3300046526 Bacteria 4358
231 Ga0495666_0039517 3300046526 Bacteria 2290
232 Ga0495666_0095942 3300046526 Bacteria 1398
233 Ga0495640_0032413 3300046533 Bacteria 3722
234 Ga0495586_0272148 3300046535 Bacteria 968
235 Ga0495587_0022370 3300046536 Bacteria 3892
236 Ga0495587_0061662 3300046536 Bacteria 2197
237 Ga0495597_0053999 3300046542 Bacteria 1765
238 Ga0495645_0108665 3300046543 Bacteria 1964
239 Ga0495645_0220076 3300046543 Bacteria 1277
240 Ga0495622_0011794 3300046557 Bacteria 4041
241 Ga0495622_0058330 3300046557 Bacteria 1788
242 Ga0495633_0041348 3300046558 Bacteria 2192
243 Ga0495668_0007084 3300046616 Bacteria 7217
244 Ga0495634_0003800 3300046642 Bacteria 11996
245 Ga0495634_0090829 3300046642 Bacteria 1983
246 Ga0495634_0387146 3300046642 Bacteria 832
247 Ga0495611_0018426 3300046648 Bacteria 2994
248 Ga0495625_0008814 3300046660 Bacteria 8538
249 Ga0495625_0050892 3300046660 Bacteria 2970
250 Ga0495625_0084305 3300046660 Bacteria 2207
251 Ga0495635_0000747 3300046663 Bacteria 21036
252 Ga0495635_0014977 3300046663 Bacteria 5424
253 Ga0495635_0057638 3300046663 Bacteria 2672
254 Ga0495588_0007271 3300046674 Bacteria 5030
255 Ga0495588_0088542 3300046674 Bacteria 1620
256 Ga0495657_0008640 3300046675 Bacteria 7772
257 Ga0495657_0030635 3300046675 Bacteria 3765
258 Ga0495657_0044140 3300046675 Bacteria 3034
259 Ga0495657_0061786 3300046675 Bacteria 2477
260 Ga0495646_0277908 3300046680 Bacteria 890
261 Ga0495658_0016490 3300046683 Bacteria 3802
262 Ga0495613_0010906 3300046689 Bacteria 6746
263 Ga0495613_0034064 3300046689 Bacteria 3782
264 Ga0495613_0055533 3300046689 Bacteria 2909
265 Ga0495613_0086916 3300046689 Bacteria 2266
266 Ga0495613_0087482 3300046689 Bacteria 2258
267 Ga0495613_0091861 3300046689 Bacteria 2198
268 Ga0495613_0101455 3300046689 Bacteria 2078
269 Ga0495624_0059737 3300046690 Bacteria 2391
270 Ga0495671_0015236 3300046692 Bacteria 4125
271 Ga0495649_0007378 3300046694 Bacteria 6716
272 Ga0495649_0059879 3300046694 Bacteria 2049
273 Ga0495589_0023200 3300046794 Bacteria 3162
274 Ga0495589_0040362 3300046794 Bacteria 2330
275 Ga0495589_0046225 3300046794 Bacteria 2161
276 Ga0495589_0118484 3300046794 Bacteria 1275
277 Ga0495600_0016669 3300046809 Bacteria 4668
278 Ga0495600_0028004 3300046809 Bacteria 3644
279 Ga0495660_0038856 3300046810 Bacteria 2644
280 Ga0495581_0003525 3300047315 Bacteria 8977
281 Ga0495581_0340821 3300047315 Bacteria 875
282 Ga0495604_0005136 3300047317 Bacteria 10362
283 Ga0495604_0017783 3300047317 Bacteria 5687
284 Ga0495604_0036132 3300047317 Bacteria 3896
285 Ga0495636_0088465 3300047318 Bacteria 1342
286 Ga0495674_0254652 3300047319 Bacteria 1444
287 Ga0495676_0009028 3300047321 Bacteria 9098
288 Ga0495676_0027824 3300047321 Bacteria 4843
289 Ga0495676_0029615 3300047321 Bacteria 4660
290 Ga0495676_0041306 3300047321 Bacteria 3797
291 Ga0495676_0043879 3300047321 Bacteria 3654
292 Ga0495676_0047325 3300047321 Bacteria 3478
293 Ga0495680_0005012 3300047322 Bacteria 12530
294 Ga0495683_0021567 3300047323 Bacteria 3319
295 Ga0495683_0119855 3300047323 Bacteria 1249
296 Ga0495687_002577 3300047443 Bacteria 14293
297 Ga0495687_004667 3300047443 Bacteria 9140
298 Ga0495687_045402 3300047443 Bacteria 1903
299 Ga0495687_077979 3300047443 Bacteria 1306
300 Ga0495675_0024745 3300047444 Bacteria 3829
301 Ga0495675_0069376 3300047444 Bacteria 2226
302 Ga0495675_0179358 3300047444 Bacteria 1297
303 Ga0495675_0188599 3300047444 Bacteria 1260
304 Ga0495685_005349 3300047447 Bacteria 4188
305 Ga0495685_011859 3300047447 Bacteria 2948
306 Ga0495685_011904 3300047447 Bacteria 2943
307 Ga0495685_016583 3300047447 Bacteria 2517
308 Ga0495685_020594 3300047447 Bacteria 2267
309 Ga0495685_034000 3300047447 Bacteria 1752
310 Ga0495685_073988 3300047447 Bacteria 1139
311 Ga0495685_085639 3300047447 Bacteria 1047
312 Ga0495681_0012672 3300047470 Bacteria 4941
313 Ga0495684_0359630 3300047471 Bacteria 1031
314 Ga0495593_0007108 3300047673 Bacteria 6563
315 Ga0495602_0032500 3300048088 Bacteria 4911
316 Ga0495602_0395810 3300048088 Bacteria 986
317 Ga0495614_0001950 3300048089 Bacteria 9063
318 Ga0495614_0062887 3300048089 Bacteria 1595
319 Ga0495626_0006153 3300048091 Bacteria 6873
320 Ga0496100_0070588 3300048903 Bacteria 2330
321 Ga0496101_0475224 3300048904 Bacteria 987
322 Ga0496102_0051674 3300048905 Bacteria 3744
323 Ga0496104_0003341 3300048907 Bacteria 13849
324 Ga0496104_0015822 3300048907 Bacteria 6844
325 Ga0496105_0030687 3300048908 Bacteria 4404
326 Ga0496105_0202759 3300048908 Bacteria 1619
327 Ga0496106_0032057 3300048909 Bacteria 3917
328 Ga0496106_0118976 3300048909 Bacteria 2063
329 Ga0496107_0057787 3300048910 Bacteria 2804
330 Ga0496108_0031035 3300048911 Bacteria 4430
331 Ga0496108_0063948 3300048911 Bacteria 3099
332 Ga0496108_0275637 3300048911 Bacteria 1464
333 Ga0496109_0006637 3300048912 Bacteria 9745
334 Ga0496110_0026928 3300048913 Bacteria 4924
335 Ga0496111_0002336 3300048914 Bacteria 11430
336 Ga0496113_0047094 3300048916 Bacteria 3203
337 Ga0496114_0452459 3300048917 Bacteria 1137
338 Ga0496126_0612105 3300048929 Bacteria 857
339 Ga0501031_0046276 3300049568 Bacteria 2837
340 Ga0501031_0179118 3300049568 Bacteria 1385
341 Ga0501032_0036228 3300049569 Bacteria 3369
342 Ga0501032_0231608 3300049569 Bacteria 1201
343 Ga0501033_0002609 3300049570 Bacteria 15193
344 Ga0501033_0010969 3300049570 Bacteria 6943
345 Ga0501033_0190078 3300049570 Bacteria 1469
346 Ga0501033_0405450 3300049570 Bacteria 950
347 Ga0501034_0079214 3300049571 Bacteria 3289
348 Ga0501034_0102274 3300049571 Bacteria 2858
349 Ga0501034_0243130 3300049571 Bacteria 1745
350 Ga0501034_0300288 3300049571 Bacteria 1542
351 Ga0501036_0005209 3300049572 Bacteria 10511
352 Ga0501036_0038120 3300049572 Bacteria 4067
353 Ga0501036_0095909 3300049572 Bacteria 2507
354 Ga0501036_0139077 3300049572 Bacteria 2049
355 Ga0501037_0009371 3300049573 Bacteria 7186
356 Ga0501037_0055078 3300049573 Bacteria 2908
357 Ga0501038_0000303 3300049574 Bacteria 41854
358 Ga0501038_0010214 3300049574 Bacteria 8592
359 Ga0501038_0463047 3300049574 Bacteria 973
360 Ga0501039_0020353 3300049575 Bacteria 5086
361 Ga0501043_0001902 3300049579 Bacteria 17894
362 Ga0501043_0007764 3300049579 Bacteria 8487
363 Ga0501043_0126016 3300049579 Bacteria 2008
364 Ga0501046_0089206 3300049580 Bacteria 2373
365 Ga0501047_0014794 3300049581 Bacteria 7427
366 Ga0501047_0046166 3300049581 Bacteria 4210
367 Ga0501047_0074647 3300049581 Bacteria 3264
368 Ga0501048_0012664 3300049582 Bacteria 6271
369 Ga0501048_0100127 3300049582 Bacteria 2044
370 Ga0501068_0029805 3300049584 Bacteria 3234
371 Ga0501070_0016277 3300049586 Bacteria 6248
372 Ga0501070_0109741 3300049586 Bacteria 2280
373 Ga0501070_0516047 3300049586 Bacteria 959
374 Ga0501074_0009586 3300049590 Bacteria 7030
375 Ga0501035_0045809 3300049822 Bacteria 3934
376 Ga0501035_0059774 3300049822 Bacteria 3394
377 Ga0501035_0158817 3300049822 Bacteria 1958
378 Ga0501035_0685086 3300049822 Bacteria 828
379 Ga0501044_0011879 3300049823 Bacteria 9436
380 Ga0501044_0044148 3300049823 Bacteria 4628
381 Ga0501044_0055820 3300049823 Bacteria 4055
382 Ga0501044_0142026 3300049823 Bacteria 2389
383 Ga0501044_0410474 3300049823 Bacteria 1265
384 Ga0501044_0499233 3300049823 Bacteria 1118
385 nmdc:mga06z11_15009_c1 3300050494 Bacteria 3448
386 nmdc:mga09592_190486_c1 3300050508 Bacteria 1775
387 nmdc:mga08y16_30184_c1 3300050511 Bacteria 5707
388 nmdc:mga0n895_19087_c1 3300050512 Bacteria 6365
389 nmdc:mga0rr50_719_c1 3300050513 Bacteria 17839
390 nmdc:mga08x19_106378_c1 3300050514 Bacteria 1867
391 nmdc:mga0a205_4394_c2 3300050515 Bacteria 10262
392 Ga0500644_0001902 3300053088 Bacteria 5363
393 Ga0500572_016372 3300053111 Bacteria 1888
394 Ga0500614_027739 3300053123 Bacteria 1363
395 Ga0500573_0054816 3300053140 Bacteria 2289
396 Ga0500573_0171245 3300053140 Bacteria 1174
397 Ga0500624_001618 3300053157 Bacteria 3414
398 Ga0466962_0004115 3300061719 Bacteria 6966
399 2547412482 2547132111 Bacteria 8013147
400 2554257363 2554235005 Bacteria 6457341
401 2585300314 2582581312 Bacteria 7308206
402 2585310634 2582581313 Bacteria 10042643
403 2585314400 2582581314 Bacteria 11452267
404 2616700202 2616644814 Bacteria 11555299
405 2616905283 2616644941 Bacteria 8510691
406 2643762988 2643221548 Bacteria 8053412
407 2643899932 2643221578 Bacteria 9213798
408 2643947751 2643221587 Bacteria 7586415
409 2644263025 2643221647 Bacteria 10741251
410 2644390817 2643221670 Bacteria 6497041
411 2644405845 2643221673 Bacteria 9196637
412 2644433616 2643221677 Bacteria 7584031
413 2644443240 2643221678 Bacteria 9540101
414 2644464154 2643221682 Bacteria 6743283
415 2644626948 2643221714 Bacteria 9015452
416 2784588872 2784132148 Bacteria 8627943
417 2785343015 2784746763 Bacteria 9783172
418 2785369813 2784746768 Bacteria 10036182
419 2786670902 2786546132 Bacteria 10419719
420 2793983500 2791355406 Bacteria 11364898
421 2804846480 2802429296 Bacteria 7227771
422 2808842317 2808606359 Bacteria 9866990
423 2808920841 2808606375 Bacteria 9466072
424 2809232485 2808606448 Bacteria 8656184
425 2811849316 2808606982 Bacteria 7791042
426 2812357799 2811994879 Bacteria 9313447
427 2812480271 2811994917 Bacteria 7761064
428 2819697158 2818991463 Bacteria 7948711
429 2852637075 2852635781 Bacteria 8251373
430 2862183399 2862178590 Bacteria 8583590
431 2862285932 2862281513 Bacteria 9621493
432 2862291259 2862290372 Bacteria 7471434
433 2862388323 2862382967 Bacteria 10317375
434 2862507988 2862507626 Bacteria 9425308
435 2862578976 2862574272 Bacteria 10567477
436 2863404279 2863404153 Bacteria 9672205
437 2867436798 2867428634 Bacteria 9590268
438 2873155464 2873151551 Bacteria 8625867
439 2875395400 2875391855 Bacteria 7600475
440 2877680826 2877676314 Bacteria 9512378
441 2912719637 2912715099 Bacteria 9460473
442 2912731304 2912723979 Bacteria 8557534
443 2912761076 2912757875 Bacteria 7940295
444 2918505308 2918501144 Bacteria 8668083
445 2919472007 2919468124 Bacteria 9133025
446 2935390949 2935390628 Bacteria 7043367
447 2946049716 2946045630 Bacteria 8527308
448 2946068067 2946064051 Bacteria 8957905
449 2946076170 2946072368 Bacteria 8999607
450 2947228886 2947224130 Bacteria 9938529
451 2954006652 2954002825 Bacteria 9173742
452 2954385925 2954380949 Bacteria 10050426
453 2954677228 2954673503 Bacteria 9685905
454 2954686927 2954682443 Bacteria 9862841
455 2954696577 2954691527 Bacteria 10720516
456 2954705647 2954701450 Bacteria 10834262
457 2954715936 2954711539 Bacteria 10867210
458 2954725875 2954721474 Bacteria 10456478
459 2954735923 2954731030 Bacteria 10243860
460 2954744813 2954740390 Bacteria 10229294
461 2954754786 2954749733 Bacteria 10366972
462 2954763798 2954759201 Bacteria 9358192
463 2966601958 2966598605 Bacteria 7676064
464 2990065649 2990059506 Bacteria 9321252
465 2997454711 2997451912 Bacteria 8492419
466 2997604405 2997600082 Bacteria 9896405
467 3006397166 3006393351 Bacteria 6615579
468 3006428338 3006425503 Bacteria 6491253
469 3006493763 3006486233 Bacteria 8157040
470 3006499264 3006493962 Bacteria 8825450
471 8008566968 8008558824 Bacteria 10610750
472 8008578641 8008574985 Bacteria 7815457
473 8023629437 8023623736 Bacteria 8593882
474 8025413661 8025413630 Bacteria 7014048
475 8025484633 8025478263 Bacteria 8209203
476 8025536355 8025530807 Bacteria 8495698
477 8047897310 8047893842 Bacteria 11723082
478 8048128223 8048127548 Bacteria 11053136
479 8048361633 8048356638 Bacteria 11044339
480 8048374298 8048369669 Bacteria 11666822
481 8048383925 8048379754 Bacteria 11877923
482 8048412637 8048406513 Bacteria 8936924
483 8054162963 8054160619 Bacteria 7783213
484 8056451924 8056447290 Bacteria 7680491
485 8056669272 8056667051 Bacteria 6953971
486 8056833393 8056829672 Bacteria 9045328
487 Ga0495611_0023040
488 rootH2_10143930
489 rootH1_10019499
490 JGI25160J50197_1017028
491 Ga0006562J51391_1116883
492 Ga0006562J51391_1116884
493 Ga0070658_10007866
494 Ga0070676_10010901
495 Ga0070670_100015180
496 Ga0070682_100031691
497 Ga0070660_100092483
498 Ga0070691_10017540
499 Ga0070675_100069227
500 Ga0070671_100007992
501 Ga0070673_100007062
502 Ga0070659_100105254
503 Ga0070667_100067460
504 Ga0070709_10022354
505 Ga0070714_100107381
506 Ga0070711_100065318
507 Ga0070705_100145470
508 Ga0070678_100081207
509 Ga0070662_100169057
510 Ga0070679_100012776
511 Ga0070693_100007017
512 Ga0070665_100099463
513 Ga0070665_100210538
514 Ga0068855_100077932
515 Ga0068857_100327493
516 Ga0068856_100016265
517 Ga0068856_100159353
518 Ga0068852_100002958
519 Ga0068864_100021141
520 Ga0068861_100055767
521 Ga0068870_10000054
522 Ga0068858_100007344
523 Ga0068860_100064197
524 Ga0081455_10023343
525 Ga0070716_100057409
526 Ga0075367_10015626
527 Ga0097621_100009324
528 Ga0068871_100064158
529 Ga0068865_100200745
530 Ga0075436_100024024
531 Ga0099826_10152429
532 Ga0075435_100000557
533 Ga0105251_10013609
534 Ga0105244_10050585
535 Ga0105250_10102502
536 Ga0105240_10132824
537 Ga0105245_10340704
538 Ga0114129_10594527
539 Ga0105237_10130783
540 Ga0105238_10049337
541 Ga0105249_11055192
542 Ga0105246_10000193
543 Ga0105246_10001651
544 Ga0105246_10209430
545 Ga0157373_10082062
546 Ga0157371_10088767
547 Ga0157374_10016370
548 Ga0157372_10064688
549 Ga0163163_10289146
550 Ga0157379_10037089
551 Ga0182007_10001033
552 Ga0183367_1008
553 Ga0207426_1019480
554 Ga0207426_1025340
555 Ga0207688_10002910
556 Ga0207647_10044926
557 Ga0207699_10090418
558 Ga0207643_10000326
559 Ga0207654_10020343
560 Ga0207707_10063123
561 Ga0207663_10040128
562 Ga0207657_10076507
563 Ga0207649_10004261
564 Ga0207649_10252761
565 Ga0207650_10002452
566 Ga0207687_10007290
567 Ga0207644_10007119
568 Ga0207706_10060013
569 Ga0207704_10094530
570 Ga0207665_10052502
571 Ga0207689_10000818
572 Ga0207661_10287176
573 Ga0207679_10008493
574 Ga0207640_10592846
575 Ga0207658_10078714
576 Ga0207678_10000468
577 Ga0207702_10000541
578 Ga0207702_10201380
579 Ga0207674_10365567
580 Ga0207674_10366520
581 Ga0207675_100048539
582 Ga0207683_10005467
583 Ga0207428_10010152
584 Ga0268264_10330061
585 Ga0307515_10000596
586 Ga0307515_10022623
587 Ga0307511_10000678
588 Ga0307511_10156319
589 Ga0307511_10213423
590 Ga0307512_10018160
591 Ga0307512_10023043
592 Ga0265327_10028278
593 Ga0307513_10040019
594 Ga0307513_10097338
595 Ga0307513_10107367
596 Ga0307509_10032103
597 Ga0307509_10121454
598 Ga0307509_10348473
599 Ga0307508_10005457
600 Ga0307508_10184935
601 Ga0307514_10005558
602 Ga0307514_10134828
603 Ga0307514_10245467
604 Ga0307516_10019666
605 Ga0307413_10110319
606 Ga0307518_10030010
607 Ga0307518_10065745
608 Ga0307518_10084002
609 Ga0307518_10090031
610 Ga0307518_10216282
611 Ga0307416_100794173
612 Ga0307416_101219540
613 Ga0307411_10178058
614 Ga0307507_10041417
615 Ga0307507_10304288
616 Ga0307510_10014944
617 Ga0307510_10092708
618 Ga0307510_10260786
619 Ga0395900_0338105
620 Ga0395898_0012933
621 Ga0395898_0087258
622 Ga0395901_0050246
623 Ga0439436_0008816
624 Ga0439436_0037629
625 Ga0439439_0002824
626 Ga0451837_0156484
627 Ga0451853_1140510
628 Ga0451853_2403763
629 Ga0451853_3244135
630 Ga0439449_0000357
631 Ga0439449_0035139
632 Ga0439449_0043436
633 Ga0439457_000476
634 Ga0439457_001782
635 Ga0439462_0001374
636 Ga0450903_000683
637 Ga0439458_0002763
638 Ga0439458_0035214
639 Ga0439459_0001957
640 Ga0466969_0016574
641 Ga0466969_0021118
642 Ga0466972_0004069
643 Ga0466972_0011410
644 Ga0466972_0155208
645 Ga0466972_0175766
646 Ga0466965_0005798
647 Ga0466966_0004948
648 Ga0466966_0034991
649 Ga0466961_0022060
650 Ga0466961_0028975
651 Ga0466963_0000277
652 Ga0466963_0005946
653 Ga0466963_0080886
654 Ga0466971_0002024
655 Ga0466971_0121483
656 Ga0466968_0012560
657 Ga0466970_0001383
658 Ga0466970_0002516
659 Ga0466957_0000471
660 Ga0466960_0008436
661 Ga0466960_0229018
662 Ga0466959_0003956
663 Ga0466958_0014838
664 Ga0466958_0109882
665 Ga0466967_0016997
666 Ga0466967_0043325
667 Ga0466967_0142258
668 Ga0495617_037141
669 Ga0495592_0013433
670 Ga0495592_0056981
671 Ga0495603_0025765
672 Ga0495603_0037992
673 Ga0495603_0077818
674 Ga0495590_0007591
675 Ga0495629_0020829
676 Ga0495629_0022040
677 Ga0495629_0034961
678 Ga0495629_0062697
679 Ga0495638_0047096
680 Ga0495638_0082859
681 Ga0495641_0026116
682 Ga0495651_0027294
683 Ga0495651_0134545
684 Ga0495653_0154254
685 Ga0495580_0041149
686 Ga0495605_0001970
687 Ga0495639_0012113
688 Ga0495662_0000832
689 Ga0495662_0024586
690 Ga0495662_0037484
691 Ga0495662_0055108
692 Ga0495662_0073137
693 Ga0495664_0017392
694 Ga0495585_0121876
695 Ga0495594_0000230
696 Ga0495594_0004764
697 Ga0495594_0017279
698 Ga0495594_0231208
699 Ga0495596_0052076
700 Ga0495607_0046733
701 Ga0495583_0106065
702 Ga0495606_0030387
703 Ga0495608_0139659
704 Ga0495616_0003636
705 Ga0495618_0031062
706 Ga0495618_0053894
707 Ga0495620_0011996
708 Ga0495628_0062160
709 Ga0495628_0082353
710 Ga0495628_0267889
711 Ga0495630_0035453
712 Ga0495631_0004858
713 Ga0495637_0021076
714 Ga0495643_0015313
715 Ga0495648_0157464
716 Ga0495666_0011783
717 Ga0495666_0039517
718 Ga0495666_0095942
719 Ga0495640_0032413
720 Ga0495586_0272148
721 Ga0495587_0022370
722 Ga0495587_0061662
723 Ga0495597_0053999
724 Ga0495645_0108665
725 Ga0495645_0220076
726 Ga0495622_0011794
727 Ga0495622_0058330
728 Ga0495633_0041348
729 Ga0495668_0007084
730 Ga0495634_0003800
731 Ga0495634_0090829
732 Ga0495634_0387146
733 Ga0495611_0018426
734 Ga0495625_0008814
735 Ga0495625_0050892
736 Ga0495625_0084305
737 Ga0495635_0000747
738 Ga0495635_0014977
739 Ga0495635_0057638
740 Ga0495588_0007271
741 Ga0495588_0088542
742 Ga0495657_0008640
743 Ga0495657_0030635
744 Ga0495657_0044140
745 Ga0495657_0061786
746 Ga0495646_0277908
747 Ga0495658_0016490
748 Ga0495613_0010906
749 Ga0495613_0034064
750 Ga0495613_0055533
751 Ga0495613_0086916
752 Ga0495613_0087482
753 Ga0495613_0091861
754 Ga0495613_0101455
755 Ga0495624_0059737
756 Ga0495671_0015236
757 Ga0495649_0007378
758 Ga0495649_0059879
759 Ga0495589_0023200
760 Ga0495589_0040362
761 Ga0495589_0046225
762 Ga0495589_0118484
763 Ga0495600_0016669
764 Ga0495600_0028004
765 Ga0495660_0038856
766 Ga0495581_0003525
767 Ga0495581_0340821
768 Ga0495604_0005136
769 Ga0495604_0017783
770 Ga0495604_0036132
771 Ga0495636_0088465
772 Ga0495674_0254652
773 Ga0495676_0009028
774 Ga0495676_0027824
775 Ga0495676_0029615
776 Ga0495676_0041306
777 Ga0495676_0043879
778 Ga0495676_0047325
779 Ga0495680_0005012
780 Ga0495683_0021567
781 Ga0495683_0119855
782 Ga0495687_002577
783 Ga0495687_004667
784 Ga0495687_045402
785 Ga0495687_077979
786 Ga0495675_0024745
787 Ga0495675_0069376
788 Ga0495675_0179358
789 Ga0495675_0188599
790 Ga0495685_005349
791 Ga0495685_011859
792 Ga0495685_011904
793 Ga0495685_016583
794 Ga0495685_020594
795 Ga0495685_034000
796 Ga0495685_073988
797 Ga0495685_085639
798 Ga0495681_0012672
799 Ga0495684_0359630
800 Ga0495593_0007108
801 Ga0495602_0032500
802 Ga0495602_0395810
803 Ga0495614_0001950
804 Ga0495614_0062887
805 Ga0495626_0006153
806 Ga0496100_0070588
807 Ga0496101_0475224
808 Ga0496102_0051674
809 Ga0496104_0003341
810 Ga0496104_0015822
811 Ga0496105_0030687
812 Ga0496105_0202759
813 Ga0496106_0032057
814 Ga0496106_0118976
815 Ga0496107_0057787
816 Ga0496108_0031035
817 Ga0496108_0063948
818 Ga0496108_0275637
819 Ga0496109_0006637
820 Ga0496110_0026928
821 Ga0496111_0002336
822 Ga0496113_0047094
823 Ga0496114_0452459
824 Ga0496126_0612105
825 Ga0501031_0046276
826 Ga0501031_0179118
827 Ga0501032_0036228
828 Ga0501032_0231608
829 Ga0501033_0002609
830 Ga0501033_0010969
831 Ga0501033_0190078
832 Ga0501033_0405450
833 Ga0501034_0079214
834 Ga0501034_0102274
835 Ga0501034_0243130
836 Ga0501034_0300288
837 Ga0501036_0005209
838 Ga0501036_0038120
839 Ga0501036_0095909
840 Ga0501036_0139077
841 Ga0501037_0009371
842 Ga0501037_0055078
843 Ga0501038_0000303
844 Ga0501038_0010214
845 Ga0501038_0463047
846 Ga0501039_0020353
847 Ga0501043_0001902
848 Ga0501043_0007764
849 Ga0501043_0126016
850 Ga0501046_0089206
851 Ga0501047_0014794
852 Ga0501047_0046166
853 Ga0501047_0074647
854 Ga0501048_0012664
855 Ga0501048_0100127
856 Ga0501068_0029805
857 Ga0501070_0016277
858 Ga0501070_0109741
859 Ga0501070_0516047
860 Ga0501074_0009586
861 Ga0501035_0045809
862 Ga0501035_0059774
863 Ga0501035_0158817
864 Ga0501035_0685086
865 Ga0501044_0011879
866 Ga0501044_0044148
867 Ga0501044_0055820
868 Ga0501044_0142026
869 Ga0501044_0410474
870 Ga0501044_0499233
871 nmdc:mga06z11_15009_c1
872 nmdc:mga09592_190486_c1
873 nmdc:mga08y16_30184_c1
874 nmdc:mga0n895_19087_c1
875 nmdc:mga0rr50_719_c1
876 nmdc:mga08x19_106378_c1
877 nmdc:mga0a205_4394_c2
878 Ga0500644_0001902
879 Ga0500572_016372
880 Ga0500614_027739
881 Ga0500573_0054816
882 Ga0500573_0171245
883 Ga0500624_001618
884 Ga0466962_0004115
885 2547412482
886 2554257363
887 2585300314
888 2585310634
889 2585314400
890 2616700202
891 2616905283
892 2643762988
893 2643899932
894 2643947751
895 2644263025
896 2644390817
897 2644405845
898 2644433616
899 2644443240
900 2644464154
901 2644626948
902 2784588872
903 2785343015
904 2785369813
905 2786670902
906 2793983500
907 2804846480
908 2808842317
909 2808920841
910 2809232485
911 2811849316
912 2812357799
913 2812480271
914 2819697158
915 2852637075
916 2862183399
917 2862285932
918 2862291259
919 2862388323
920 2862507988
921 2862578976
922 2863404279
923 2867436798
924 2873155464
925 2875395400
926 2877680826
927 2912719637
928 2912731304
929 2912761076
930 2918505308
931 2919472007
932 2935390949
933 2946049716
934 2946068067
935 2946076170
936 2947228886
937 2954006652
938 2954385925
939 2954677228
940 2954686927
941 2954696577
942 2954705647
943 2954715936
944 2954725875
945 2954735923
946 2954744813
947 2954754786
948 2954763798
949 2966601958
950 2990065649
951 2997454711
952 2997604405
953 3006397166
954 3006428338
955 3006493763
956 3006499264
957 8008566968
958 8008578641
959 8023629437
960 8025413661
961 8025484633
962 8025536355
963 8047897310
964 8048128223
965 8048361633
966 8048374298
967 8048383925
968 8048412637
969 8054162963
970 8056451924
971 8056669272
972 8056833393

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF17844

SCP_3

Bacterial SCP ortholog

171

263

0.99

PF07398

MDMPI_C

MDMPI C-terminal domain

172

259

0.96

PF11716

MDMPI_N

Mycothiol maleylpyruvate isomerase N-terminal domain

20

160

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
4zy7-assembly1.cif.gz_A crystal structure of a mycobacterial protein 0.8984 146 264
4zy7-assembly2.cif.gz_B crystal structure of a mycobacterial protein 0.8866 146 264
4nss-assembly1.cif.gz_A a structural and functional investigation of a novel protein from mycobacterium smegmatis implicated in mycobacterial macrophage survivability 0.865 146 264
4nss-assembly2.cif.gz_B a structural and functional investigation of a novel protein from mycobacterium smegmatis implicated in mycobacterial macrophage survivability 0.8636 146 264
4zy7-assembly1.cif.gz_A crystal structure of a mycobacterial protein 0.849 146 264
ID Description Score Start End Superfamily
af_I6Y8U3_1_129_3.30.1050.40 Alpha Beta;2-Layer Sandwich;Nonspecific Lipid-transfer Protein; Chain A; 0.872 146 263 3.30.1050.40
4nssB00 Alpha Beta;2-Layer Sandwich;Nonspecific Lipid-transfer Protein; Chain A; 0.8636 146 264 3.30.1050.40
af_P71985_5_134_1.20.120.450 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.8346 19 162 1.20.120.450
af_P71985_5_134_1.20.120.450 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.8112 19 162 1.20.120.450
4nssB00 Alpha Beta;2-Layer Sandwich;Nonspecific Lipid-transfer Protein; Chain A; 0.8004 146 264 3.30.1050.40
ID Description Score Start End GO Terms
AF-A0A433GWG1-F1-model_v4 deleted 1.001 172 263
AF-A0A0K8Q1I5-F1-model_v4 Sterol binding protein 0.9984 194 262
AF-A0A0L8QGA8-F1-model_v4 deleted 0.9982 180 265
AF-A0A7X6UDS6-F1-model_v4 Bacterial SCP orthologue domain-containing protein 0.9981 172 265
AF-A0A657IV11-F1-model_v4 Bacterial SCP orthologue domain-containing protein 0.9967 171 265

Map