F453314

General Info

Members Datasets Scaffolds Average Seq Length
486 191 485 253

Family's Representative Sequence

Representative Sequence 3300044765|Ga0466970_0124707|Ga0466970_0124707_121_894
Length 238
Sequence MNTQLIDTHCHLYGKEFAGDIREVIQRAENEGVHRFYLPGIDSEVIEDMLKLEQDFPGKCFAMMGLHPCSVKEDFEQELALVSDWLKKRPFSAVGEIGLDYYWDKTFVQQQQQSRESMADSIQIVQEHQKGSLRGIFHCFTGTLEEAKKIIDTGFYLGIGGVLTYKNTHLREVLKEISLDHIVLETDAPYLTPVPFRGKRNESSYLKYVAEKLAEVKNISVEEIGSITTANAKKIFGA

Samples

Sample ID Description Type Environment
1 2738541278 Niastella sp. CF465 Isolate Unclassified
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
61 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
62 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
84 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
151 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
155 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
156 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
157 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
158 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
159 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
160 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
161 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
162 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
163 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
164 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
165 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
166 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
167 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
168 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
169 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
170 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
171 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
172 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
173 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
174 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
175 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
176 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
177 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
178 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
179 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
180 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
181 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
182 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
183 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
184 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
185 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
186 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
187 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
188 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
189 3300053152 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 endosphere Metagenome Endosphere
190 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
191 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.79
Metatranscriptomes 0
Isolates 0.21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.65
Nodule 0
Rhizoplane 0.82
Rhizosphere 95.88
Stem 0
Stem Tuber 0
Unclassified 1.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10019511 3300003203 Bacteria 2761
2 rootL2_10103102 3300003322 Bacteria 2665
3 Ga0065714_10009752 3300005288 Bacteria 2410
4 Ga0065712_10096558 3300005290 Bacteria 2156
5 Ga0065712_10258012 3300005290 Bacteria 944
6 Ga0065715_10180385 3300005293 Bacteria 1480
7 Ga0065715_10334885 3300005293 Bacteria 976
8 Ga0065707_10007300 3300005295 Bacteria 2500
9 Ga0070658_10093815 3300005327 Bacteria 2476
10 Ga0070683_100001339 3300005329 Bacteria 18784
11 Ga0070683_100049182 3300005329 Bacteria 3899
12 Ga0070690_100038348 3300005330 Bacteria 3024
13 Ga0070670_100053216 3300005331 Bacteria 3476
14 Ga0070670_100079593 3300005331 Bacteria 2816
15 Ga0070670_100247359 3300005331 Bacteria 1553
16 Ga0070670_100275108 3300005331 Unclassified 1470
17 Ga0068869_100011293 3300005334 Bacteria 5852
18 Ga0068869_100023442 3300005334 Bacteria 4263
19 Ga0068869_100029698 3300005334 Bacteria 3833
20 Ga0068869_100034231 3300005334 Bacteria 3592
21 Ga0068869_100461739 3300005334 Bacteria 1054
22 Ga0068869_100522469 3300005334 Bacteria 994
23 Ga0070666_10000086 3300005335 Bacteria 66096
24 Ga0070666_10064925 3300005335 Bacteria 2476
25 Ga0070666_10143318 3300005335 Bacteria 1665
26 Ga0070666_10314965 3300005335 Bacteria 1115
27 Ga0070680_100369309 3300005336 Bacteria 1221
28 Ga0070682_100000005 3300005337 Bacteria 386439
29 Ga0070682_100019516 3300005337 Bacteria 3977
30 Ga0068868_100001797 3300005338 Bacteria 14736
31 Ga0068868_100060698 3300005338 Bacteria 2995
32 Ga0068868_100100816 3300005338 Bacteria 2336
33 Ga0068868_100172940 3300005338 Bacteria 1789
34 Ga0070660_100034909 3300005339 Bacteria 3803
35 Ga0070689_100007125 3300005340 Bacteria 7792
36 Ga0070689_100153483 3300005340 Bacteria 1858
37 Ga0070689_100168187 3300005340 Bacteria 1775
38 Ga0070689_100221405 3300005340 Bacteria 1552
39 Ga0070687_100011524 3300005343 Bacteria 3870
40 Ga0070687_100146875 3300005343 Bacteria 1379
41 Ga0070661_100001444 3300005344 Bacteria 16518
42 Ga0070661_100006362 3300005344 Bacteria 8147
43 Ga0070661_100039294 3300005344 Bacteria 3448
44 Ga0070668_100013895 3300005347 Bacteria 6020
45 Ga0070668_100138631 3300005347 Bacteria 1958
46 Ga0070669_100002268 3300005353 Bacteria 13955
47 Ga0070669_100069093 3300005353 Bacteria 2608
48 Ga0070669_100089767 3300005353 Bacteria 2302
49 Ga0070675_100047026 3300005354 Bacteria 3535
50 Ga0070675_100084748 3300005354 Bacteria 2647
51 Ga0070671_100034090 3300005355 Bacteria 4213
52 Ga0070671_100126330 3300005355 Bacteria 2153
53 Ga0070671_100274596 3300005355 Bacteria 1433
54 Ga0070673_100008734 3300005364 Bacteria 6761
55 Ga0070673_100014218 3300005364 Bacteria 5533
56 Ga0070673_100072756 3300005364 Bacteria 2765
57 Ga0070673_100158738 3300005364 Bacteria 1921
58 Ga0070688_100015081 3300005365 Unclassified 4387
59 Ga0070688_100021005 3300005365 Bacteria 3807
60 Ga0070688_100365843 3300005365 Bacteria 1059
61 Ga0070659_100072184 3300005366 Bacteria 2746
62 Ga0070659_100166163 3300005366 Bacteria 1806
63 Ga0070667_100033986 3300005367 Bacteria 4265
64 Ga0070667_100071476 3300005367 Bacteria 2955
65 Ga0070667_100095892 3300005367 Bacteria 2558
66 Ga0070667_100113698 3300005367 Unclassified 2350
67 Ga0070667_100205703 3300005367 Bacteria 1748
68 Ga0070667_100234948 3300005367 Bacteria 1635
69 Ga0070701_10045345 3300005438 Bacteria 2255
70 Ga0070700_100023130 3300005441 Bacteria 3632
71 Ga0070700_100071474 3300005441 Bacteria 2215
72 Ga0070700_100435959 3300005441 Bacteria 993
73 Ga0070678_100007945 3300005456 Bacteria 6320
74 Ga0070678_100038906 3300005456 Unclassified 3352
75 Ga0070662_100014708 3300005457 Bacteria 5230
76 Ga0070662_100016329 3300005457 Bacteria 4984
77 Ga0070662_100030930 3300005457 Bacteria 3751
78 Ga0070662_100031625 3300005457 Bacteria 3715
79 Ga0070662_100282856 3300005457 Bacteria 1343
80 Ga0070662_100290906 3300005457 Bacteria 1324
81 Ga0070681_10174492 3300005458 Bacteria 2071
82 Ga0068867_100007009 3300005459 Bacteria 7964
83 Ga0068867_100036940 3300005459 Bacteria 3549
84 Ga0068867_100051949 3300005459 Bacteria 3024
85 Ga0068867_100117369 3300005459 Bacteria 2052
86 Ga0070685_10005117 3300005466 Bacteria 6644
87 Ga0070685_10018969 3300005466 Bacteria 3706
88 Ga0070685_10053062 3300005466 Bacteria 2347
89 Ga0070698_100003376 3300005471 Bacteria 17567
90 Ga0070698_100027276 3300005471 Bacteria 5942
91 Ga0070679_100062085 3300005530 Bacteria 3724
92 Ga0070684_100001043 3300005535 Bacteria 19809
93 Ga0070684_100051588 3300005535 Bacteria 3574
94 Ga0070684_100055315 3300005535 Bacteria 3459
95 Ga0068853_100002759 3300005539 Bacteria 13264
96 Ga0068853_100006785 3300005539 Bacteria 9126
97 Ga0068853_100019441 3300005539 Bacteria 5630
98 Ga0068853_100019942 3300005539 Bacteria 5568
99 Ga0070672_100157866 3300005543 Bacteria 1880
100 Ga0070672_100381961 3300005543 Bacteria 1205
101 Ga0070672_100428694 3300005543 Bacteria 1137
102 Ga0070686_100033206 3300005544 Bacteria 3169
103 Ga0070686_100622783 3300005544 Bacteria 853
104 Ga0070693_100282643 3300005547 Bacteria 1112
105 Ga0070665_100090791 3300005548 Bacteria 3060
106 Ga0068855_100015279 3300005563 Bacteria 9240
107 Ga0070664_100001070 3300005564 Bacteria 21563
108 Ga0070664_100056658 3300005564 Bacteria 3330
109 Ga0070664_100084080 3300005564 Bacteria 2746
110 Ga0070664_100183091 3300005564 Bacteria 1863
111 Ga0070664_100207906 3300005564 Unclassified 1748
112 Ga0070664_100274239 3300005564 Bacteria 1520
113 Ga0068857_100005178 3300005577 Bacteria 11090
114 Ga0068857_100110128 3300005577 Bacteria 2475
115 Ga0068857_100215129 3300005577 Bacteria 1754
116 Ga0068854_100071249 3300005578 Bacteria 2542
117 Ga0068854_100105931 3300005578 Bacteria 2115
118 Ga0068854_100247935 3300005578 Bacteria 1421
119 Ga0068856_100048756 3300005614 Bacteria 4174
120 Ga0068852_100019107 3300005616 Bacteria 5415
121 Ga0068852_100028078 3300005616 Bacteria 4599
122 Ga0068852_100046813 3300005616 Bacteria 3686
123 Ga0068852_100056501 3300005616 Bacteria 3392
124 Ga0068852_100096477 3300005616 Bacteria 2658
125 Ga0068859_100028028 3300005617 Bacteria 5648
126 Ga0068859_100033450 3300005617 Bacteria 5162
127 Ga0068859_100047708 3300005617 Bacteria 4303
128 Ga0068859_100218909 3300005617 Bacteria 1991
129 Ga0068859_100325251 3300005617 Bacteria 1631
130 Ga0068859_100486461 3300005617 Unclassified 1329
131 Ga0068864_100003947 3300005618 Bacteria 12221
132 Ga0068864_100006021 3300005618 Bacteria 9956
133 Ga0068864_100067640 3300005618 Bacteria 3102
134 Ga0068866_10076455 3300005718 Bacteria 1785
135 Ga0068861_100026902 3300005719 Bacteria 4185
136 Ga0068861_100030426 3300005719 Bacteria 3956
137 Ga0068861_100086060 3300005719 Bacteria 2470
138 Ga0068861_100333842 3300005719 Bacteria 1324
139 Ga0068851_10025272 3300005834 Bacteria 2913
140 Ga0068851_10052307 3300005834 Bacteria 2076
141 Ga0068851_10084774 3300005834 Unclassified 1660
142 Ga0068870_10015827 3300005840 Bacteria 3588
143 Ga0068870_10224549 3300005840 Bacteria 1151
144 Ga0068863_100030182 3300005841 Bacteria 5179
145 Ga0068863_100342827 3300005841 Bacteria 1454
146 Ga0068863_100380863 3300005841 Bacteria 1377
147 Ga0068863_100855857 3300005841 Bacteria 908
148 Ga0068858_100030523 3300005842 Bacteria 5005
149 Ga0068858_100097453 3300005842 Unclassified 2741
150 Ga0068860_100125834 3300005843 Bacteria 2456
151 Ga0068860_100362736 3300005843 Bacteria 1428
152 Ga0068860_100738426 3300005843 Bacteria 996
153 Ga0068860_100933124 3300005843 Bacteria 885
154 Ga0068862_100002324 3300005844 Bacteria 16954
155 Ga0068862_100428786 3300005844 Bacteria 1242
156 Ga0081539_10000382 3300005985 Bacteria 96235
157 Ga0070715_10015010 3300006163 Bacteria 2881
158 Ga0070715_10037199 3300006163 Bacteria 2013
159 Ga0075366_10045810 3300006195 Bacteria 2591
160 Ga0097621_100001494 3300006237 Bacteria 16035
161 Ga0097621_100006622 3300006237 Bacteria 8230
162 Ga0097621_100052257 3300006237 Bacteria 3329
163 Ga0097621_100083401 3300006237 Bacteria 2663
164 Ga0097621_100346361 3300006237 Bacteria 1320
165 Ga0068871_100000042 3300006358 Bacteria 67951
166 Ga0068871_100096271 3300006358 Bacteria 2473
167 Ga0068871_100197545 3300006358 Bacteria 1735
168 Ga0068871_100454217 3300006358 Bacteria 1149
169 Ga0068871_100478678 3300006358 Bacteria 1119
170 Ga0068871_100486578 3300006358 Bacteria 1111
171 Ga0075428_100061779 3300006844 Bacteria 4103
172 Ga0075428_100296873 3300006844 Bacteria 1737
173 Ga0075431_100009790 3300006847 Bacteria 9626
174 Ga0075431_100889535 3300006847 Bacteria 860
175 Ga0075434_100197800 3300006871 Unclassified 2030
176 Ga0075429_100013074 3300006880 Bacteria 7201
177 Ga0068865_100144601 3300006881 Bacteria 1797
178 Ga0068865_100481567 3300006881 Bacteria 1031
179 Ga0097620_100028026 3300006931 Bacteria 5648
180 Ga0097620_100033448 3300006931 Bacteria 5162
181 Ga0097620_100047710 3300006931 Bacteria 4303
182 Ga0097620_100218903 3300006931 Bacteria 1991
183 Ga0097620_100225674 3300006931 Bacteria 1961
184 Ga0097620_100325253 3300006931 Bacteria 1631
185 Ga0097620_100326441 3300006931 Bacteria 1628
186 Ga0097620_100486493 3300006931 Unclassified 1329
187 Ga0105240_10151116 3300009093 Bacteria 2765
188 Ga0105240_10966469 3300009093 Bacteria 913
189 Ga0111539_10008839 3300009094 Bacteria 12764
190 Ga0111539_10090371 3300009094 Bacteria 3599
191 Ga0111539_11232902 3300009094 Unclassified 868
192 Ga0105245_10299444 3300009098 Bacteria 1578
193 Ga0105247_10004746 3300009101 Bacteria 8654
194 Ga0114129_10058478 3300009147 Bacteria 5392
195 Ga0114129_10060533 3300009147 Bacteria 5294
196 Ga0114129_11451913 3300009147 Bacteria 845
197 Ga0105243_10336336 3300009148 Bacteria 1381
198 Ga0105243_10528873 3300009148 Bacteria 1123
199 Ga0105241_10003004 3300009174 Bacteria 12606
200 Ga0105241_10321164 3300009174 Bacteria 1335
201 Ga0105241_10474583 3300009174 Bacteria 1111
202 Ga0105242_10008553 3300009176 Bacteria 7861
203 Ga0105242_10198691 3300009176 Bacteria 1780
204 Ga0105242_10352724 3300009176 Unclassified 1359
205 Ga0105248_10007557 3300009177 Bacteria 11937
206 Ga0105248_10134257 3300009177 Bacteria 2792
207 Ga0105249_10001904 3300009553 Bacteria 18071
208 Ga0105249_10002194 3300009553 Bacteria 16909
209 Ga0105249_10021735 3300009553 Bacteria 5745
210 Ga0105249_10066945 3300009553 Bacteria 3308
211 Ga0105249_10067403 3300009553 Bacteria 3297
212 Ga0105249_10069117 3300009553 Bacteria 3259
213 Ga0105249_10085557 3300009553 Bacteria 2939
214 Ga0105249_10138241 3300009553 Bacteria 2333
215 Ga0105249_10383549 3300009553 Bacteria 1432
216 Ga0105249_10740502 3300009553 Bacteria 1045
217 Ga0105249_10816265 3300009553 Bacteria 997
218 Ga0105239_10367244 3300010375 Bacteria 1626
219 Ga0105239_10574185 3300010375 Bacteria 1285
220 Ga0105239_10737085 3300010375 Bacteria 1127
221 Ga0105246_10049901 3300011119 Bacteria 2868
222 Ga0157373_10029384 3300013100 Bacteria 3959
223 Ga0157373_10190250 3300013100 Bacteria 1446
224 Ga0157371_10097453 3300013102 Bacteria 2084
225 Ga0157369_10020846 3300013105 Bacteria 7327
226 Ga0157369_10085423 3300013105 Bacteria 3372
227 Ga0157374_10001062 3300013296 Bacteria 23840
228 Ga0157374_10101061 3300013296 Bacteria 2765
229 Ga0157374_10110798 3300013296 Bacteria 2640
230 Ga0157374_10112951 3300013296 Bacteria 2615
231 Ga0157374_10170124 3300013296 Bacteria 2125
232 Ga0157374_10446753 3300013296 Bacteria 1294
233 Ga0157374_10608708 3300013296 Bacteria 1103
234 Ga0157378_10011592 3300013297 Bacteria 7719
235 Ga0157378_10024817 3300013297 Bacteria 5279
236 Ga0157378_10081021 3300013297 Bacteria 2933
237 Ga0157378_10231130 3300013297 Bacteria 1762
238 Ga0157378_10705998 3300013297 Bacteria 1028
239 Ga0163162_10003627 3300013306 Bacteria 14800
240 Ga0163162_10118148 3300013306 Bacteria 2753
241 Ga0163162_10154104 3300013306 Bacteria 2417
242 Ga0163162_10156201 3300013306 Bacteria 2401
243 Ga0163162_10182739 3300013306 Bacteria 2223
244 Ga0163162_10242775 3300013306 Bacteria 1932
245 Ga0163162_10638358 3300013306 Bacteria 1189
246 Ga0157372_10101566 3300013307 Bacteria 3283
247 Ga0157372_10149115 3300013307 Bacteria 2698
248 Ga0157372_10735964 3300013307 Bacteria 1147
249 Ga0157372_10934493 3300013307 Bacteria 1005
250 Ga0157375_10000182 3300013308 Bacteria 59120
251 Ga0157375_10003065 3300013308 Bacteria 14505
252 Ga0157375_10075927 3300013308 Bacteria 3386
253 Ga0157375_10076323 3300013308 Bacteria 3377
254 Ga0157375_10189291 3300013308 Bacteria 2212
255 Ga0157375_10235901 3300013308 Bacteria 1988
256 Ga0157375_10244354 3300013308 Bacteria 1955
257 Ga0157375_10293429 3300013308 Bacteria 1789
258 Ga0157375_10648105 3300013308 Bacteria 1212
259 Ga0163163_10000469 3300014325 Bacteria 36859
260 Ga0163163_10001809 3300014325 Bacteria 18036
261 Ga0163163_10116370 3300014325 Bacteria 2704
262 Ga0163163_10159308 3300014325 Bacteria 2302
263 Ga0163163_10191015 3300014325 Unclassified 2096
264 Ga0163163_10307263 3300014325 Bacteria 1638
265 Ga0163163_10446966 3300014325 Bacteria 1353
266 Ga0163163_10468463 3300014325 Bacteria 1320
267 Ga0163163_10480372 3300014325 Bacteria 1304
268 Ga0157380_10000855 3300014326 Bacteria 19105
269 Ga0157380_10059048 3300014326 Bacteria 3060
270 Ga0157380_10061627 3300014326 Bacteria 3002
271 Ga0157380_10114511 3300014326 Bacteria 2273
272 Ga0157380_10259243 3300014326 Bacteria 1578
273 Ga0157380_10394527 3300014326 Bacteria 1310
274 Ga0157377_10010426 3300014745 Bacteria 4598
275 Ga0157377_10045461 3300014745 Bacteria 2453
276 Ga0157377_10088742 3300014745 Bacteria 1822
277 Ga0157379_10004353 3300014968 Bacteria 12111
278 Ga0157379_10019053 3300014968 Bacteria 6059
279 Ga0157379_10586242 3300014968 Bacteria 1040
280 Ga0157376_10001366 3300014969 Bacteria 16065
281 Ga0157376_10019837 3300014969 Bacteria 5190
282 Ga0157376_10158586 3300014969 Bacteria 2048
283 Ga0157376_10161439 3300014969 Bacteria 2032
284 Ga0163161_10004376 3300017792 Bacteria 9847
285 Ga0163161_10010124 3300017792 Bacteria 6525
286 Ga0163161_10057307 3300017792 Bacteria 2831
287 Ga0163161_10313253 3300017792 Bacteria 1239
288 Ga0163161_10388073 3300017792 Bacteria 1117
289 Ga0207666_1011411 3300025271 Bacteria 1227
290 Ga0207697_10026777 3300025315 Bacteria 2358
291 Ga0207656_10068885 3300025321 Bacteria 1569
292 Ga0207656_10116484 3300025321 Unclassified 1240
293 Ga0207642_10057092 3300025899 Bacteria 1794
294 Ga0207642_10216095 3300025899 Bacteria 1068
295 Ga0207710_10063895 3300025900 Bacteria 1675
296 Ga0207680_10000898 3300025903 Bacteria 14063
297 Ga0207680_10364392 3300025903 Bacteria 1017
298 Ga0207685_10020261 3300025905 Bacteria 2207
299 Ga0207645_10039439 3300025907 Bacteria 3026
300 Ga0207643_10016549 3300025908 Bacteria 4023
301 Ga0207643_10046810 3300025908 Bacteria 2445
302 Ga0207643_10072150 3300025908 Bacteria 1988
303 Ga0207705_10081333 3300025909 Bacteria 2361
304 Ga0207654_10005588 3300025911 Bacteria 6358
305 Ga0207654_10218654 3300025911 Bacteria 1262
306 Ga0207707_10313604 3300025912 Bacteria 1355
307 Ga0207695_10041330 3300025913 Bacteria 4935
308 Ga0207671_10010843 3300025914 Bacteria 7477
309 Ga0207660_10482647 3300025917 Bacteria 1004
310 Ga0207662_10054381 3300025918 Bacteria 2387
311 Ga0207662_10080872 3300025918 Bacteria 1983
312 Ga0207662_10105476 3300025918 Bacteria 1751
313 Ga0207662_10121686 3300025918 Bacteria 1637
314 Ga0207662_10306396 3300025918 Bacteria 1057
315 Ga0207662_10336697 3300025918 Bacteria 1010
316 Ga0207657_10033353 3300025919 Bacteria 4642
317 Ga0207649_10004821 3300025920 Bacteria 7296
318 Ga0207652_10052000 3300025921 Bacteria 3514
319 Ga0207646_10462689 3300025922 Bacteria 1144
320 Ga0207681_10005290 3300025923 Bacteria 7931
321 Ga0207650_10057151 3300025925 Bacteria 2901
322 Ga0207650_10087068 3300025925 Bacteria 2379
323 Ga0207650_10181241 3300025925 Bacteria 1678
324 Ga0207650_10319473 3300025925 Bacteria 1271
325 Ga0207650_10621149 3300025925 Bacteria 910
326 Ga0207659_10011438 3300025926 Bacteria 5607
327 Ga0207659_10110324 3300025926 Bacteria 2090
328 Ga0207659_10163781 3300025926 Bacteria 1748
329 Ga0207659_10176368 3300025926 Bacteria 1690
330 Ga0207644_10017612 3300025931 Bacteria 4830
331 Ga0207644_10036019 3300025931 Bacteria 3472
332 Ga0207644_10117091 3300025931 Bacteria 2023
333 Ga0207644_10130591 3300025931 Bacteria 1923
334 Ga0207644_10164765 3300025931 Bacteria 1726
335 Ga0207644_10279937 3300025931 Bacteria 1339
336 Ga0207644_10291369 3300025931 Bacteria 1313
337 Ga0207690_10025899 3300025932 Bacteria 3689
338 Ga0207706_10012152 3300025933 Bacteria 7843
339 Ga0207706_10021488 3300025933 Bacteria 5796
340 Ga0207706_10027810 3300025933 Bacteria 5055
341 Ga0207706_10047721 3300025933 Bacteria 3789
342 Ga0207706_10361922 3300025933 Bacteria 1260
343 Ga0207686_10000907 3300025934 Bacteria 17828
344 Ga0207686_10025685 3300025934 Bacteria 3430
345 Ga0207686_10152776 3300025934 Unclassified 1609
346 Ga0207670_10005967 3300025936 Bacteria 6726
347 Ga0207670_10050964 3300025936 Bacteria 2777
348 Ga0207670_10309280 3300025936 Bacteria 1240
349 Ga0207669_10233611 3300025937 Bacteria 1358
350 Ga0207704_10080544 3300025938 Bacteria 2103
351 Ga0207704_10183704 3300025938 Bacteria 1514
352 Ga0207691_10047912 3300025940 Bacteria 3919
353 Ga0207691_10088739 3300025940 Bacteria 2773
354 Ga0207691_10147277 3300025940 Bacteria 2072
355 Ga0207691_10197478 3300025940 Bacteria 1752
356 Ga0207689_10020086 3300025942 Bacteria 5624
357 Ga0207689_10025250 3300025942 Bacteria 4980
358 Ga0207689_10049268 3300025942 Bacteria 3475
359 Ga0207689_10061748 3300025942 Bacteria 3082
360 Ga0207689_10066701 3300025942 Bacteria 2958
361 Ga0207689_10148451 3300025942 Bacteria 1932
362 Ga0207689_10149512 3300025942 Bacteria 1925
363 Ga0207661_10023976 3300025944 Bacteria 4617
364 Ga0207679_10000296 3300025945 Bacteria 37547
365 Ga0207679_10071568 3300025945 Bacteria 2616
366 Ga0207679_10193632 3300025945 Bacteria 1693
367 Ga0207679_10230636 3300025945 Bacteria 1563
368 Ga0207679_10580711 3300025945 Bacteria 1008
369 Ga0207679_10605197 3300025945 Bacteria 988
370 Ga0207667_10110859 3300025949 Bacteria 2830
371 Ga0207667_10149436 3300025949 Bacteria 2405
372 Ga0207651_10052628 3300025960 Bacteria 2777
373 Ga0207651_10245390 3300025960 Bacteria 1462
374 Ga0207651_10256292 3300025960 Bacteria 1434
375 Ga0207651_10392043 3300025960 Unclassified 1179
376 Ga0207712_10000323 3300025961 Bacteria 43711
377 Ga0207712_10000765 3300025961 Bacteria 24158
378 Ga0207712_10032603 3300025961 Bacteria 3517
379 Ga0207712_10171678 3300025961 Bacteria 1695
380 Ga0207712_10371141 3300025961 Bacteria 1195
381 Ga0207712_10565190 3300025961 Bacteria 980
382 Ga0207668_10070685 3300025972 Bacteria 2490
383 Ga0207668_10342714 3300025972 Bacteria 1247
384 Ga0207640_10042129 3300025981 Bacteria 2909
385 Ga0207640_10159896 3300025981 Bacteria 1665
386 Ga0207640_10258356 3300025981 Bacteria 1356
387 Ga0207640_10388337 3300025981 Bacteria 1133
388 Ga0207658_10047600 3300025986 Bacteria 3139
389 Ga0207658_10075557 3300025986 Bacteria 2564
390 Ga0207658_10139610 3300025986 Bacteria 1959
391 Ga0207658_10185556 3300025986 Bacteria 1725
392 Ga0207658_10199162 3300025986 Bacteria 1671
393 Ga0207658_10374144 3300025986 Bacteria 1246
394 Ga0207677_10026710 3300026023 Bacteria 3626
395 Ga0207677_10033910 3300026023 Bacteria 3300
396 Ga0207677_10094213 3300026023 Unclassified 2185
397 Ga0207677_10215868 3300026023 Bacteria 1535
398 Ga0207677_10487355 3300026023 Bacteria 1063
399 Ga0207703_10014947 3300026035 Bacteria 6057
400 Ga0207703_10024460 3300026035 Bacteria 4751
401 Ga0207639_10010455 3300026041 Bacteria 6429
402 Ga0207639_10010661 3300026041 Bacteria 6365
403 Ga0207639_10023774 3300026041 Bacteria 4427
404 Ga0207639_10193673 3300026041 Bacteria 1738
405 Ga0207639_10457187 3300026041 Bacteria 1160
406 Ga0207639_10669139 3300026041 Bacteria 961
407 Ga0207678_10027796 3300026067 Bacteria 4939
408 Ga0207678_10385401 3300026067 Bacteria 1212
409 Ga0207708_10055038 3300026075 Bacteria 3033
410 Ga0207708_10427064 3300026075 Bacteria 1100
411 Ga0207702_10045659 3300026078 Bacteria 3686
412 Ga0207641_10000275 3300026088 Bacteria 64649
413 Ga0207641_10021151 3300026088 Bacteria 5347
414 Ga0207641_10077086 3300026088 Bacteria 2883
415 Ga0207641_10883768 3300026088 Bacteria 887
416 Ga0207648_10001807 3300026089 Bacteria 23447
417 Ga0207648_10025883 3300026089 Bacteria 5219
418 Ga0207648_10070619 3300026089 Bacteria 3044
419 Ga0207676_10005102 3300026095 Bacteria 9297
420 Ga0207676_10181940 3300026095 Bacteria 1841
421 Ga0207676_10564975 3300026095 Bacteria 1088
422 Ga0207674_10000294 3300026116 Bacteria 63206
423 Ga0207674_10011159 3300026116 Bacteria 10102
424 Ga0207674_10027667 3300026116 Bacteria 5993
425 Ga0207674_10058474 3300026116 Bacteria 3905
426 Ga0207675_100021625 3300026118 Bacteria 5990
427 Ga0207675_100079241 3300026118 Bacteria 3078
428 Ga0207675_100188234 3300026118 Bacteria 1979
429 Ga0207675_100194312 3300026118 Bacteria 1947
430 Ga0207683_10061887 3300026121 Bacteria 3295
431 Ga0207683_10083810 3300026121 Unclassified 2833
432 Ga0207683_10279781 3300026121 Bacteria 1525
433 Ga0207698_10040714 3300026142 Bacteria 3456
434 Ga0207698_10055313 3300026142 Bacteria 3058
435 Ga0207698_10146250 3300026142 Bacteria 2044
436 Ga0207698_10873444 3300026142 Bacteria 905
437 Ga0207428_10181671 3300027907 Bacteria 1589
438 Ga0268266_10158057 3300028379 Bacteria 2049
439 Ga0268265_10050814 3300028380 Bacteria 3126
440 Ga0268265_10352759 3300028380 Bacteria 1344
441 Ga0268265_10652616 3300028380 Bacteria 1011
442 Ga0268264_10086165 3300028381 Bacteria 2698
443 Ga0268264_10736593 3300028381 Bacteria 981
444 Ga0307513_10121187 3300031456 Bacteria 2582
445 Ga0307509_10021575 3300031507 Bacteria 7277
446 Ga0307509_10047454 3300031507 Bacteria 4620
447 Ga0307508_10001601 3300031616 Bacteria 25237
448 Ga0307516_10194976 3300031730 Bacteria 1749
449 Ga0373936_0039756 3300035113 Bacteria 1883
450 Ga0439439_0035355 3300041406 Bacteria 1283
451 Ga0451853_3658985 3300041512 Bacteria 1055
452 Ga0439441_045362 3300042001 Bacteria 892
453 Ga0439457_000988 3300042014 Bacteria 8559
454 Ga0439462_0003256 3300042015 Bacteria 3880
455 Ga0450923_002506 3300042125 Bacteria 2645
456 Ga0451577_0005281 3300042876 Bacteria 13277
457 Ga0466972_0162309 3300044658 Bacteria 1050
458 Ga0466966_0001553 3300044684 Bacteria 14724
459 Ga0466970_0124707 3300044765 Bacteria 1412
460 Ga0466959_0000004 3300045049 Bacteria 216815
461 Ga0466967_1558421 3300045976 Bacteria 658
462 Ga0495638_0145627 3300046460 Bacteria 1378
463 Ga0495638_0181164 3300046460 Bacteria 1202
464 Ga0495653_0052349 3300046463 Bacteria 3129
465 Ga0495686_0245331 3300047472 Bacteria 1008
466 Ga0496100_0020389 3300048903 Bacteria 3974
467 Ga0496110_0066025 3300048913 Bacteria 3199
468 Ga0496111_0051868 3300048914 Bacteria 2962
469 Ga0496114_0067750 3300048917 Bacteria 2995
470 Ga0501257_023777 3300049686 Bacteria 1454
471 Ga0501080_0256794 3300049742 Bacteria 1593
472 Ga0501044_0340440 3300049823 Bacteria 1421
473 nmdc:mga0k408_147077_c1 3300050493 Bacteria 1403
474 nmdc:mga0k408_244974_c1 3300050493 Bacteria 1070
475 nmdc:mga05p37_234205_c1 3300050507 Bacteria 2211
476 nmdc:mga09592_22708_c1 3300050508 Bacteria 5177
477 nmdc:mga06r32_28727_c1 3300050510 Bacteria 5207
478 nmdc:mga08y16_178160_c1 3300050511 Bacteria 2208
479 nmdc:mga08y16_413360_c1 3300050511 Bacteria 1379
480 nmdc:mga0n895_344963_c1 3300050512 Unclassified 1508
481 Ga0500583_0001933 3300053092 Bacteria 6082
482 Ga0500589_062643 3300053147 Bacteria 1700
483 Ga0500606_118062 3300053152 Bacteria 886
484 Ga0500611_000004 3300053727 Bacteria 253326
485 Ga0500587_004779 3300053739 Bacteria 1850

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300045976 Ga0466967_1558421 Ga0466967_1558421_15_644 209
2 3300005459 Ga0068867_100051949 Ga0068867_1000519492 231
3 3300006881 Ga0068865_100481567 Ga0068865_1004815671 231
4 3300009174 Ga0105241_10474583 Ga0105241_104745832 231
5 3300025942 Ga0207689_10025250 Ga0207689_100252503 231
6 3300025986 Ga0207658_10185556 Ga0207658_101855561 231
7 3300026089 Ga0207648_10070619 Ga0207648_100706191 231
8 3300005617 Ga0068859_100325251 Ga0068859_1003252511 232
9 3300006931 Ga0097620_100325253 Ga0097620_1003252531 232
10 3300009553 Ga0105249_10067403 Ga0105249_100674031 232
11 3300028380 Ga0268265_10352759 Ga0268265_103527592 232
12 3300005335 Ga0070666_10143318 Ga0070666_101433182 234
13 3300009094 Ga0111539_11232902 Ga0111539_112329021 234
14 3300009553 Ga0105249_10002194 Ga0105249_100021946 234
15 3300025949 Ga0207667_10110859 Ga0207667_101108592 234
16 3300044765 Ga0466970_0124707 Ga0466970_0124707_121_894 236
17 3300045049 Ga0466959_0000004 Ga0466959_0000004_85296_86069 236
18 3300005841 Ga0068863_100342827 Ga0068863_1003428273 237
19 3300009553 Ga0105249_10383549 Ga0105249_103835492 237
20 3300005329 Ga0070683_100001339 Ga0070683_1000013399 238
21 3300005334 Ga0068869_100011293 Ga0068869_1000112935 238
22 3300005338 Ga0068868_100172940 Ga0068868_1001729402 238
23 3300005340 Ga0070689_100221405 Ga0070689_1002214052 238
24 3300005344 Ga0070661_100006362 Ga0070661_1000063623 238
25 3300005354 Ga0070675_100047026 Ga0070675_1000470262 238
26 3300005364 Ga0070673_100014218 Ga0070673_1000142185 238
27 3300005535 Ga0070684_100051588 Ga0070684_1000515881 238
28 3300005564 Ga0070664_100207906 Ga0070664_1002079063 238
29 3300005577 Ga0068857_100005178 Ga0068857_1000051783 238
30 3300005617 Ga0068859_100486461 Ga0068859_1004864611 238
31 3300005618 Ga0068864_100006021 Ga0068864_1000060219 238
32 3300005834 Ga0068851_10084774 Ga0068851_100847741 238
33 3300005843 Ga0068860_100738426 Ga0068860_1007384262 238
34 3300006931 Ga0097620_100486493 Ga0097620_1004864931 238
35 3300013296 Ga0157374_10001062 Ga0157374_100010625 238
36 3300013308 Ga0157375_10189291 Ga0157375_101892913 238
37 3300014325 Ga0163163_10000469 Ga0163163_100004694 238
38 3300014745 Ga0157377_10088742 Ga0157377_100887422 238
39 3300025986 Ga0207658_10139610 Ga0207658_101396103 238
40 3300005471 Ga0070698_100003376 Ga0070698_10000337616 239
41 3300025321 Ga0207656_10116484 Ga0207656_101164841 239
42 3300025903 Ga0207680_10364392 Ga0207680_103643922 239
43 3300025918 Ga0207662_10105476 Ga0207662_101054762 239
44 3300025925 Ga0207650_10057151 Ga0207650_100571512 239
45 3300025926 Ga0207659_10163781 Ga0207659_101637812 239
46 3300025933 Ga0207706_10021488 Ga0207706_100214885 239
47 3300025936 Ga0207670_10050964 Ga0207670_100509643 239
48 3300025942 Ga0207689_10061748 Ga0207689_100617482 239
49 3300026023 Ga0207677_10033910 Ga0207677_100339104 239
50 3300026067 Ga0207678_10027796 Ga0207678_100277962 239
51 3300026088 Ga0207641_10883768 Ga0207641_108837681 239
52 3300026116 Ga0207674_10058474 Ga0207674_100584742 239
53 3300048913 Ga0496110_0066025 Ga0496110_0066025_1349_2128 239
54 3300005335 Ga0070666_10064925 Ga0070666_100649251 241
55 3300010375 Ga0105239_10574185 Ga0105239_105741851 242
56 3300025931 Ga0207644_10117091 Ga0207644_101170912 242
57 3300009094 Ga0111539_10090371 Ga0111539_100903716 244
58 3300050493 nmdc:mga0k408_147077_c1 nmdc:mga0k408_147077_c1_32_766 244
59 3300005355 Ga0070671_100274596 Ga0070671_1002745962 246
60 3300025931 Ga0207644_10130591 Ga0207644_101305912 247
61 3300005331 Ga0070670_100275108 Ga0070670_1002751082 253
62 3300005334 Ga0068869_100034231 Ga0068869_1000342314 253
63 3300005347 Ga0070668_100138631 Ga0070668_1001386312 253
64 3300005441 Ga0070700_100435959 Ga0070700_1004359591 253
65 3300005459 Ga0068867_100007009 Ga0068867_1000070098 253
66 3300005539 Ga0068853_100006785 Ga0068853_1000067852 253
67 3300005543 Ga0070672_100428694 Ga0070672_1004286942 253
68 3300005618 Ga0068864_100067640 Ga0068864_1000676403 253
69 3300005719 Ga0068861_100333842 Ga0068861_1003338422 253
70 3300005834 Ga0068851_10025272 Ga0068851_100252722 253
71 3300005843 Ga0068860_100125834 Ga0068860_1001258343 253
72 3300005843 Ga0068860_100362736 Ga0068860_1003627362 253
73 3300009148 Ga0105243_10336336 Ga0105243_103363363 253
74 3300009553 Ga0105249_10740502 Ga0105249_107405021 253
75 3300025321 Ga0207656_10068885 Ga0207656_100688853 253
76 3300025900 Ga0207710_10063895 Ga0207710_100638952 253
77 3300025909 Ga0207705_10081333 Ga0207705_100813332 253
78 3300025925 Ga0207650_10319473 Ga0207650_103194731 253
79 3300025931 Ga0207644_10291369 Ga0207644_102913691 253
80 3300025934 Ga0207686_10025685 Ga0207686_100256853 253
81 3300025942 Ga0207689_10149512 Ga0207689_101495122 253
82 3300025961 Ga0207712_10371141 Ga0207712_103711411 253
83 3300025961 Ga0207712_10565190 Ga0207712_105651901 253
84 3300026041 Ga0207639_10010455 Ga0207639_100104556 253
85 3300026075 Ga0207708_10427064 Ga0207708_104270641 253
86 3300026089 Ga0207648_10001807 Ga0207648_1000180720 253
87 3300026095 Ga0207676_10181940 Ga0207676_101819402 253
88 3300026118 Ga0207675_100021625 Ga0207675_1000216254 253
89 3300028381 Ga0268264_10086165 Ga0268264_100861653 253
90 iso_pu_bacteria 2738541278 2738724611 253
91 3300003322 rootL2_10103102 rootL2_101031023 254
92 3300005288 Ga0065714_10009752 Ga0065714_100097521 254
93 3300005290 Ga0065712_10096558 Ga0065712_100965582 254
94 3300005290 Ga0065712_10258012 Ga0065712_102580121 254
95 3300005293 Ga0065715_10180385 Ga0065715_101803852 254
96 3300005327 Ga0070658_10093815 Ga0070658_100938151 254
97 3300005329 Ga0070683_100049182 Ga0070683_1000491823 254
98 3300005330 Ga0070690_100038348 Ga0070690_1000383482 254
99 3300005331 Ga0070670_100079593 Ga0070670_1000795932 254
100 3300005334 Ga0068869_100029698 Ga0068869_1000296983 254
101 3300005334 Ga0068869_100461739 Ga0068869_1004617392 254
102 3300005334 Ga0068869_100522469 Ga0068869_1005224691 254
103 3300005335 Ga0070666_10000086 Ga0070666_100000863 254
104 3300005336 Ga0070680_100369309 Ga0070680_1003693091 254
105 3300005337 Ga0070682_100019516 Ga0070682_1000195161 254
106 3300005338 Ga0068868_100060698 Ga0068868_1000606982 254
107 3300005339 Ga0070660_100034909 Ga0070660_1000349091 254
108 3300005340 Ga0070689_100007125 Ga0070689_1000071253 254
109 3300005340 Ga0070689_100153483 Ga0070689_1001534832 254
110 3300005343 Ga0070687_100146875 Ga0070687_1001468753 254
111 3300005344 Ga0070661_100039294 Ga0070661_1000392942 254
112 3300005353 Ga0070669_100069093 Ga0070669_1000690933 254
113 3300005353 Ga0070669_100089767 Ga0070669_1000897673 254
114 3300005354 Ga0070675_100084748 Ga0070675_1000847482 254
115 3300005355 Ga0070671_100034090 Ga0070671_1000340902 254
116 3300005364 Ga0070673_100158738 Ga0070673_1001587383 254
117 3300005365 Ga0070688_100365843 Ga0070688_1003658431 254
118 3300005366 Ga0070659_100072184 Ga0070659_1000721842 254
119 3300005367 Ga0070667_100071476 Ga0070667_1000714761 254
120 3300005367 Ga0070667_100205703 Ga0070667_1002057032 254
121 3300005367 Ga0070667_100234948 Ga0070667_1002349481 254
122 3300005438 Ga0070701_10045345 Ga0070701_100453453 254
123 3300005441 Ga0070700_100071474 Ga0070700_1000714742 254
124 3300005457 Ga0070662_100031625 Ga0070662_1000316253 254
125 3300005458 Ga0070681_10174492 Ga0070681_101744922 254
126 3300005466 Ga0070685_10005117 Ga0070685_100051176 254
127 3300005466 Ga0070685_10018969 Ga0070685_100189693 254
128 3300005471 Ga0070698_100027276 Ga0070698_1000272763 254
129 3300005530 Ga0070679_100062085 Ga0070679_1000620853 254
130 3300005535 Ga0070684_100055315 Ga0070684_1000553153 254
131 3300005539 Ga0068853_100019942 Ga0068853_1000199424 254
132 3300005544 Ga0070686_100622783 Ga0070686_1006227831 254
133 3300005547 Ga0070693_100282643 Ga0070693_1002826432 254
134 3300005563 Ga0068855_100015279 Ga0068855_1000152792 254
135 3300005564 Ga0070664_100084080 Ga0070664_1000840802 254
136 3300005614 Ga0068856_100048756 Ga0068856_1000487563 254
137 3300005616 Ga0068852_100019107 Ga0068852_1000191078 254
138 3300005616 Ga0068852_100056501 Ga0068852_1000565011 254
139 3300005617 Ga0068859_100033450 Ga0068859_1000334503 254
140 3300005617 Ga0068859_100047708 Ga0068859_1000477083 254
141 3300005617 Ga0068859_100218909 Ga0068859_1002189092 254
142 3300005719 Ga0068861_100026902 Ga0068861_1000269026 254
143 3300005719 Ga0068861_100086060 Ga0068861_1000860602 254
144 3300005834 Ga0068851_10052307 Ga0068851_100523072 254
145 3300005840 Ga0068870_10015827 Ga0068870_100158273 254
146 3300005841 Ga0068863_100030182 Ga0068863_1000301823 254
147 3300005841 Ga0068863_100380863 Ga0068863_1003808631 254
148 3300005842 Ga0068858_100030523 Ga0068858_1000305233 254
149 3300005843 Ga0068860_100933124 Ga0068860_1009331241 254
150 3300005844 Ga0068862_100428786 Ga0068862_1004287861 254
151 3300006163 Ga0070715_10015010 Ga0070715_100150102 254
152 3300006237 Ga0097621_100006622 Ga0097621_1000066227 254
153 3300006237 Ga0097621_100052257 Ga0097621_1000522573 254
154 3300006237 Ga0097621_100083401 Ga0097621_1000834012 254
155 3300006358 Ga0068871_100096271 Ga0068871_1000962714 254
156 3300006358 Ga0068871_100197545 Ga0068871_1001975452 254
157 3300006358 Ga0068871_100478678 Ga0068871_1004786781 254
158 3300006844 Ga0075428_100061779 Ga0075428_1000617797 254
159 3300006847 Ga0075431_100889535 Ga0075431_1008895351 254
160 3300006931 Ga0097620_100033448 Ga0097620_1000334483 254
161 3300006931 Ga0097620_100047710 Ga0097620_1000477103 254
162 3300006931 Ga0097620_100218903 Ga0097620_1002189032 254
163 3300009098 Ga0105245_10299444 Ga0105245_102994442 254
164 3300009101 Ga0105247_10004746 Ga0105247_100047462 254
165 3300009147 Ga0114129_10058478 Ga0114129_100584785 254
166 3300009148 Ga0105243_10528873 Ga0105243_105288731 254
167 3300009174 Ga0105241_10003004 Ga0105241_1000300414 254
168 3300009176 Ga0105242_10008553 Ga0105242_100085532 254
169 3300009176 Ga0105242_10198691 Ga0105242_101986911 254
170 3300009553 Ga0105249_10001904 Ga0105249_100019042 254
171 3300009553 Ga0105249_10066945 Ga0105249_100669452 254
172 3300009553 Ga0105249_10085557 Ga0105249_100855572 254
173 3300010375 Ga0105239_10367244 Ga0105239_103672442 254
174 3300011119 Ga0105246_10049901 Ga0105246_100499012 254
175 3300013100 Ga0157373_10029384 Ga0157373_100293845 254
176 3300013102 Ga0157371_10097453 Ga0157371_100974533 254
177 3300013105 Ga0157369_10020846 Ga0157369_100208466 254
178 3300013296 Ga0157374_10101061 Ga0157374_101010611 254
179 3300013296 Ga0157374_10446753 Ga0157374_104467532 254
180 3300013296 Ga0157374_10608708 Ga0157374_106087081 254
181 3300013297 Ga0157378_10024817 Ga0157378_100248173 254
182 3300013297 Ga0157378_10231130 Ga0157378_102311301 254
183 3300013306 Ga0163162_10118148 Ga0163162_101181482 254
184 3300013306 Ga0163162_10156201 Ga0163162_101562015 254
185 3300013306 Ga0163162_10242775 Ga0163162_102427752 254
186 3300013307 Ga0157372_10101566 Ga0157372_101015664 254
187 3300013307 Ga0157372_10149115 Ga0157372_101491153 254
188 3300013308 Ga0157375_10003065 Ga0157375_100030653 254
189 3300013308 Ga0157375_10244354 Ga0157375_102443541 254
190 3300014325 Ga0163163_10307263 Ga0163163_103072633 254
191 3300014325 Ga0163163_10446966 Ga0163163_104469661 254
192 3300014326 Ga0157380_10114511 Ga0157380_101145113 254
193 3300014326 Ga0157380_10394527 Ga0157380_103945272 254
194 3300014745 Ga0157377_10010426 Ga0157377_100104261 254
195 3300014968 Ga0157379_10586242 Ga0157379_105862422 254
196 3300014969 Ga0157376_10019837 Ga0157376_100198373 254
197 3300014969 Ga0157376_10158586 Ga0157376_101585863 254
198 3300014969 Ga0157376_10161439 Ga0157376_101614393 254
199 3300017792 Ga0163161_10057307 Ga0163161_100573072 254
200 3300017792 Ga0163161_10388073 Ga0163161_103880733 254
201 3300025271 Ga0207666_1011411 Ga0207666_10114112 254
202 3300025899 Ga0207642_10216095 Ga0207642_102160952 254
203 3300025903 Ga0207680_10000898 Ga0207680_1000089815 254
204 3300025905 Ga0207685_10020261 Ga0207685_100202612 254
205 3300025908 Ga0207643_10072150 Ga0207643_100721502 254
206 3300025911 Ga0207654_10005588 Ga0207654_100055886 254
207 3300025912 Ga0207707_10313604 Ga0207707_103136042 254
208 3300025914 Ga0207671_10010843 Ga0207671_100108437 254
209 3300025917 Ga0207660_10482647 Ga0207660_104826471 254
210 3300025918 Ga0207662_10121686 Ga0207662_101216862 254
211 3300025918 Ga0207662_10306396 Ga0207662_103063962 254
212 3300025919 Ga0207657_10033353 Ga0207657_100333537 254
213 3300025921 Ga0207652_10052000 Ga0207652_100520004 254
214 3300025926 Ga0207659_10110324 Ga0207659_101103243 254
215 3300025926 Ga0207659_10176368 Ga0207659_101763682 254
216 3300025931 Ga0207644_10164765 Ga0207644_101647652 254
217 3300025933 Ga0207706_10012152 Ga0207706_100121526 254
218 3300025934 Ga0207686_10000907 Ga0207686_100009073 254
219 3300025936 Ga0207670_10005967 Ga0207670_100059673 254
220 3300025937 Ga0207669_10233611 Ga0207669_102336112 254
221 3300025940 Ga0207691_10047912 Ga0207691_100479125 254
222 3300025942 Ga0207689_10020086 Ga0207689_100200866 254
223 3300025942 Ga0207689_10148451 Ga0207689_101484512 254
224 3300025944 Ga0207661_10023976 Ga0207661_100239764 254
225 3300025945 Ga0207679_10071568 Ga0207679_100715683 254
226 3300025949 Ga0207667_10149436 Ga0207667_101494364 254
227 3300025960 Ga0207651_10245390 Ga0207651_102453901 254
228 3300025961 Ga0207712_10000323 Ga0207712_100003232 254
229 3300025961 Ga0207712_10000765 Ga0207712_1000076528 254
230 3300025972 Ga0207668_10342714 Ga0207668_103427142 254
231 3300025981 Ga0207640_10042129 Ga0207640_100421293 254
232 3300025981 Ga0207640_10258356 Ga0207640_102583562 254
233 3300025986 Ga0207658_10199162 Ga0207658_101991622 254
234 3300025986 Ga0207658_10374144 Ga0207658_103741443 254
235 3300026023 Ga0207677_10026710 Ga0207677_100267102 254
236 3300026035 Ga0207703_10024460 Ga0207703_100244602 254
237 3300026041 Ga0207639_10193673 Ga0207639_101936732 254
238 3300026041 Ga0207639_10457187 Ga0207639_104571871 254
239 3300026067 Ga0207678_10385401 Ga0207678_103854011 254
240 3300026075 Ga0207708_10055038 Ga0207708_100550382 254
241 3300026078 Ga0207702_10045659 Ga0207702_100456594 254
242 3300026088 Ga0207641_10000275 Ga0207641_1000027510 254
243 3300026088 Ga0207641_10021151 Ga0207641_100211515 254
244 3300026088 Ga0207641_10077086 Ga0207641_100770862 254
245 3300026095 Ga0207676_10564975 Ga0207676_105649752 254
246 3300026116 Ga0207674_10027667 Ga0207674_100276674 254
247 3300026118 Ga0207675_100188234 Ga0207675_1001882342 254
248 3300026118 Ga0207675_100194312 Ga0207675_1001943122 254
249 3300026121 Ga0207683_10083810 Ga0207683_100838103 254
250 3300026121 Ga0207683_10279781 Ga0207683_102797812 254
251 3300026142 Ga0207698_10040714 Ga0207698_100407143 254
252 3300028380 Ga0268265_10050814 Ga0268265_100508142 254
253 3300042125 Ga0450923_002506 Ga0450923_002506_860_1624 254
254 3300050507 nmdc:mga05p37_234205_c1 nmdc:mga05p37_234205_c1_12_776 254
255 3300050511 nmdc:mga08y16_413360_c1 nmdc:mga08y16_413360_c1_115_879 254
256 3300003203 JGI25406J46586_10019511 JGI25406J46586_100195113 255
257 3300005293 Ga0065715_10334885 Ga0065715_103348851 255
258 3300005295 Ga0065707_10007300 Ga0065707_100073001 255
259 3300005331 Ga0070670_100053216 Ga0070670_1000532161 255
260 3300005331 Ga0070670_100247359 Ga0070670_1002473591 255
261 3300005334 Ga0068869_100023442 Ga0068869_1000234424 255
262 3300005335 Ga0070666_10314965 Ga0070666_103149652 255
263 3300005337 Ga0070682_100000005 Ga0070682_100000005101 255
264 3300005338 Ga0068868_100001797 Ga0068868_10000179713 255
265 3300005338 Ga0068868_100100816 Ga0068868_1001008162 255
266 3300005340 Ga0070689_100168187 Ga0070689_1001681872 255
267 3300005343 Ga0070687_100011524 Ga0070687_1000115244 255
268 3300005344 Ga0070661_100001444 Ga0070661_10000144411 255
269 3300005347 Ga0070668_100013895 Ga0070668_1000138953 255
270 3300005353 Ga0070669_100002268 Ga0070669_1000022682 255
271 3300005355 Ga0070671_100126330 Ga0070671_1001263302 255
272 3300005364 Ga0070673_100008734 Ga0070673_1000087344 255
273 3300005364 Ga0070673_100072756 Ga0070673_1000727563 255
274 3300005365 Ga0070688_100015081 Ga0070688_1000150811 255
275 3300005365 Ga0070688_100021005 Ga0070688_1000210052 255
276 3300005366 Ga0070659_100166163 Ga0070659_1001661631 255
277 3300005367 Ga0070667_100033986 Ga0070667_1000339864 255
278 3300005367 Ga0070667_100095892 Ga0070667_1000958922 255
279 3300005367 Ga0070667_100113698 Ga0070667_1001136984 255
280 3300005441 Ga0070700_100023130 Ga0070700_1000231303 255
281 3300005456 Ga0070678_100007945 Ga0070678_1000079455 255
282 3300005456 Ga0070678_100038906 Ga0070678_1000389061 255
283 3300005457 Ga0070662_100014708 Ga0070662_1000147083 255
284 3300005457 Ga0070662_100016329 Ga0070662_1000163295 255
285 3300005457 Ga0070662_100030930 Ga0070662_1000309305 255
286 3300005457 Ga0070662_100282856 Ga0070662_1002828562 255
287 3300005457 Ga0070662_100290906 Ga0070662_1002909061 255
288 3300005459 Ga0068867_100036940 Ga0068867_1000369404 255
289 3300005459 Ga0068867_100117369 Ga0068867_1001173692 255
290 3300005466 Ga0070685_10053062 Ga0070685_100530622 255
291 3300005535 Ga0070684_100001043 Ga0070684_10000104314 255
292 3300005539 Ga0068853_100002759 Ga0068853_1000027593 255
293 3300005539 Ga0068853_100019441 Ga0068853_1000194416 255
294 3300005543 Ga0070672_100157866 Ga0070672_1001578662 255
295 3300005543 Ga0070672_100381961 Ga0070672_1003819612 255
296 3300005544 Ga0070686_100033206 Ga0070686_1000332062 255
297 3300005548 Ga0070665_100090791 Ga0070665_1000907914 255
298 3300005564 Ga0070664_100001070 Ga0070664_1000010709 255
299 3300005564 Ga0070664_100056658 Ga0070664_1000566582 255
300 3300005564 Ga0070664_100183091 Ga0070664_1001830912 255
301 3300005564 Ga0070664_100274239 Ga0070664_1002742392 255
302 3300005577 Ga0068857_100110128 Ga0068857_1001101281 255
303 3300005577 Ga0068857_100215129 Ga0068857_1002151292 255
304 3300005578 Ga0068854_100071249 Ga0068854_1000712494 255
305 3300005578 Ga0068854_100105931 Ga0068854_1001059313 255
306 3300005578 Ga0068854_100247935 Ga0068854_1002479352 255
307 3300005616 Ga0068852_100028078 Ga0068852_1000280784 255
308 3300005616 Ga0068852_100046813 Ga0068852_1000468134 255
309 3300005616 Ga0068852_100096477 Ga0068852_1000964773 255
310 3300005617 Ga0068859_100028028 Ga0068859_1000280282 255
311 3300005618 Ga0068864_100003947 Ga0068864_1000039478 255
312 3300005718 Ga0068866_10076455 Ga0068866_100764552 255
313 3300005719 Ga0068861_100030426 Ga0068861_1000304262 255
314 3300005840 Ga0068870_10224549 Ga0068870_102245493 255
315 3300005841 Ga0068863_100855857 Ga0068863_1008558571 255
316 3300005842 Ga0068858_100097453 Ga0068858_1000974534 255
317 3300005844 Ga0068862_100002324 Ga0068862_1000023242 255
318 3300005985 Ga0081539_10000382 Ga0081539_1000038284 255
319 3300006163 Ga0070715_10037199 Ga0070715_100371993 255
320 3300006195 Ga0075366_10045810 Ga0075366_100458101 255
321 3300006237 Ga0097621_100001494 Ga0097621_1000014949 255
322 3300006237 Ga0097621_100346361 Ga0097621_1003463613 255
323 3300006358 Ga0068871_100000042 Ga0068871_10000004253 255
324 3300006358 Ga0068871_100454217 Ga0068871_1004542172 255
325 3300006358 Ga0068871_100486578 Ga0068871_1004865782 255
326 3300006844 Ga0075428_100296873 Ga0075428_1002968732 255
327 3300006847 Ga0075431_100009790 Ga0075431_1000097904 255
328 3300006871 Ga0075434_100197800 Ga0075434_1001978002 255
329 3300006880 Ga0075429_100013074 Ga0075429_1000130743 255
330 3300006881 Ga0068865_100144601 Ga0068865_1001446012 255
331 3300006931 Ga0097620_100028026 Ga0097620_1000280267 255
332 3300006931 Ga0097620_100225674 Ga0097620_1002256744 255
333 3300006931 Ga0097620_100326441 Ga0097620_1003264412 255
334 3300009093 Ga0105240_10151116 Ga0105240_101511164 255
335 3300009093 Ga0105240_10966469 Ga0105240_109664692 255
336 3300009094 Ga0111539_10008839 Ga0111539_1000883910 255
337 3300009147 Ga0114129_10060533 Ga0114129_100605333 255
338 3300009147 Ga0114129_11451913 Ga0114129_114519131 255
339 3300009174 Ga0105241_10321164 Ga0105241_103211641 255
340 3300009176 Ga0105242_10352724 Ga0105242_103527242 255
341 3300009177 Ga0105248_10007557 Ga0105248_1000755711 255
342 3300009177 Ga0105248_10134257 Ga0105248_101342572 255
343 3300009553 Ga0105249_10021735 Ga0105249_100217357 255
344 3300009553 Ga0105249_10069117 Ga0105249_100691173 255
345 3300009553 Ga0105249_10138241 Ga0105249_101382413 255
346 3300009553 Ga0105249_10816265 Ga0105249_108162652 255
347 3300010375 Ga0105239_10737085 Ga0105239_107370852 255
348 3300013100 Ga0157373_10190250 Ga0157373_101902502 255
349 3300013105 Ga0157369_10085423 Ga0157369_100854233 255
350 3300013296 Ga0157374_10110798 Ga0157374_101107983 255
351 3300013296 Ga0157374_10112951 Ga0157374_101129512 255
352 3300013296 Ga0157374_10170124 Ga0157374_101701242 255
353 3300013297 Ga0157378_10011592 Ga0157378_100115922 255
354 3300013297 Ga0157378_10081021 Ga0157378_100810212 255
355 3300013297 Ga0157378_10705998 Ga0157378_107059981 255
356 3300013306 Ga0163162_10003627 Ga0163162_1000362711 255
357 3300013306 Ga0163162_10154104 Ga0163162_101541042 255
358 3300013306 Ga0163162_10182739 Ga0163162_101827393 255
359 3300013306 Ga0163162_10638358 Ga0163162_106383582 255
360 3300013307 Ga0157372_10735964 Ga0157372_107359641 255
361 3300013307 Ga0157372_10934493 Ga0157372_109344931 255
362 3300013308 Ga0157375_10000182 Ga0157375_1000018213 255
363 3300013308 Ga0157375_10075927 Ga0157375_100759271 255
364 3300013308 Ga0157375_10076323 Ga0157375_100763231 255
365 3300013308 Ga0157375_10235901 Ga0157375_102359011 255
366 3300013308 Ga0157375_10293429 Ga0157375_102934293 255
367 3300013308 Ga0157375_10648105 Ga0157375_106481051 255
368 3300014325 Ga0163163_10001809 Ga0163163_1000180914 255
369 3300014325 Ga0163163_10116370 Ga0163163_101163702 255
370 3300014325 Ga0163163_10159308 Ga0163163_101593082 255
371 3300014325 Ga0163163_10191015 Ga0163163_101910152 255
372 3300014325 Ga0163163_10468463 Ga0163163_104684632 255
373 3300014325 Ga0163163_10480372 Ga0163163_104803723 255
374 3300014326 Ga0157380_10000855 Ga0157380_1000085515 255
375 3300014326 Ga0157380_10059048 Ga0157380_100590481 255
376 3300014326 Ga0157380_10061627 Ga0157380_100616274 255
377 3300014326 Ga0157380_10259243 Ga0157380_102592432 255
378 3300014745 Ga0157377_10045461 Ga0157377_100454612 255
379 3300014968 Ga0157379_10004353 Ga0157379_1000435313 255
380 3300014968 Ga0157379_10019053 Ga0157379_100190535 255
381 3300014969 Ga0157376_10001366 Ga0157376_1000136610 255
382 3300017792 Ga0163161_10004376 Ga0163161_100043766 255
383 3300017792 Ga0163161_10010124 Ga0163161_100101245 255
384 3300017792 Ga0163161_10313253 Ga0163161_103132531 255
385 3300025315 Ga0207697_10026777 Ga0207697_100267773 255
386 3300025899 Ga0207642_10057092 Ga0207642_100570922 255
387 3300025907 Ga0207645_10039439 Ga0207645_100394394 255
388 3300025908 Ga0207643_10016549 Ga0207643_100165494 255
389 3300025908 Ga0207643_10046810 Ga0207643_100468103 255
390 3300025911 Ga0207654_10218654 Ga0207654_102186542 255
391 3300025913 Ga0207695_10041330 Ga0207695_100413304 255
392 3300025918 Ga0207662_10054381 Ga0207662_100543814 255
393 3300025918 Ga0207662_10080872 Ga0207662_100808723 255
394 3300025918 Ga0207662_10336697 Ga0207662_103366971 255
395 3300025920 Ga0207649_10004821 Ga0207649_100048212 255
396 3300025922 Ga0207646_10462689 Ga0207646_104626891 255
397 3300025923 Ga0207681_10005290 Ga0207681_100052909 255
398 3300025925 Ga0207650_10087068 Ga0207650_100870682 255
399 3300025925 Ga0207650_10181241 Ga0207650_101812412 255
400 3300025925 Ga0207650_10621149 Ga0207650_106211491 255
401 3300025926 Ga0207659_10011438 Ga0207659_100114382 255
402 3300025931 Ga0207644_10017612 Ga0207644_100176124 255
403 3300025931 Ga0207644_10036019 Ga0207644_100360192 255
404 3300025931 Ga0207644_10279937 Ga0207644_102799372 255
405 3300025932 Ga0207690_10025899 Ga0207690_100258992 255
406 3300025933 Ga0207706_10027810 Ga0207706_100278102 255
407 3300025933 Ga0207706_10047721 Ga0207706_100477212 255
408 3300025933 Ga0207706_10361922 Ga0207706_103619221 255
409 3300025934 Ga0207686_10152776 Ga0207686_101527762 255
410 3300025936 Ga0207670_10309280 Ga0207670_103092801 255
411 3300025938 Ga0207704_10080544 Ga0207704_100805443 255
412 3300025938 Ga0207704_10183704 Ga0207704_101837041 255
413 3300025940 Ga0207691_10088739 Ga0207691_100887392 255
414 3300025940 Ga0207691_10147277 Ga0207691_101472773 255
415 3300025940 Ga0207691_10197478 Ga0207691_101974782 255
416 3300025942 Ga0207689_10049268 Ga0207689_100492682 255
417 3300025942 Ga0207689_10066701 Ga0207689_100667013 255
418 3300025945 Ga0207679_10000296 Ga0207679_1000029629 255
419 3300025945 Ga0207679_10193632 Ga0207679_101936322 255
420 3300025945 Ga0207679_10230636 Ga0207679_102306361 255
421 3300025945 Ga0207679_10580711 Ga0207679_105807111 255
422 3300025945 Ga0207679_10605197 Ga0207679_106051972 255
423 3300025960 Ga0207651_10052628 Ga0207651_100526283 255
424 3300025960 Ga0207651_10256292 Ga0207651_102562922 255
425 3300025960 Ga0207651_10392043 Ga0207651_103920432 255
426 3300025961 Ga0207712_10032603 Ga0207712_100326034 255
427 3300025961 Ga0207712_10171678 Ga0207712_101716781 255
428 3300025972 Ga0207668_10070685 Ga0207668_100706853 255
429 3300025981 Ga0207640_10159896 Ga0207640_101598962 255
430 3300025981 Ga0207640_10388337 Ga0207640_103883371 255
431 3300025986 Ga0207658_10047600 Ga0207658_100476004 255
432 3300025986 Ga0207658_10075557 Ga0207658_100755572 255
433 3300026023 Ga0207677_10094213 Ga0207677_100942134 255
434 3300026023 Ga0207677_10215868 Ga0207677_102158681 255
435 3300026023 Ga0207677_10487355 Ga0207677_104873552 255
436 3300026035 Ga0207703_10014947 Ga0207703_100149476 255
437 3300026041 Ga0207639_10010661 Ga0207639_100106614 255
438 3300026041 Ga0207639_10023774 Ga0207639_100237741 255
439 3300026041 Ga0207639_10669139 Ga0207639_106691391 255
440 3300026089 Ga0207648_10025883 Ga0207648_100258834 255
441 3300026095 Ga0207676_10005102 Ga0207676_100051025 255
442 3300026116 Ga0207674_10000294 Ga0207674_1000029426 255
443 3300026116 Ga0207674_10011159 Ga0207674_1001115910 255
444 3300026118 Ga0207675_100079241 Ga0207675_1000792413 255
445 3300026121 Ga0207683_10061887 Ga0207683_100618872 255
446 3300026142 Ga0207698_10055313 Ga0207698_100553131 255
447 3300026142 Ga0207698_10146250 Ga0207698_101462501 255
448 3300026142 Ga0207698_10873444 Ga0207698_108734441 255
449 3300027907 Ga0207428_10181671 Ga0207428_101816712 255
450 3300028379 Ga0268266_10158057 Ga0268266_101580572 255
451 3300028380 Ga0268265_10652616 Ga0268265_106526161 255
452 3300028381 Ga0268264_10736593 Ga0268264_107365931 255
453 3300031456 Ga0307513_10121187 Ga0307513_101211873 255
454 3300031507 Ga0307509_10021575 Ga0307509_1002157511 255
455 3300031507 Ga0307509_10047454 Ga0307509_100474548 255
456 3300031616 Ga0307508_10001601 Ga0307508_1000160119 255
457 3300031730 Ga0307516_10194976 Ga0307516_101949764 255
458 3300035113 Ga0373936_0039756 Ga0373936_0039756_232_999 255
459 3300041406 Ga0439439_0035355 Ga0439439_0035355_50_823 255
460 3300041512 Ga0451853_3658985 Ga0451853_3658985_72_845 255
461 3300042001 Ga0439441_045362 Ga0439441_045362_11_778 255
462 3300042014 Ga0439457_000988 Ga0439457_000988_373_1146 255
463 3300042015 Ga0439462_0003256 Ga0439462_0003256_2543_3316 255
464 3300042876 Ga0451577_0005281 Ga0451577_0005281_4434_5246 255
465 3300044658 Ga0466972_0162309 Ga0466972_0162309_86_859 255
466 3300044684 Ga0466966_0001553 Ga0466966_0001553_753_1526 255
467 3300046460 Ga0495638_0145627 Ga0495638_0145627_596_1366 255
468 3300046460 Ga0495638_0181164 Ga0495638_0181164_319_1089 255
469 3300046463 Ga0495653_0052349 Ga0495653_0052349_1861_2628 255
470 3300047472 Ga0495686_0245331 Ga0495686_0245331_145_912 255
471 3300048903 Ga0496100_0020389 Ga0496100_0020389_2672_3484 255
472 3300048914 Ga0496111_0051868 Ga0496111_0051868_1972_2739 255
473 3300048917 Ga0496114_0067750 Ga0496114_0067750_1836_2603 255
474 3300049686 Ga0501257_023777 Ga0501257_023777_154_927 255
475 3300049742 Ga0501080_0256794 Ga0501080_0256794_213_986 255
476 3300049823 Ga0501044_0340440 Ga0501044_0340440_199_990 255
477 3300050493 nmdc:mga0k408_244974_c1 nmdc:mga0k408_244974_c1_106_879 255
478 3300050508 nmdc:mga09592_22708_c1 nmdc:mga09592_22708_c1_2429_3202 255
479 3300050510 nmdc:mga06r32_28727_c1 nmdc:mga06r32_28727_c1_1361_2134 255
480 3300050511 nmdc:mga08y16_178160_c1 nmdc:mga08y16_178160_c1_1124_1891 255
481 3300050512 nmdc:mga0n895_344963_c1 nmdc:mga0n895_344963_c1_390_1157 255
482 3300053092 Ga0500583_0001933 Ga0500583_0001933_3378_4151 255
483 3300053147 Ga0500589_062643 Ga0500589_062643_788_1561 255
484 3300053152 Ga0500606_118062 Ga0500606_118062_53_826 255
485 3300053727 Ga0500611_000004 Ga0500611_000004_154681_155451 255
486 3300053739 Ga0500587_004779 Ga0500587_004779_951_1724 255

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01026

TatD_DNase

TatD related DNase

114

237

0.97

PF01026

TatD_DNase

TatD related DNase

6

115

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2gzx-assembly2.cif.gz_B crystal structure of the tatd deoxyribonuclease mw0446 from staphylococcus aureus. northeast structural genomics consortium target zr237. 0.9128 3 253
1zzm-assembly1.cif.gz_A crystal structure of yjjv, tatd homolog from escherichia coli k12, at 1.8 a resolution 0.9048 3 255
2gzx-assembly2.cif.gz_B crystal structure of the tatd deoxyribonuclease mw0446 from staphylococcus aureus. northeast structural genomics consortium target zr237. 0.9025 3 253
1j6o-assembly1.cif.gz_A crystal structure of tatd-related deoxyribonuclease (tm0667) from thermotoga maritima at 1.8 a resolution 0.8989 2 255
1yix-assembly2.cif.gz_B crystal structure of ycfh, tatd homolog from escherichia coli k12, at 1.9 a resolution 0.8967 1 254
ID Description Score Start End Superfamily
af_Q58977_2_248_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.919 2 254 3.20.20.140
af_P39408_1_259_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9069 1 254 3.20.20.140
2gzxB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9063 3 253 3.20.20.140
af_P39408_1_259_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9001 1 254 3.20.20.140
2gzxB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8994 3 253 3.20.20.140
ID Description Score Start End GO Terms
AF-A0A5S3VSQ5-F1-model_v4 Hydrolase TatD 0.9974 116 194 GO:0005829
GO:0016788
AF-A0A2W5F1J2-F1-model_v4 Hydrolase TatD 0.9808 1 143 GO:0005829
GO:0016788
AF-A0A4Q6AK01-F1-model_v4 TatD family deoxyribonuclease 0.9807 1 203 GO:0005829
GO:0016788
GO:0046872
AF-A0A4Q6DCX6-F1-model_v4 deleted 0.9779 1 186
AF-A0A2J6I5D9-F1-model_v4 Hydrolase TatD 0.9765 1 120 GO:0005829
GO:0016788

Feature Viewer

pLDDT pTM Quality
93.75 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map