F453285

General Info

Members Datasets Scaffolds Average Seq Length
486 274 478 145

Family's Representative Sequence

Representative Sequence 3300031456|Ga0307513_10000051|Ga0307513_1000005157
Length 156
Sequence MKGWEEVMNFGADIPFVNHLGFELELFTGGASAIGYTPKPEHLNSFAVTHGGAIMTLLDVTMATAARSVDKDMGVVTIEMKTSFMRPAPGDGSRLTAKGRLMHRTKTMAFTEATLYDVLGQACAHSTGTFKYVKRLPTGPESANAPNGPDGAISTD

Samples

Sample ID Description Type Environment
1 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
2 2643221570 Acidovorax sp. Root568 Isolate Unclassified
3 2643221596 Acidovorax sp. Root70 Isolate Unclassified
4 2643221652 Acidovorax sp. Root402 Isolate Unclassified
5 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
6 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
7 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
8 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
9 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
10 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
11 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
12 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
13 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
14 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
15 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
16 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
17 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
18 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
19 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
20 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
21 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
22 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
23 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
24 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
25 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
26 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
27 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
28 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
29 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
30 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
31 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
32 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
33 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
34 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
35 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
36 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
37 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
38 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
39 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
40 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
41 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
42 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
47 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
48 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
64 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
65 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
66 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
67 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
68 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
69 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
70 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
73 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
90 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
91 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
92 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
93 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
94 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
95 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
96 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
97 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
98 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
99 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
100 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
102 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
103 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
104 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
106 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
107 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
142 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
143 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
147 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
148 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
149 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
150 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
151 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
152 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
153 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
154 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
155 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
156 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
157 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
158 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
159 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
160 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
161 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
162 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
163 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
164 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
165 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
166 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
167 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
168 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
169 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
170 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
171 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
172 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
173 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
174 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
175 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
176 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
177 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
178 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
179 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
180 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
181 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
182 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
183 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
184 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
185 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
186 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
187 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
188 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
189 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
190 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
191 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
192 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
193 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
194 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
195 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
196 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
197 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
198 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
199 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
200 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
201 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
202 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
203 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
204 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
205 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
206 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
207 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
208 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
209 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
210 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
211 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
212 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
213 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
214 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
215 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
216 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
217 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
218 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
219 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
220 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
221 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
222 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
223 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
224 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
225 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
226 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
227 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
228 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
229 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
230 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
231 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
232 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
233 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
234 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
235 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
236 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
237 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
238 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
246 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
247 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
248 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
249 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
250 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
251 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
252 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
253 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
254 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
255 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
256 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
257 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
258 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
259 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
260 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
261 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
262 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
263 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
264 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
265 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
266 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
267 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
268 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
269 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
270 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
271 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
272 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
273 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
274 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.35
Metatranscriptomes 0
Isolates 1.65

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 30.25
Nodule 0.21
Rhizoplane 1.03
Rhizosphere 59.26
Stem 0
Stem Tuber 0
Unclassified 9.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000002 3300002704 Bacteria 292156
2 JGI25156J39149_1000003 3300002705 Bacteria 305434
3 JGI25154J39366_1000009 3300002738 Bacteria 305408
4 JGI25157J39369_1000002 3300002741 Bacteria 305434
5 JGI25159J45721_1000302 3300002987 Bacteria 23151
6 JGI25159J45721_1000502 3300002987 Bacteria 17895
7 JGI25151J46595_10017838 3300003187 Bacteria 3065
8 JGI25151J46595_10025203 3300003187 Bacteria 2423
9 JGI25151J46595_10044421 3300003187 Bacteria 1578
10 rootH1_10025590 3300003316 Bacteria 1210
11 JGI25160J50197_1000145 3300003354 Bacteria 63479
12 JGI25161J50226_1000032 3300003374 Bacteria 138440
13 JGI25161J50226_1000064 3300003374 Bacteria 99448
14 Ga0055526_1003563 3300003771 Bacteria 9805
15 Ga0055526_1009997 3300003771 Bacteria 4477
16 Ga0055537_1000043 3300003773 Bacteria 90816
17 Ga0055537_1008563 3300003773 Bacteria 2346
18 Ga0055524_1000012 3300003775 Bacteria 260384
19 Ga0055536_1004794 3300003781 Bacteria 6779
20 Ga0055534_1005165 3300003784 Bacteria 3576
21 Ga0055528_1000717 3300003790 Bacteria 23401
22 Ga0055530_10000015 3300003791 Bacteria 148790
23 Ga0055530_10035307 3300003791 Bacteria 1269
24 Ga0055530_10089805 3300003791 Bacteria 632
25 Ga0055540_1000012 3300003792 Bacteria 262667
26 Ga0055540_1000039 3300003792 Bacteria 161844
27 Ga0055540_1013853 3300003792 Bacteria 2440
28 Ga0055531_10001591 3300003794 Bacteria 16513
29 Ga0055531_10006340 3300003794 Bacteria 6734
30 Ga0055531_10114267 3300003794 Bacteria 535
31 Ga0055543_1000752 3300004625 Bacteria 16244
32 Ga0065165_1007478 3300005262 Bacteria 5355
33 Ga0065165_1016049 3300005262 Bacteria 2823
34 Ga0065165_1016671 3300005262 Bacteria 2741
35 Ga0065165_1065678 3300005262 Bacteria 978
36 Ga0065704_10162087 3300005289 Bacteria 1347
37 Ga0070658_10449559 3300005327 Bacteria 1110
38 Ga0070658_10690412 3300005327 Bacteria 886
39 Ga0070676_10006620 3300005328 Bacteria 6199
40 Ga0070676_10539101 3300005328 Bacteria 834
41 Ga0070670_100086168 3300005331 Bacteria 2699
42 Ga0070677_10029917 3300005333 Bacteria 2069
43 Ga0068869_100126428 3300005334 Bacteria 1961
44 Ga0068869_100621262 3300005334 Bacteria 915
45 Ga0068869_100918619 3300005334 Bacteria 758
46 Ga0070660_100018535 3300005339 Bacteria 5087
47 Ga0070660_100138639 3300005339 Bacteria 1950
48 Ga0070660_100550925 3300005339 Bacteria 962
49 Ga0070675_100052440 3300005354 Bacteria 3354
50 Ga0070675_101290187 3300005354 Bacteria 673
51 Ga0070675_101356500 3300005354 Bacteria 655
52 Ga0070671_100005987 3300005355 Bacteria 9690
53 Ga0070674_100175406 3300005356 Bacteria 1637
54 Ga0070688_100414238 3300005365 Bacteria 1000
55 Ga0070659_100311208 3300005366 Bacteria 1315
56 Ga0070659_101104825 3300005366 Bacteria 699
57 Ga0070667_101011891 3300005367 Bacteria 775
58 Ga0070708_100136582 3300005445 Bacteria 2272
59 Ga0070678_100081929 3300005456 Bacteria 2448
60 Ga0070678_100252417 3300005456 Bacteria 1479
61 Ga0070662_100116649 3300005457 Bacteria 2041
62 Ga0070662_100228057 3300005457 Bacteria 1489
63 Ga0068867_100003980 3300005459 Bacteria 10393
64 Ga0070706_100001360 3300005467 Bacteria 25993
65 Ga0070707_100026346 3300005468 Bacteria 5520
66 Ga0070698_100735145 3300005471 Bacteria 929
67 Ga0070679_100032501 3300005530 Bacteria 5162
68 Ga0068853_100051532 3300005539 Bacteria 3542
69 Ga0068853_100177477 3300005539 Bacteria 1930
70 Ga0070672_100089700 3300005543 Bacteria 2477
71 Ga0070665_100178385 3300005548 Bacteria 2125
72 Ga0070665_100253303 3300005548 Bacteria 1761
73 Ga0068855_100143829 3300005563 Bacteria 2716
74 Ga0068855_100211523 3300005563 Bacteria 2179
75 Ga0068857_100064931 3300005577 Bacteria 3245
76 Ga0068857_101365537 3300005577 Bacteria 689
77 Ga0068852_100026931 3300005616 Bacteria 4680
78 Ga0068859_100151336 3300005617 Bacteria 2396
79 Ga0068859_100477168 3300005617 Bacteria 1343
80 Ga0068859_100891965 3300005617 Bacteria 974
81 Ga0068864_100045701 3300005618 Bacteria 3756
82 Ga0068866_10925132 3300005718 Bacteria 615
83 Ga0068870_10046046 3300005840 Bacteria 2286
84 Ga0068863_100032370 3300005841 Bacteria 4984
85 Ga0068863_101183712 3300005841 Bacteria 770
86 Ga0068860_101294542 3300005843 Bacteria 750
87 Ga0068862_102651930 3300005844 Bacteria 513
88 Ga0075365_10122998 3300006038 Bacteria 1791
89 Ga0075365_10443517 3300006038 Bacteria 917
90 Ga0075365_10539421 3300006038 Bacteria 825
91 Ga0075368_10024418 3300006042 Bacteria 2316
92 Ga0075368_10050310 3300006042 Bacteria 1655
93 Ga0075363_100039003 3300006048 Bacteria 2499
94 Ga0075363_100039336 3300006048 Bacteria 2489
95 Ga0075363_100065425 3300006048 Bacteria 1966
96 Ga0075363_100080366 3300006048 Bacteria 1783
97 Ga0075364_10036191 3300006051 Bacteria 3191
98 Ga0075362_10002742 3300006177 Bacteria 6002
99 Ga0075362_10008420 3300006177 Bacteria 3942
100 Ga0075362_10091260 3300006177 Bacteria 1414
101 Ga0075362_10257762 3300006177 Bacteria 859
102 Ga0075362_10385898 3300006177 Bacteria 705
103 Ga0075367_10030320 3300006178 Bacteria 3100
104 Ga0075367_10246968 3300006178 Bacteria 1119
105 Ga0075367_10348576 3300006178 Bacteria 934
106 Ga0075367_10378481 3300006178 Bacteria 894
107 Ga0075367_10626653 3300006178 Bacteria 684
108 Ga0075369_10025400 3300006186 Bacteria 2463
109 Ga0075366_10002134 3300006195 Bacteria 10056
110 Ga0075366_10014460 3300006195 Bacteria 4508
111 Ga0075366_10054094 3300006195 Bacteria 2384
112 Ga0075366_10216685 3300006195 Bacteria 1166
113 Ga0075366_10347115 3300006195 Bacteria 911
114 Ga0075366_10787175 3300006195 Bacteria 591
115 Ga0097621_100355824 3300006237 Bacteria 1303
116 Ga0097621_100713975 3300006237 Bacteria 924
117 Ga0075370_10002071 3300006353 Bacteria 9132
118 Ga0075370_10033696 3300006353 Bacteria 2868
119 Ga0075370_10087589 3300006353 Bacteria 1794
120 Ga0075370_10088879 3300006353 Bacteria 1781
121 Ga0075370_10195532 3300006353 Bacteria 1193
122 Ga0075370_10410574 3300006353 Bacteria 813
123 Ga0075430_100135513 3300006846 Bacteria 2052
124 Ga0068865_100126747 3300006881 Bacteria 1907
125 Ga0068865_101480328 3300006881 Bacteria 608
126 Ga0097620_100151343 3300006931 Bacteria 2396
127 Ga0097620_100477191 3300006931 Bacteria 1343
128 Ga0097620_100892237 3300006931 Bacteria 974
129 Ga0079104_1016249 3300006946 Bacteria 2182
130 Ga0105240_10001089 3300009093 Bacteria 47935
131 Ga0105245_10022835 3300009098 Bacteria 5489
132 Ga0105245_10218041 3300009098 Bacteria 1840
133 Ga0105245_11547564 3300009098 Bacteria 714
134 Ga0105243_10025185 3300009148 Bacteria 4544
135 Ga0105243_10295782 3300009148 Bacteria 1465
136 Ga0105243_10685493 3300009148 Bacteria 997
137 Ga0105243_12021905 3300009148 Bacteria 611
138 Ga0105241_10097627 3300009174 Bacteria 2330
139 Ga0105242_10006633 3300009176 Bacteria 8927
140 Ga0105242_11292997 3300009176 Bacteria 753
141 Ga0105237_10052299 3300009545 Bacteria 4101
142 Ga0105238_10052600 3300009551 Bacteria 4094
143 Ga0105238_11056861 3300009551 Bacteria 834
144 Ga0105249_12196901 3300009553 Bacteria 625
145 Ga0105239_10021489 3300010375 Bacteria 7115
146 Ga0105246_10030595 3300011119 Bacteria 3557
147 Ga0163162_10281552 3300013306 Bacteria 1795
148 Ga0163162_10402132 3300013306 Bacteria 1502
149 Ga0157375_10041640 3300013308 Bacteria 4437
150 Ga0157375_10551604 3300013308 Bacteria 1314
151 Ga0157380_10661754 3300014326 Bacteria 1043
152 Ga0157377_10371993 3300014745 Bacteria 965
153 Ga0209435_100001 3300025206 Bacteria 1424171
154 Ga0207425_1008756 3300025245 Bacteria 2563
155 Ga0209646_1000001 3300025246 Bacteria 3092932
156 Ga0209026_1000003 3300025250 Bacteria 1060571
157 Ga0209759_1000001 3300025256 Bacteria 2799452
158 Ga0209565_1000004 3300025263 Bacteria 983150
159 Ga0209565_1001286 3300025263 Bacteria 11626
160 Ga0209673_1000357 3300025273 Bacteria 82249
161 Ga0209673_1050378 3300025273 Bacteria 1106
162 Ga0209130_1000082 3300025284 Bacteria 164441
163 Ga0209130_1000094 3300025284 Bacteria 145569
164 Ga0209675_1000061 3300025291 Bacteria 181096
165 Ga0209675_1006569 3300025291 Bacteria 4633
166 Ga0209676_1000029 3300025292 Bacteria 520536
167 Ga0209676_1003883 3300025292 Bacteria 8718
168 Ga0209025_1006826 3300025294 Bacteria 8715
169 Ga0209025_1007422 3300025294 Bacteria 8182
170 Ga0209025_1033881 3300025294 Bacteria 2348
171 Ga0209025_1058171 3300025294 Bacteria 1471
172 Ga0209564_1000969 3300025295 Bacteria 36292
173 Ga0209564_1002810 3300025295 Bacteria 12935
174 Ga0209564_1010108 3300025295 Bacteria 4392
175 Ga0209758_1003972 3300025297 Bacteria 12820
176 Ga0209050_1000003 3300025298 Bacteria 1609245
177 Ga0209050_1005923 3300025298 Bacteria 7452
178 Ga0209050_1015438 3300025298 Bacteria 3208
179 Ga0209256_1000001 3300025299 Bacteria 2166974
180 Ga0207426_1000025 3300025302 Bacteria 532921
181 Ga0207426_1033316 3300025302 Bacteria 1662
182 Ga0209051_1000003 3300025303 Bacteria 1609245
183 Ga0209051_1000078 3300025303 Bacteria 201965
184 Ga0209051_1107143 3300025303 Bacteria 737
185 Ga0209257_1000012 3300025304 Bacteria 1111138
186 Ga0209257_1000018 3300025304 Bacteria 836016
187 Ga0209257_1014547 3300025304 Bacteria 3372
188 Ga0207682_10217373 3300025893 Bacteria 883
189 Ga0207645_10002443 3300025907 Bacteria 14624
190 Ga0207645_10271683 3300025907 Bacteria 1124
191 Ga0207643_10091900 3300025908 Bacteria 1770
192 Ga0207705_10220744 3300025909 Bacteria 1440
193 Ga0207705_10626424 3300025909 Bacteria 836
194 Ga0207684_10029430 3300025910 Bacteria 4677
195 Ga0207654_10170131 3300025911 Bacteria 1414
196 Ga0207695_10038007 3300025913 Bacteria 5189
197 Ga0207695_10049144 3300025913 Bacteria 4449
198 Ga0207671_10028247 3300025914 Bacteria 4192
199 Ga0207657_10054433 3300025919 Bacteria 3460
200 Ga0207657_10139848 3300025919 Bacteria 1979
201 Ga0207657_10538331 3300025919 Bacteria 913
202 Ga0207652_10073160 3300025921 Bacteria 2981
203 Ga0207694_10127612 3300025924 Bacteria 2036
204 Ga0207650_10065460 3300025925 Bacteria 2724
205 Ga0207650_10164783 3300025925 Bacteria 1758
206 Ga0207659_10030899 3300025926 Bacteria 3663
207 Ga0207659_10256582 3300025926 Bacteria 1421
208 Ga0207687_10229185 3300025927 Bacteria 1467
209 Ga0207687_10350600 3300025927 Bacteria 1202
210 Ga0207644_10034779 3300025931 Bacteria 3527
211 Ga0207690_10172889 3300025932 Bacteria 1620
212 Ga0207690_10554196 3300025932 Bacteria 935
213 Ga0207706_10036208 3300025933 Bacteria 4384
214 Ga0207706_10420501 3300025933 Bacteria 1158
215 Ga0207686_10009207 3300025934 Bacteria 5356
216 Ga0207709_10344530 3300025935 Bacteria 1123
217 Ga0207709_10353165 3300025935 Bacteria 1110
218 Ga0207669_10719812 3300025937 Bacteria 822
219 Ga0207669_11068475 3300025937 Bacteria 680
220 Ga0207704_10065298 3300025938 Bacteria 2278
221 Ga0207691_10019248 3300025940 Bacteria 6463
222 Ga0207689_10051305 3300025942 Bacteria 3401
223 Ga0207689_10346437 3300025942 Bacteria 1235
224 Ga0207667_10114656 3300025949 Bacteria 2778
225 Ga0207667_10281311 3300025949 Bacteria 1700
226 Ga0207668_10899026 3300025972 Bacteria 788
227 Ga0207677_10702109 3300026023 Bacteria 898
228 Ga0207639_10066789 3300026041 Bacteria 2797
229 Ga0207639_10070432 3300026041 Bacteria 2731
230 Ga0207639_10713879 3300026041 Bacteria 931
231 Ga0207648_10005998 3300026089 Bacteria 12142
232 Ga0207648_10139452 3300026089 Bacteria 2137
233 Ga0207676_10074356 3300026095 Bacteria 2737
234 Ga0207674_10011244 3300026116 Bacteria 10060
235 Ga0207674_10097996 3300026116 Bacteria 2915
236 Ga0207675_100745939 3300026118 Bacteria 990
237 Ga0207683_10079277 3300026121 Bacteria 2911
238 Ga0209813_10007691 3300027866 Bacteria 2693
239 Ga0209813_10048137 3300027866 Bacteria 1322
240 Ga0209813_10075203 3300027866 Bacteria 1106
241 Ga0207428_10177411 3300027907 Bacteria 1611
242 Ga0268266_10032323 3300028379 Bacteria 4446
243 Ga0268266_10864171 3300028379 Bacteria 874
244 Ga0268265_10471422 3300028380 Bacteria 1177
245 Ga0268264_10376828 3300028381 Bacteria 1358
246 Ga0268264_11984408 3300028381 Bacteria 591
247 Ga0307517_10105031 3300028786 Bacteria 2195
248 Ga0307517_10125962 3300028786 Bacteria 1869
249 Ga0307517_10160721 3300028786 Bacteria 1509
250 Ga0307515_10002977 3300028794 Bacteria 35954
251 Ga0307515_10103741 3300028794 Bacteria 3405
252 Ga0307515_10121837 3300028794 Bacteria 2947
253 Ga0307515_10249927 3300028794 Bacteria 1528
254 Ga0307515_10350102 3300028794 Bacteria 1124
255 Ga0307515_10720200 3300028794 Unclassified 615
256 Ga0265330_10084490 3300031235 Bacteria 1366
257 Ga0265332_10054502 3300031238 Bacteria 1715
258 Ga0307513_10000019 3300031456 Bacteria 231194
259 Ga0307513_10000051 3300031456 Bacteria 149733
260 Ga0307513_10010735 3300031456 Bacteria 11451
261 Ga0307513_10422266 3300031456 Bacteria 1063
262 Ga0307509_10003890 3300031507 Bacteria 22097
263 Ga0307509_10271141 3300031507 Bacteria 1464
264 Ga0307408_100000407 3300031548 Bacteria 38725
265 Ga0307408_100005073 3300031548 Bacteria 8837
266 Ga0307408_100058277 3300031548 Bacteria 2807
267 Ga0307408_100311888 3300031548 Bacteria 1322
268 Ga0307408_100380430 3300031548 Bacteria 1207
269 Ga0307408_101098163 3300031548 Bacteria 738
270 Ga0307408_102259560 3300031548 Bacteria 526
271 Ga0307508_10009033 3300031616 Bacteria 9182
272 Ga0307508_10011731 3300031616 Bacteria 8008
273 Ga0307508_10266442 3300031616 Bacteria 1307
274 Ga0307508_10460082 3300031616 Bacteria 865
275 Ga0307514_10003221 3300031649 Bacteria 15940
276 Ga0307514_10483651 3300031649 Bacteria 595
277 Ga0265314_10003396 3300031711 Bacteria 15427
278 Ga0307516_10008844 3300031730 Bacteria 11310
279 Ga0307516_10108290 3300031730 Bacteria 2586
280 Ga0307516_10193844 3300031730 Bacteria 1756
281 Ga0307410_10524908 3300031852 Bacteria 978
282 Ga0307406_10039594 3300031901 Bacteria 2926
283 Ga0307406_10072159 3300031901 Bacteria 2265
284 Ga0307406_12079202 3300031901 Bacteria 509
285 Ga0307416_100425576 3300032002 Bacteria 1373
286 Ga0307416_102092897 3300032002 Bacteria 668
287 Ga0307411_11539708 3300032005 Bacteria 612
288 Ga0307510_10001792 3300033180 Bacteria 23968
289 Ga0307510_10257348 3300033180 Bacteria 1229
290 Ga0307510_10294015 3300033180 Bacteria 1089
291 Ga0373932_0005175 3300035112 Bacteria 3067
292 Ga0373939_0275934 3300035114 Bacteria 662
293 Ga0373960_0328839 3300035121 Bacteria 575
294 Ga0373931_0020008 3300035691 Bacteria 3346
295 Ga0373931_0087776 3300035691 Bacteria 1728
296 Ga0373947_0316436 3300035725 Bacteria 1043
297 Ga0373925_0159514 3300037068 Bacteria 1776
298 Ga0395899_0002622 3300037312 Bacteria 14501
299 Ga0395899_0029980 3300037312 Bacteria 4094
300 Ga0395899_0647276 3300037312 Bacteria 668
301 Ga0395900_0078158 3300037418 Bacteria 3400
302 Ga0395900_0185104 3300037418 Bacteria 2114
303 Ga0395900_0398849 3300037418 Bacteria 1340
304 Ga0395900_0404209 3300037418 Bacteria 1329
305 Ga0395900_0966929 3300037418 Bacteria 772
306 Ga0395898_0037857 3300037466 Bacteria 4782
307 Ga0395905_0000148 3300037471 Bacteria 116301
308 Ga0395905_0000443 3300037471 Bacteria 58027
309 Ga0395905_0027898 3300037471 Bacteria 5323
310 Ga0395905_0065049 3300037471 Bacteria 3413
311 Ga0395905_0123694 3300037471 Bacteria 2432
312 Ga0395905_0131818 3300037471 Bacteria 2350
313 Ga0395905_0544960 3300037471 Bacteria 1061
314 Ga0395905_0571366 3300037471 Bacteria 1032
315 Ga0395905_0604300 3300037471 Bacteria 999
316 Ga0395901_0086684 3300038443 Bacteria 3274
317 Ga0395901_0139747 3300038443 Bacteria 2545
318 Ga0395901_0220882 3300038443 Bacteria 1981
319 Ga0395901_0305687 3300038443 Bacteria 1648
320 Ga0395901_0329215 3300038443 Bacteria 1579
321 Ga0395901_0958472 3300038443 Bacteria 834
322 Ga0439439_0057378 3300041406 Bacteria 1029
323 Ga0439453_0014878 3300041408 Bacteria 1340
324 Ga0451797_0866692 3300041453 Bacteria 703
325 Ga0451800_0609522 3300041459 Bacteria 545
326 Ga0451849_0298659 3300041505 Bacteria 808
327 Ga0451853_0206703 3300041512 Bacteria 1313
328 Ga0451853_1434675 3300041512 Bacteria 777
329 Ga0439431_0054761 3300041997 Bacteria 1041
330 Ga0439433_0012841 3300041999 Bacteria 1838
331 Ga0439437_016454 3300042000 Bacteria 873
332 Ga0439441_053851 3300042001 Bacteria 834
333 Ga0439442_125685 3300042002 Bacteria 563
334 Ga0439449_0001507 3300042007 Bacteria 9126
335 Ga0439452_090254 3300042010 Bacteria 662
336 Ga0439462_0019094 3300042015 Bacteria 1782
337 Ga0439462_0047212 3300042015 Bacteria 1154
338 Ga0450923_018629 3300042125 Bacteria 1330
339 Ga0450895_006737 3300042132 Bacteria 945
340 Ga0450903_026535 3300042138 Bacteria 883
341 Ga0439446_0059109 3300042156 Bacteria 1157
342 Ga0450909_038410 3300042185 Bacteria 734
343 Ga0439435_0272273 3300042436 Bacteria 575
344 Ga0439464_0007722 3300042439 Bacteria 2815
345 Ga0451577_0010101 3300042876 Bacteria 9044
346 Ga0451577_0104069 3300042876 Bacteria 2537
347 Ga0451577_0956491 3300042876 Bacteria 770
348 Ga0466969_0016312 3300044656 Bacteria 3890
349 Ga0466969_0080128 3300044656 Bacteria 1560
350 Ga0453683_0009651 3300044673 Bacteria 6436
351 Ga0453683_0011859 3300044673 Bacteria 5735
352 Ga0466966_0016959 3300044684 Bacteria 4813
353 Ga0466966_0461986 3300044684 Bacteria 763
354 Ga0466966_0480511 3300044684 Bacteria 747
355 Ga0466961_0026070 3300044693 Bacteria 3758
356 Ga0466961_0460775 3300044693 Bacteria 769
357 Ga0453684_1276089 3300044712 Bacteria 767
358 Ga0466970_0093791 3300044765 Bacteria 1631
359 Ga0466957_0254304 3300044842 Bacteria 1169
360 Ga0466959_0047085 3300045049 Bacteria 3172
361 Ga0451576_0045100 3300045051 Bacteria 4644
362 Ga0451576_0053188 3300045051 Bacteria 4242
363 Ga0451576_0087179 3300045051 Bacteria 3247
364 Ga0451576_0176080 3300045051 Bacteria 2233
365 Ga0451576_0534061 3300045051 Bacteria 1232
366 Ga0466967_0196006 3300045976 Bacteria 1911
367 Ga0466967_1179821 3300045976 Bacteria 763
368 Ga0495617_161958 3300046452 Bacteria 709
369 Ga0495638_0206153 3300046460 Bacteria 1107
370 Ga0495650_0171811 3300046471 Bacteria 767
371 Ga0495605_0087836 3300046474 Bacteria 1445
372 Ga0495606_0332296 3300046507 Bacteria 813
373 Ga0495620_0273502 3300046515 Bacteria 643
374 Ga0495630_0038959 3300046517 Bacteria 3555
375 Ga0495632_0023318 3300046519 Bacteria 3306
376 Ga0495642_0010858 3300046528 Bacteria 3491
377 Ga0495609_0063873 3300046538 Bacteria 1625
378 Ga0495597_0023755 3300046542 Bacteria 2834
379 Ga0495597_0187540 3300046542 Bacteria 833
380 Ga0495656_0008104 3300046615 Bacteria 3740
381 Ga0495656_0015334 3300046615 Bacteria 2891
382 Ga0495668_0113849 3300046616 Bacteria 1479
383 Ga0495668_0183512 3300046616 Bacteria 1146
384 Ga0495668_0397374 3300046616 Bacteria 757
385 Ga0495625_0071156 3300046660 Bacteria 2441
386 Ga0495635_0411126 3300046663 Bacteria 898
387 Ga0495659_0510645 3300046664 Unclassified 527
388 Ga0495658_0169795 3300046683 Bacteria 1349
389 Ga0495669_0217959 3300046684 Bacteria 914
390 Ga0495613_0430251 3300046689 Bacteria 897
391 Ga0495624_0156216 3300046690 Bacteria 1394
392 Ga0495671_0067453 3300046692 Bacteria 1760
393 Ga0495649_0003708 3300046694 Bacteria 10162
394 Ga0495660_0047442 3300046810 Bacteria 2352
395 Ga0495636_0176768 3300047318 Bacteria 967
396 Ga0495636_0441368 3300047318 Bacteria 624
397 Ga0495676_0062662 3300047321 Bacteria 2902
398 Ga0495687_010796 3300047443 Bacteria 4971
399 Ga0495687_017419 3300047443 Bacteria 3585
400 Ga0495615_0011836 3300048090 Bacteria 1784
401 Ga0495626_0051749 3300048091 Bacteria 1894
402 Ga0495626_0097039 3300048091 Bacteria 1289
403 Ga0496110_0820351 3300048913 Bacteria 835
404 Ga0496113_1126587 3300048916 Bacteria 615
405 Ga0496114_0802325 3300048917 Bacteria 820
406 Ga0496126_0539642 3300048929 Bacteria 927
407 Ga0495682_0196024 3300049460 Bacteria 717
408 Ga0501032_0037733 3300049569 Bacteria 3294
409 Ga0501032_0299521 3300049569 Bacteria 1040
410 Ga0501034_0145532 3300049571 Bacteria 2347
411 Ga0501037_0275722 3300049573 Bacteria 1173
412 Ga0501037_0334732 3300049573 Bacteria 1046
413 Ga0501037_0421131 3300049573 Bacteria 914
414 Ga0501038_0462437 3300049574 Bacteria 974
415 Ga0501043_0121898 3300049579 Bacteria 2045
416 Ga0501043_0498571 3300049579 Bacteria 910
417 Ga0501046_0044943 3300049580 Bacteria 3511
418 Ga0501047_0206307 3300049581 Bacteria 1824
419 Ga0501047_0238280 3300049581 Bacteria 1671
420 Ga0501048_0292393 3300049582 Bacteria 1159
421 Ga0501080_0079221 3300049742 Bacteria 3054
422 Ga0501263_003341 3300049760 Bacteria 1707
423 Ga0501266_001326 3300049763 Bacteria 3156
424 Ga0501044_0040510 3300049823 Bacteria 4855
425 Ga0501044_0393482 3300049823 Bacteria 1299
426 nmdc:mga03683_149108_c1 3300050489 Bacteria 1055
427 nmdc:mga03683_508449_c1 3300050489 Bacteria 584
428 nmdc:mga03683_51377_c1 3300050489 Bacteria 1720
429 nmdc:mga03n38_51798_c1 3300050490 Bacteria 1834
430 nmdc:mga03n38_693512_c1 3300050490 Bacteria 586
431 nmdc:mga03n38_714730_c1 3300050490 Bacteria 578
432 nmdc:mga00v17_225202_c1 3300050491 Bacteria 1214
433 nmdc:mga00v17_340549_c1 3300050491 Bacteria 975
434 nmdc:mga0k408_235734_c1 3300050493 Bacteria 1093
435 nmdc:mga0k408_238215_c1 3300050493 Bacteria 704
436 nmdc:mga0k408_452078_c1 3300050493 Bacteria 763
437 nmdc:mga0k408_473163_c1 3300050493 Bacteria 743
438 nmdc:mga0k408_504_c1 3300050493 Bacteria 21443
439 nmdc:mga0k408_7882_c1 3300050493 Bacteria 5702
440 nmdc:mga0k408_8130_c1 3300050493 Bacteria 5622
441 nmdc:mga0k408_9301_c1 3300050493 Bacteria 5296
442 nmdc:mga06z11_106701_c1 3300050494 Bacteria 1545
443 nmdc:mga06z11_146399_c1 3300050494 Bacteria 1339
444 nmdc:mga06z11_258125_c1 3300050494 Bacteria 1028
445 nmdc:mga06z11_587941_c1 3300050494 Bacteria 677
446 nmdc:mga04h51_113124_c1 3300050495 Bacteria 1003
447 nmdc:mga04h51_26458_c1 3300050495 Bacteria 1794
448 nmdc:mga04h51_63046_c1 3300050495 Bacteria 1275
449 nmdc:mga07m45_10888_c1 3300050496 Bacteria 4762
450 nmdc:mga07m45_150_c1 3300050496 Bacteria 27900
451 nmdc:mga07m45_2017_c1 3300050496 Bacteria 9417
452 nmdc:mga07m45_24397_c1 3300050496 Bacteria 3312
453 nmdc:mga07m45_344078_c1 3300050496 Bacteria 866
454 nmdc:mga07m45_399176_c1 3300050496 Bacteria 798
455 nmdc:mga07m45_804644_c1 3300050496 Bacteria 539
456 nmdc:mga07m45_8835_c1 3300050496 Bacteria 5198
457 nmdc:mga0qj67_109111_c1 3300050509 Bacteria 1673
458 nmdc:mga0sz30_354721_c1 3300050516 Bacteria 656
459 nmdc:mga0sz30_9248_c2 3300050516 Bacteria 1285
460 Ga0495655_0233632 3300053083 Bacteria 613
461 Ga0495619_1025056 3300053085 Bacteria 551
462 Ga0500644_0016039 3300053088 Bacteria 2150
463 Ga0500651_0235474 3300053093 Bacteria 1069
464 Ga0500660_237644 3300053100 Bacteria 577
465 Ga0500562_044638 3300053108 Bacteria 1180
466 Ga0500593_016489 3300053117 Bacteria 3202
467 Ga0500658_0003736 3300053134 Bacteria 5733
468 Ga0500559_0000948 3300053136 Bacteria 18266
469 Ga0500559_0524381 3300053136 Bacteria 542
470 Ga0500568_0019208 3300053139 Bacteria 2975
471 Ga0500586_205174 3300053145 Bacteria 644
472 Ga0500616_0168909 3300053153 Bacteria 995
473 Ga0500620_214222 3300053155 Bacteria 653
474 Ga0500627_0199747 3300053158 Bacteria 896
475 Ga0500645_001435 3300053730 Bacteria 12097
476 Ga0500645_002264 3300053730 Bacteria 8744
477 Ga0500645_079960 3300053730 Bacteria 933
478 Ga0500661_001087 3300055283 Bacteria 5115

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300032002 Ga0307416_102092897 Ga0307416_1020928972 132
2 3300028794 Ga0307515_10002977 Ga0307515_1000297726 133
3 3300031456 Ga0307513_10010735 Ga0307513_100107354 133
4 3300031649 Ga0307514_10003221 Ga0307514_1000322111 133
5 3300049573 Ga0501037_0334732 Ga0501037_0334732_329_739 134
6 iso_pu_bacteria 2974320154 2974323103 135
7 3300009148 Ga0105243_10685493 Ga0105243_106854932 136
8 3300009176 Ga0105242_10006633 Ga0105242_100066339 136
9 3300025934 Ga0207686_10009207 Ga0207686_100092073 136
10 3300044684 Ga0466966_0480511 Ga0466966_0480511_289_702 136
11 3300044693 Ga0466961_0460775 Ga0466961_0460775_280_693 136
12 3300044842 Ga0466957_0254304 Ga0466957_0254304_287_700 136
13 3300049760 Ga0501263_003341 Ga0501263_003341_697_1110 136
14 iso_pu_bacteria 2643221570 2643866698 136
15 iso_pu_bacteria 2643221652 2644294569 136
16 iso_pu_bacteria 2990710928 2990712667 136
17 3300003792 Ga0055540_1013853 Ga0055540_10138532 137
18 3300003794 Ga0055531_10001591 Ga0055531_100015917 137
19 3300005617 Ga0068859_100477168 Ga0068859_1004771682 137
20 3300006177 Ga0075362_10385898 Ga0075362_103858981 137
21 3300006195 Ga0075366_10216685 Ga0075366_102166852 137
22 3300006353 Ga0075370_10410574 Ga0075370_104105742 137
23 3300006846 Ga0075430_100135513 Ga0075430_1001355131 137
24 3300006881 Ga0068865_101480328 Ga0068865_1014803282 137
25 3300006931 Ga0097620_100477191 Ga0097620_1004771912 137
26 3300025273 Ga0209673_1050378 Ga0209673_10503782 137
27 3300025303 Ga0209051_1000078 Ga0209051_100007830 137
28 3300025304 Ga0209257_1000012 Ga0209257_1000012289 137
29 3300031548 Ga0307408_100311888 Ga0307408_1003118882 137
30 3300031548 Ga0307408_100380430 Ga0307408_1003804302 137
31 3300031548 Ga0307408_101098163 Ga0307408_1010981632 137
32 3300031901 Ga0307406_12079202 Ga0307406_120792021 137
33 3300032005 Ga0307411_11539708 Ga0307411_115397082 137
34 3300037312 Ga0395899_0002622 Ga0395899_0002622_8342_8770 137
35 3300037471 Ga0395905_0131818 Ga0395905_0131818_1772_2200 137
36 3300038443 Ga0395901_0139747 Ga0395901_0139747_257_685 137
37 3300038443 Ga0395901_0220882 Ga0395901_0220882_684_1121 137
38 3300041408 Ga0439453_0014878 Ga0439453_0014878_514_942 137
39 3300041459 Ga0451800_0609522 Ga0451800_0609522_100_519 137
40 3300042010 Ga0439452_090254 Ga0439452_090254_215_643 137
41 3300042125 Ga0450923_018629 Ga0450923_018629_866_1294 137
42 3300042132 Ga0450895_006737 Ga0450895_006737_268_696 137
43 3300042138 Ga0450903_026535 Ga0450903_026535_230_658 137
44 3300042156 Ga0439446_0059109 Ga0439446_0059109_387_815 137
45 3300042185 Ga0450909_038410 Ga0450909_038410_100_528 137
46 3300042436 Ga0439435_0272273 Ga0439435_0272273_74_502 137
47 3300042439 Ga0439464_0007722 Ga0439464_0007722_659_1087 137
48 3300045976 Ga0466967_0196006 Ga0466967_0196006_631_1068 137
49 3300045976 Ga0466967_1179821 Ga0466967_1179821_316_744 137
50 3300046616 Ga0495668_0397374 Ga0495668_0397374_132_551 137
51 3300049569 Ga0501032_0299521 Ga0501032_0299521_222_650 137
52 3300049573 Ga0501037_0275722 Ga0501037_0275722_344_772 137
53 3300049579 Ga0501043_0498571 Ga0501043_0498571_251_679 137
54 3300049581 Ga0501047_0238280 Ga0501047_0238280_321_836 137
55 3300049823 Ga0501044_0393482 Ga0501044_0393482_19_534 137
56 3300050493 nmdc:mga0k408_238215_c1 nmdc:mga0k408_238215_c1_185_613 137
57 3300050496 nmdc:mga07m45_804644_c1 nmdc:mga07m45_804644_c1_46_474 137
58 3300050509 nmdc:mga0qj67_109111_c1 nmdc:mga0qj67_109111_c1_404_832 137
59 3300053136 Ga0500559_0524381 Ga0500559_0524381_52_477 137
60 iso_pu_bacteria 2643221654 2644305109 137
61 3300006038 Ga0075365_10122998 Ga0075365_101229982 138
62 3300044673 Ga0453683_0011859 Ga0453683_0011859_980_1411 138
63 3300045051 Ga0451576_0053188 Ga0451576_0053188_3460_3891 138
64 3300046663 Ga0495635_0411126 Ga0495635_0411126_413_844 138
65 3300003316 rootH1_10025590 rootH1_100255901 139
66 3300005289 Ga0065704_10162087 Ga0065704_101620872 139
67 3300005328 Ga0070676_10006620 Ga0070676_100066203 139
68 3300005328 Ga0070676_10539101 Ga0070676_105391012 139
69 3300005331 Ga0070670_100086168 Ga0070670_1000861682 139
70 3300005333 Ga0070677_10029917 Ga0070677_100299172 139
71 3300005334 Ga0068869_100126428 Ga0068869_1001264282 139
72 3300005334 Ga0068869_100621262 Ga0068869_1006212621 139
73 3300005334 Ga0068869_100918619 Ga0068869_1009186192 139
74 3300005339 Ga0070660_100138639 Ga0070660_1001386392 139
75 3300005354 Ga0070675_100052440 Ga0070675_1000524403 139
76 3300005354 Ga0070675_101356500 Ga0070675_1013565002 139
77 3300005355 Ga0070671_100005987 Ga0070671_1000059873 139
78 3300005356 Ga0070674_100175406 Ga0070674_1001754062 139
79 3300005365 Ga0070688_100414238 Ga0070688_1004142382 139
80 3300005366 Ga0070659_100311208 Ga0070659_1003112081 139
81 3300005367 Ga0070667_101011891 Ga0070667_1010118912 139
82 3300005445 Ga0070708_100136582 Ga0070708_1001365822 139
83 3300005456 Ga0070678_100081929 Ga0070678_1000819292 139
84 3300005456 Ga0070678_100252417 Ga0070678_1002524172 139
85 3300005457 Ga0070662_100116649 Ga0070662_1001166492 139
86 3300005457 Ga0070662_100228057 Ga0070662_1002280572 139
87 3300005459 Ga0068867_100003980 Ga0068867_1000039809 139
88 3300005467 Ga0070706_100001360 Ga0070706_10000136019 139
89 3300005468 Ga0070707_100026346 Ga0070707_1000263464 139
90 3300005471 Ga0070698_100735145 Ga0070698_1007351452 139
91 3300005539 Ga0068853_100177477 Ga0068853_1001774772 139
92 3300005543 Ga0070672_100089700 Ga0070672_1000897003 139
93 3300005548 Ga0070665_100253303 Ga0070665_1002533032 139
94 3300005577 Ga0068857_100064931 Ga0068857_1000649313 139
95 3300005577 Ga0068857_101365537 Ga0068857_1013655372 139
96 3300005616 Ga0068852_100026931 Ga0068852_1000269315 139
97 3300005617 Ga0068859_100891965 Ga0068859_1008919652 139
98 3300005718 Ga0068866_10925132 Ga0068866_109251322 139
99 3300005840 Ga0068870_10046046 Ga0068870_100460462 139
100 3300005841 Ga0068863_101183712 Ga0068863_1011837121 139
101 3300005843 Ga0068860_101294542 Ga0068860_1012945422 139
102 3300005844 Ga0068862_102651930 Ga0068862_1026519301 139
103 3300006038 Ga0075365_10443517 Ga0075365_104435172 139
104 3300006042 Ga0075368_10024418 Ga0075368_100244182 139
105 3300006042 Ga0075368_10050310 Ga0075368_100503102 139
106 3300006048 Ga0075363_100039003 Ga0075363_1000390032 139
107 3300006048 Ga0075363_100065425 Ga0075363_1000654252 139
108 3300006048 Ga0075363_100080366 Ga0075363_1000803662 139
109 3300006051 Ga0075364_10036191 Ga0075364_100361912 139
110 3300006177 Ga0075362_10002742 Ga0075362_100027422 139
111 3300006177 Ga0075362_10008420 Ga0075362_100084203 139
112 3300006178 Ga0075367_10030320 Ga0075367_100303204 139
113 3300006178 Ga0075367_10246968 Ga0075367_102469682 139
114 3300006178 Ga0075367_10378481 Ga0075367_103784812 139
115 3300006178 Ga0075367_10626653 Ga0075367_106266531 139
116 3300006186 Ga0075369_10025400 Ga0075369_100254001 139
117 3300006195 Ga0075366_10002134 Ga0075366_100021344 139
118 3300006195 Ga0075366_10014460 Ga0075366_100144602 139
119 3300006195 Ga0075366_10054094 Ga0075366_100540944 139
120 3300006195 Ga0075366_10787175 Ga0075366_107871752 139
121 3300006237 Ga0097621_100355824 Ga0097621_1003558242 139
122 3300006237 Ga0097621_100713975 Ga0097621_1007139752 139
123 3300006353 Ga0075370_10002071 Ga0075370_100020718 139
124 3300006353 Ga0075370_10033696 Ga0075370_100336965 139
125 3300006353 Ga0075370_10087589 Ga0075370_100875892 139
126 3300006353 Ga0075370_10088879 Ga0075370_100888792 139
127 3300006881 Ga0068865_100126747 Ga0068865_1001267472 139
128 3300006931 Ga0097620_100892237 Ga0097620_1008922372 139
129 3300009098 Ga0105245_10022835 Ga0105245_100228353 139
130 3300009148 Ga0105243_10025185 Ga0105243_100251853 139
131 3300009148 Ga0105243_10295782 Ga0105243_102957822 139
132 3300009148 Ga0105243_12021905 Ga0105243_120219052 139
133 3300009174 Ga0105241_10097627 Ga0105241_100976274 139
134 3300009545 Ga0105237_10052299 Ga0105237_100522992 139
135 3300009553 Ga0105249_12196901 Ga0105249_121969012 139
136 3300010375 Ga0105239_10021489 Ga0105239_100214895 139
137 3300011119 Ga0105246_10030595 Ga0105246_100305953 139
138 3300013306 Ga0163162_10402132 Ga0163162_104021322 139
139 3300013308 Ga0157375_10041640 Ga0157375_100416403 139
140 3300014326 Ga0157380_10661754 Ga0157380_106617542 139
141 3300014745 Ga0157377_10371993 Ga0157377_103719932 139
142 3300025893 Ga0207682_10217373 Ga0207682_102173731 139
143 3300025907 Ga0207645_10002443 Ga0207645_1000244312 139
144 3300025907 Ga0207645_10271683 Ga0207645_102716832 139
145 3300025908 Ga0207643_10091900 Ga0207643_100919002 139
146 3300025910 Ga0207684_10029430 Ga0207684_100294305 139
147 3300025911 Ga0207654_10170131 Ga0207654_101701312 139
148 3300025913 Ga0207695_10038007 Ga0207695_100380074 139
149 3300025914 Ga0207671_10028247 Ga0207671_100282472 139
150 3300025919 Ga0207657_10139848 Ga0207657_101398482 139
151 3300025925 Ga0207650_10065460 Ga0207650_100654604 139
152 3300025926 Ga0207659_10030899 Ga0207659_100308992 139
153 3300025926 Ga0207659_10256582 Ga0207659_102565822 139
154 3300025927 Ga0207687_10350600 Ga0207687_103506002 139
155 3300025931 Ga0207644_10034779 Ga0207644_100347793 139
156 3300025932 Ga0207690_10172889 Ga0207690_101728892 139
157 3300025933 Ga0207706_10036208 Ga0207706_100362082 139
158 3300025933 Ga0207706_10420501 Ga0207706_104205012 139
159 3300025935 Ga0207709_10344530 Ga0207709_103445302 139
160 3300025935 Ga0207709_10353165 Ga0207709_103531652 139
161 3300025937 Ga0207669_10719812 Ga0207669_107198122 139
162 3300025937 Ga0207669_11068475 Ga0207669_110684751 139
163 3300025938 Ga0207704_10065298 Ga0207704_100652982 139
164 3300025940 Ga0207691_10019248 Ga0207691_100192486 139
165 3300025942 Ga0207689_10051305 Ga0207689_100513052 139
166 3300025942 Ga0207689_10346437 Ga0207689_103464372 139
167 3300025972 Ga0207668_10899026 Ga0207668_108990262 139
168 3300026023 Ga0207677_10702109 Ga0207677_107021092 139
169 3300026041 Ga0207639_10066789 Ga0207639_100667893 139
170 3300026041 Ga0207639_10713879 Ga0207639_107138791 139
171 3300026089 Ga0207648_10005998 Ga0207648_100059983 139
172 3300026089 Ga0207648_10139452 Ga0207648_101394523 139
173 3300026116 Ga0207674_10011244 Ga0207674_100112444 139
174 3300026116 Ga0207674_10097996 Ga0207674_100979963 139
175 3300026118 Ga0207675_100745939 Ga0207675_1007459392 139
176 3300026121 Ga0207683_10079277 Ga0207683_100792773 139
177 3300027866 Ga0209813_10007691 Ga0209813_100076913 139
178 3300027866 Ga0209813_10048137 Ga0209813_100481371 139
179 3300027866 Ga0209813_10075203 Ga0209813_100752032 139
180 3300028379 Ga0268266_10864171 Ga0268266_108641712 139
181 3300028380 Ga0268265_10471422 Ga0268265_104714222 139
182 3300028381 Ga0268264_10376828 Ga0268264_103768282 139
183 3300028786 Ga0307517_10105031 Ga0307517_101050312 139
184 3300028786 Ga0307517_10160721 Ga0307517_101607213 139
185 3300028794 Ga0307515_10103741 Ga0307515_101037414 139
186 3300028794 Ga0307515_10121837 Ga0307515_101218372 139
187 3300028794 Ga0307515_10249927 Ga0307515_102499273 139
188 3300028794 Ga0307515_10350102 Ga0307515_103501022 139
189 3300031456 Ga0307513_10422266 Ga0307513_104222662 139
190 3300031507 Ga0307509_10003890 Ga0307509_100038905 139
191 3300031507 Ga0307509_10271141 Ga0307509_102711412 139
192 3300031548 Ga0307408_100000407 Ga0307408_10000040739 139
193 3300031616 Ga0307508_10009033 Ga0307508_100090335 139
194 3300031616 Ga0307508_10011731 Ga0307508_100117315 139
195 3300031616 Ga0307508_10266442 Ga0307508_102664422 139
196 3300031616 Ga0307508_10460082 Ga0307508_104600822 139
197 3300031649 Ga0307514_10483651 Ga0307514_104836511 139
198 3300031730 Ga0307516_10108290 Ga0307516_101082902 139
199 3300031901 Ga0307406_10039594 Ga0307406_100395944 139
200 3300033180 Ga0307510_10001792 Ga0307510_100017929 139
201 3300033180 Ga0307510_10257348 Ga0307510_102573482 139
202 3300033180 Ga0307510_10294015 Ga0307510_102940152 139
203 3300035112 Ga0373932_0005175 Ga0373932_0005175_222_659 139
204 3300035114 Ga0373939_0275934 Ga0373939_0275934_81_518 139
205 3300035121 Ga0373960_0328839 Ga0373960_0328839_79_516 139
206 3300035691 Ga0373931_0020008 Ga0373931_0020008_84_521 139
207 3300035691 Ga0373931_0087776 Ga0373931_0087776_932_1369 139
208 3300035725 Ga0373947_0316436 Ga0373947_0316436_410_847 139
209 3300037068 Ga0373925_0159514 Ga0373925_0159514_18_455 139
210 3300041453 Ga0451797_0866692 Ga0451797_0866692_160_594 139
211 3300041505 Ga0451849_0298659 Ga0451849_0298659_178_615 139
212 3300041512 Ga0451853_1434675 Ga0451853_1434675_280_738 139
213 3300044712 Ga0453684_1276089 Ga0453684_1276089_170_604 139
214 3300045051 Ga0451576_0534061 Ga0451576_0534061_511_945 139
215 3300046452 Ga0495617_161958 Ga0495617_161958_230_667 139
216 3300046460 Ga0495638_0206153 Ga0495638_0206153_372_809 139
217 3300046471 Ga0495650_0171811 Ga0495650_0171811_230_664 139
218 3300046474 Ga0495605_0087836 Ga0495605_0087836_284_718 139
219 3300046507 Ga0495606_0332296 Ga0495606_0332296_299_736 139
220 3300046515 Ga0495620_0273502 Ga0495620_0273502_195_632 139
221 3300046517 Ga0495630_0038959 Ga0495630_0038959_1652_2089 139
222 3300046519 Ga0495632_0023318 Ga0495632_0023318_1557_1991 139
223 3300046538 Ga0495609_0063873 Ga0495609_0063873_1073_1507 139
224 3300046542 Ga0495597_0023755 Ga0495597_0023755_138_572 139
225 3300046542 Ga0495597_0187540 Ga0495597_0187540_16_450 139
226 3300046616 Ga0495668_0113849 Ga0495668_0113849_79_513 139
227 3300046660 Ga0495625_0071156 Ga0495625_0071156_242_676 139
228 3300046664 Ga0495659_0510645 Ga0495659_0510645_24_458 139
229 3300046683 Ga0495658_0169795 Ga0495658_0169795_271_708 139
230 3300046689 Ga0495613_0430251 Ga0495613_0430251_308_745 139
231 3300046690 Ga0495624_0156216 Ga0495624_0156216_884_1321 139
232 3300046692 Ga0495671_0067453 Ga0495671_0067453_776_1246 139
233 3300046694 Ga0495649_0003708 Ga0495649_0003708_8726_9160 139
234 3300046810 Ga0495660_0047442 Ga0495660_0047442_905_1339 139
235 3300047321 Ga0495676_0062662 Ga0495676_0062662_180_617 139
236 3300047443 Ga0495687_010796 Ga0495687_010796_2838_3272 139
237 3300047443 Ga0495687_017419 Ga0495687_017419_112_546 139
238 3300048091 Ga0495626_0051749 Ga0495626_0051749_296_730 139
239 3300048091 Ga0495626_0097039 Ga0495626_0097039_110_544 139
240 3300048916 Ga0496113_1126587 Ga0496113_1126587_117_557 139
241 3300048917 Ga0496114_0802325 Ga0496114_0802325_77_514 139
242 3300049460 Ga0495682_0196024 Ga0495682_0196024_267_701 139
243 3300049763 Ga0501266_001326 Ga0501266_001326_2268_2699 139
244 3300050489 nmdc:mga03683_149108_c1 nmdc:mga03683_149108_c1_152_586 139
245 3300050490 nmdc:mga03n38_51798_c1 nmdc:mga03n38_51798_c1_578_1012 139
246 3300050490 nmdc:mga03n38_693512_c1 nmdc:mga03n38_693512_c1_44_478 139
247 3300050491 nmdc:mga00v17_225202_c1 nmdc:mga00v17_225202_c1_151_585 139
248 3300050493 nmdc:mga0k408_235734_c1 nmdc:mga0k408_235734_c1_524_958 139
249 3300050493 nmdc:mga0k408_473163_c1 nmdc:mga0k408_473163_c1_82_516 139
250 3300050493 nmdc:mga0k408_504_c1 nmdc:mga0k408_504_c1_17256_17690 139
251 3300050493 nmdc:mga0k408_7882_c1 nmdc:mga0k408_7882_c1_3859_4293 139
252 3300050493 nmdc:mga0k408_8130_c1 nmdc:mga0k408_8130_c1_440_874 139
253 3300050493 nmdc:mga0k408_9301_c1 nmdc:mga0k408_9301_c1_3530_3964 139
254 3300050494 nmdc:mga06z11_106701_c1 nmdc:mga06z11_106701_c1_772_1206 139
255 3300050494 nmdc:mga06z11_146399_c1 nmdc:mga06z11_146399_c1_400_834 139
256 3300050494 nmdc:mga06z11_258125_c1 nmdc:mga06z11_258125_c1_52_486 139
257 3300050495 nmdc:mga04h51_113124_c1 nmdc:mga04h51_113124_c1_421_855 139
258 3300050495 nmdc:mga04h51_26458_c1 nmdc:mga04h51_26458_c1_587_1021 139
259 3300050495 nmdc:mga04h51_63046_c1 nmdc:mga04h51_63046_c1_588_1022 139
260 3300050496 nmdc:mga07m45_10888_c1 nmdc:mga07m45_10888_c1_2742_3176 139
261 3300050496 nmdc:mga07m45_150_c1 nmdc:mga07m45_150_c1_492_926 139
262 3300050496 nmdc:mga07m45_2017_c1 nmdc:mga07m45_2017_c1_1537_1971 139
263 3300050496 nmdc:mga07m45_24397_c1 nmdc:mga07m45_24397_c1_1260_1697 139
264 3300050496 nmdc:mga07m45_399176_c1 nmdc:mga07m45_399176_c1_274_711 139
265 3300050496 nmdc:mga07m45_8835_c1 nmdc:mga07m45_8835_c1_3049_3483 139
266 3300050516 nmdc:mga0sz30_354721_c1 nmdc:mga0sz30_354721_c1_180_614 139
267 3300050516 nmdc:mga0sz30_9248_c2 nmdc:mga0sz30_9248_c2_676_1110 139
268 3300053083 Ga0495655_0233632 Ga0495655_0233632_105_539 139
269 3300053108 Ga0500562_044638 Ga0500562_044638_540_974 139
270 3300053134 Ga0500658_0003736 Ga0500658_0003736_543_977 139
271 3300053136 Ga0500559_0000948 Ga0500559_0000948_1565_2002 139
272 3300053139 Ga0500568_0019208 Ga0500568_0019208_500_934 139
273 3300053145 Ga0500586_205174 Ga0500586_205174_140_574 139
274 3300053153 Ga0500616_0168909 Ga0500616_0168909_59_493 139
275 3300053155 Ga0500620_214222 Ga0500620_214222_160_597 139
276 iso_pu_bacteria 2643221596 2643993431 139
277 3300028794 Ga0307515_10720200 Ga0307515_107202001 140
278 3300031548 Ga0307408_100058277 Ga0307408_1000582774 140
279 3300031852 Ga0307410_10524908 Ga0307410_105249082 140
280 3300032002 Ga0307416_100425576 Ga0307416_1004255762 140
281 3300042876 Ga0451577_0010101 Ga0451577_0010101_5511_5939 140
282 3300042876 Ga0451577_0104069 Ga0451577_0104069_396_821 140
283 3300042876 Ga0451577_0956491 Ga0451577_0956491_219_644 140
284 3300044673 Ga0453683_0009651 Ga0453683_0009651_4145_4573 140
285 3300045051 Ga0451576_0045100 Ga0451576_0045100_2661_3089 140
286 3300045051 Ga0451576_0087179 Ga0451576_0087179_1711_2136 140
287 3300048929 Ga0496126_0539642 Ga0496126_0539642_169_591 140
288 3300053730 Ga0500645_001435 Ga0500645_001435_299_754 140
289 iso_pu_bacteria 2881101125 2881101925 140
290 3300005327 Ga0070658_10449559 Ga0070658_104495592 141
291 3300005339 Ga0070660_100018535 Ga0070660_1000185354 141
292 3300005354 Ga0070675_101290187 Ga0070675_1012901871 141
293 3300005530 Ga0070679_100032501 Ga0070679_1000325015 141
294 3300005548 Ga0070665_100178385 Ga0070665_1001783854 141
295 3300005563 Ga0068855_100143829 Ga0068855_1001438292 141
296 3300005617 Ga0068859_100151336 Ga0068859_1001513362 141
297 3300005618 Ga0068864_100045701 Ga0068864_1000457014 141
298 3300005841 Ga0068863_100032370 Ga0068863_1000323704 141
299 3300006931 Ga0097620_100151343 Ga0097620_1001513432 141
300 3300009093 Ga0105240_10001089 Ga0105240_1000108931 141
301 3300009098 Ga0105245_10218041 Ga0105245_102180412 141
302 3300009176 Ga0105242_11292997 Ga0105242_112929971 141
303 3300009551 Ga0105238_10052600 Ga0105238_100526004 141
304 3300013306 Ga0163162_10281552 Ga0163162_102815521 141
305 3300013308 Ga0157375_10551604 Ga0157375_105516042 141
306 3300025909 Ga0207705_10220744 Ga0207705_102207442 141
307 3300025913 Ga0207695_10049144 Ga0207695_100491443 141
308 3300025919 Ga0207657_10054433 Ga0207657_100544333 141
309 3300025921 Ga0207652_10073160 Ga0207652_100731604 141
310 3300025924 Ga0207694_10127612 Ga0207694_101276122 141
311 3300025925 Ga0207650_10164783 Ga0207650_101647833 141
312 3300025927 Ga0207687_10229185 Ga0207687_102291852 141
313 3300025949 Ga0207667_10114656 Ga0207667_101146564 141
314 3300026095 Ga0207676_10074356 Ga0207676_100743564 141
315 3300028379 Ga0268266_10032323 Ga0268266_100323233 141
316 3300028381 Ga0268264_11984408 Ga0268264_119844081 141
317 3300028786 Ga0307517_10125962 Ga0307517_101259621 141
318 3300046615 Ga0495656_0008104 Ga0495656_0008104_1727_2164 141
319 3300046616 Ga0495668_0183512 Ga0495668_0183512_197_676 141
320 3300047318 Ga0495636_0176768 Ga0495636_0176768_187_624 141
321 3300048090 Ga0495615_0011836 Ga0495615_0011836_79_516 141
322 3300005327 Ga0070658_10690412 Ga0070658_106904122 142
323 3300005339 Ga0070660_100550925 Ga0070660_1005509252 142
324 3300005366 Ga0070659_101104825 Ga0070659_1011048251 142
325 3300005563 Ga0068855_100211523 Ga0068855_1002115232 142
326 3300006177 Ga0075362_10091260 Ga0075362_100912602 142
327 3300006178 Ga0075367_10348576 Ga0075367_103485761 142
328 3300009098 Ga0105245_11547564 Ga0105245_115475642 142
329 3300025909 Ga0207705_10626424 Ga0207705_106264242 142
330 3300025919 Ga0207657_10538331 Ga0207657_105383312 142
331 3300025932 Ga0207690_10554196 Ga0207690_105541962 142
332 3300025949 Ga0207667_10281311 Ga0207667_102813112 142
333 3300031235 Ga0265330_10084490 Ga0265330_100844902 142
334 3300031238 Ga0265332_10054502 Ga0265332_100545023 142
335 3300031456 Ga0307513_10000019 Ga0307513_1000001983 142
336 3300031711 Ga0265314_10003396 Ga0265314_1000339611 142
337 3300031730 Ga0307516_10193844 Ga0307516_101938442 142
338 3300037312 Ga0395899_0029980 Ga0395899_0029980_2318_2749 142
339 3300037312 Ga0395899_0647276 Ga0395899_0647276_144_575 142
340 3300037418 Ga0395900_0078158 Ga0395900_0078158_170_601 142
341 3300037418 Ga0395900_0185104 Ga0395900_0185104_206_637 142
342 3300037418 Ga0395900_0398849 Ga0395900_0398849_636_1079 142
343 3300037418 Ga0395900_0404209 Ga0395900_0404209_683_1111 142
344 3300037418 Ga0395900_0966929 Ga0395900_0966929_315_746 142
345 3300037466 Ga0395898_0037857 Ga0395898_0037857_4187_4618 142
346 3300037471 Ga0395905_0000148 Ga0395905_0000148_87806_88234 142
347 3300037471 Ga0395905_0000443 Ga0395905_0000443_1924_2352 142
348 3300037471 Ga0395905_0027898 Ga0395905_0027898_1835_2278 142
349 3300037471 Ga0395905_0065049 Ga0395905_0065049_717_1145 142
350 3300037471 Ga0395905_0123694 Ga0395905_0123694_1852_2280 142
351 3300037471 Ga0395905_0544960 Ga0395905_0544960_351_782 142
352 3300037471 Ga0395905_0571366 Ga0395905_0571366_316_744 142
353 3300037471 Ga0395905_0604300 Ga0395905_0604300_496_930 142
354 3300038443 Ga0395901_0086684 Ga0395901_0086684_278_706 142
355 3300038443 Ga0395901_0305687 Ga0395901_0305687_326_769 142
356 3300038443 Ga0395901_0329215 Ga0395901_0329215_207_635 142
357 3300038443 Ga0395901_0958472 Ga0395901_0958472_163_591 142
358 3300041406 Ga0439439_0057378 Ga0439439_0057378_233_661 142
359 3300041997 Ga0439431_0054761 Ga0439431_0054761_46_474 142
360 3300041999 Ga0439433_0012841 Ga0439433_0012841_1062_1490 142
361 3300042000 Ga0439437_016454 Ga0439437_016454_94_522 142
362 3300042001 Ga0439441_053851 Ga0439441_053851_250_678 142
363 3300042002 Ga0439442_125685 Ga0439442_125685_67_495 142
364 3300042007 Ga0439449_0001507 Ga0439449_0001507_3622_4050 142
365 3300042015 Ga0439462_0019094 Ga0439462_0019094_568_996 142
366 3300044656 Ga0466969_0016312 Ga0466969_0016312_1176_1604 142
367 3300044656 Ga0466969_0080128 Ga0466969_0080128_206_640 142
368 3300044684 Ga0466966_0016959 Ga0466966_0016959_4045_4473 142
369 3300044684 Ga0466966_0461986 Ga0466966_0461986_173_607 142
370 3300044693 Ga0466961_0026070 Ga0466961_0026070_1773_2201 142
371 3300044765 Ga0466970_0093791 Ga0466970_0093791_1176_1604 142
372 3300045049 Ga0466959_0047085 Ga0466959_0047085_2404_2832 142
373 3300045051 Ga0451576_0176080 Ga0451576_0176080_1618_2046 142
374 3300046528 Ga0495642_0010858 Ga0495642_0010858_1025_1462 142
375 3300046615 Ga0495656_0015334 Ga0495656_0015334_80_517 142
376 3300046684 Ga0495669_0217959 Ga0495669_0217959_404_841 142
377 3300047318 Ga0495636_0441368 Ga0495636_0441368_64_501 142
378 3300048913 Ga0496110_0820351 Ga0496110_0820351_95_532 142
379 3300049569 Ga0501032_0037733 Ga0501032_0037733_263_694 142
380 3300049571 Ga0501034_0145532 Ga0501034_0145532_335_766 142
381 3300049573 Ga0501037_0421131 Ga0501037_0421131_105_536 142
382 3300049574 Ga0501038_0462437 Ga0501038_0462437_198_629 142
383 3300049579 Ga0501043_0121898 Ga0501043_0121898_135_566 142
384 3300049580 Ga0501046_0044943 Ga0501046_0044943_2045_2476 142
385 3300049581 Ga0501047_0206307 Ga0501047_0206307_621_1052 142
386 3300049582 Ga0501048_0292393 Ga0501048_0292393_404_835 142
387 3300049742 Ga0501080_0079221 Ga0501080_0079221_579_1010 142
388 3300049823 Ga0501044_0040510 Ga0501044_0040510_4161_4592 142
389 3300050489 nmdc:mga03683_51377_c1 nmdc:mga03683_51377_c1_1118_1546 142
390 3300050490 nmdc:mga03n38_714730_c1 nmdc:mga03n38_714730_c1_104_535 142
391 3300050494 nmdc:mga06z11_587941_c1 nmdc:mga06z11_587941_c1_118_546 142
392 3300053085 Ga0495619_1025056 Ga0495619_1025056_24_452 142
393 3300053093 Ga0500651_0235474 Ga0500651_0235474_411_842 142
394 3300006177 Ga0075362_10257762 Ga0075362_102577622 143
395 3300042015 Ga0439462_0047212 Ga0439462_0047212_139_576 143
396 3300050489 nmdc:mga03683_508449_c1 nmdc:mga03683_508449_c1_77_508 143
397 3300050496 nmdc:mga07m45_344078_c1 nmdc:mga07m45_344078_c1_83_514 143
398 3300002704 JGI25155J39150_1000002 JGI25155J39150_100000224 145
399 3300002705 JGI25156J39149_1000003 JGI25156J39149_1000003281 145
400 3300002738 JGI25154J39366_1000009 JGI25154J39366_100000924 145
401 3300002741 JGI25157J39369_1000002 JGI25157J39369_100000224 145
402 3300002987 JGI25159J45721_1000302 JGI25159J45721_10003024 145
403 3300002987 JGI25159J45721_1000502 JGI25159J45721_10005024 145
404 3300003187 JGI25151J46595_10017838 JGI25151J46595_100178382 145
405 3300003187 JGI25151J46595_10025203 JGI25151J46595_100252033 145
406 3300003187 JGI25151J46595_10044421 JGI25151J46595_100444212 145
407 3300003354 JGI25160J50197_1000145 JGI25160J50197_100014570 145
408 3300003374 JGI25161J50226_1000032 JGI25161J50226_1000032103 145
409 3300003374 JGI25161J50226_1000064 JGI25161J50226_100006412 145
410 3300003771 Ga0055526_1003563 Ga0055526_10035636 145
411 3300003771 Ga0055526_1009997 Ga0055526_10099974 145
412 3300003773 Ga0055537_1000043 Ga0055537_10000436 145
413 3300003773 Ga0055537_1008563 Ga0055537_10085632 145
414 3300003775 Ga0055524_1000012 Ga0055524_1000012119 145
415 3300003781 Ga0055536_1004794 Ga0055536_10047948 145
416 3300003784 Ga0055534_1005165 Ga0055534_10051652 145
417 3300003790 Ga0055528_1000717 Ga0055528_10007177 145
418 3300003791 Ga0055530_10000015 Ga0055530_10000015122 145
419 3300003791 Ga0055530_10035307 Ga0055530_100353072 145
420 3300003791 Ga0055530_10089805 Ga0055530_100898051 145
421 3300003792 Ga0055540_1000012 Ga0055540_1000012238 145
422 3300003792 Ga0055540_1000039 Ga0055540_100003920 145
423 3300003794 Ga0055531_10006340 Ga0055531_100063405 145
424 3300003794 Ga0055531_10114267 Ga0055531_101142671 145
425 3300004625 Ga0055543_1000752 Ga0055543_100075211 145
426 3300005262 Ga0065165_1007478 Ga0065165_10074786 145
427 3300005262 Ga0065165_1016049 Ga0065165_10160493 145
428 3300005262 Ga0065165_1016671 Ga0065165_10166712 145
429 3300005262 Ga0065165_1065678 Ga0065165_10656782 145
430 3300005539 Ga0068853_100051532 Ga0068853_1000515323 145
431 3300006038 Ga0075365_10539421 Ga0075365_105394212 145
432 3300006048 Ga0075363_100039336 Ga0075363_1000393362 145
433 3300006195 Ga0075366_10347115 Ga0075366_103471152 145
434 3300006353 Ga0075370_10195532 Ga0075370_101955321 145
435 3300006946 Ga0079104_1016249 Ga0079104_10162491 145
436 3300009551 Ga0105238_11056861 Ga0105238_110568612 145
437 3300025206 Ga0209435_100001 Ga0209435_100001692 145
438 3300025245 Ga0207425_1008756 Ga0207425_10087562 145
439 3300025246 Ga0209646_1000001 Ga0209646_10000011061 145
440 3300025250 Ga0209026_1000003 Ga0209026_1000003692 145
441 3300025256 Ga0209759_1000001 Ga0209759_1000001692 145
442 3300025263 Ga0209565_1000004 Ga0209565_1000004516 145
443 3300025263 Ga0209565_1001286 Ga0209565_10012864 145
444 3300025273 Ga0209673_1000357 Ga0209673_100035732 145
445 3300025284 Ga0209130_1000082 Ga0209130_100008246 145
446 3300025284 Ga0209130_1000094 Ga0209130_100009451 145
447 3300025291 Ga0209675_1000061 Ga0209675_1000061116 145
448 3300025291 Ga0209675_1006569 Ga0209675_10065694 145
449 3300025292 Ga0209676_1000029 Ga0209676_1000029387 145
450 3300025292 Ga0209676_1003883 Ga0209676_10038836 145
451 3300025294 Ga0209025_1006826 Ga0209025_10068268 145
452 3300025294 Ga0209025_1007422 Ga0209025_10074228 145
453 3300025294 Ga0209025_1033881 Ga0209025_10338813 145
454 3300025294 Ga0209025_1058171 Ga0209025_10581712 145
455 3300025295 Ga0209564_1000969 Ga0209564_100096933 145
456 3300025295 Ga0209564_1002810 Ga0209564_10028106 145
457 3300025295 Ga0209564_1010108 Ga0209564_10101084 145
458 3300025297 Ga0209758_1003972 Ga0209758_10039723 145
459 3300025298 Ga0209050_1000003 Ga0209050_1000003449 145
460 3300025298 Ga0209050_1005923 Ga0209050_10059233 145
461 3300025298 Ga0209050_1015438 Ga0209050_10154382 145
462 3300025299 Ga0209256_1000001 Ga0209256_1000001451 145
463 3300025302 Ga0207426_1000025 Ga0207426_1000025508 145
464 3300025302 Ga0207426_1033316 Ga0207426_10333162 145
465 3300025303 Ga0209051_1000003 Ga0209051_1000003449 145
466 3300025303 Ga0209051_1107143 Ga0209051_11071431 145
467 3300025304 Ga0209257_1000018 Ga0209257_1000018449 145
468 3300025304 Ga0209257_1014547 Ga0209257_10145472 145
469 3300026041 Ga0207639_10070432 Ga0207639_100704322 145
470 3300027907 Ga0207428_10177411 Ga0207428_101774113 145
471 3300031456 Ga0307513_10000051 Ga0307513_1000005157 145
472 3300031548 Ga0307408_100005073 Ga0307408_1000050737 145
473 3300031548 Ga0307408_102259560 Ga0307408_1022595601 145
474 3300031730 Ga0307516_10008844 Ga0307516_1000884410 145
475 3300031901 Ga0307406_10072159 Ga0307406_100721592 145
476 3300041512 Ga0451853_0206703 Ga0451853_0206703_418_873 145
477 3300050491 nmdc:mga00v17_340549_c1 nmdc:mga00v17_340549_c1_73_528 145
478 3300050493 nmdc:mga0k408_452078_c1 nmdc:mga0k408_452078_c1_48_503 145
479 3300053088 Ga0500644_0016039 Ga0500644_0016039_1502_1957 145
480 3300053100 Ga0500660_237644 Ga0500660_237644_81_539 145
481 3300053117 Ga0500593_016489 Ga0500593_016489_395_850 145
482 3300053158 Ga0500627_0199747 Ga0500627_0199747_144_602 145
483 3300053730 Ga0500645_002264 Ga0500645_002264_2038_2505 145
484 3300053730 Ga0500645_079960 Ga0500645_079960_146_583 145
485 3300055283 Ga0500661_001087 Ga0500661_001087_91_528 145
486 iso_pu_bacteria 2511231002 2511247026 145

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03061

4HBT

Thioesterase superfamily

46

124

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3dkz-assembly1.cif.gz_A crystal structure of the q7w9w5_borpa protein from bordetella parapertussis. northeast structural genomics consortium target bpr208c. 0.9728 3 127
2fs2-assembly1.cif.gz_B structure of the e. coli paai protein from the phyenylacetic acid degradation operon 0.9553 6 126
1zki-assembly1.cif.gz_B structure of conserved protein pa5202 from pseudomonas aeruginosa 0.9466 4 126
2dsl-assembly1.cif.gz_A mutant n33d structure of phenylacetic acid degradation protein paai from thermus thermophilus hb8 0.9434 7 124
3dkz-assembly1.cif.gz_A crystal structure of the q7w9w5_borpa protein from bordetella parapertussis. northeast structural genomics consortium target bpr208c. 0.9425 3 127
ID Description Score Start End Superfamily
3dkzB00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9731 3 126 3.10.129.10
1zkiB00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9495 6 126 3.10.129.10
2fs2B00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9483 6 126 3.10.129.10
3dkzB00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9415 3 126 3.10.129.10
1wluA00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9368 5 124 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A7J3SJJ5-F1-model_v4 PaaI family thioesterase 0.9613 8 124 GO:0047617
AF-A0A843A950-F1-model_v4 PaaI family thioesterase 0.955 8 127 GO:0047617
AF-A0A4R4M627-F1-model_v4 PaaI family thioesterase 0.952 6 131 GO:0047617
AF-A0A7K4FWL5-F1-model_v4 PaaI family thioesterase 0.9512 8 127 GO:0047617
AF-A0A3D2FXV3-F1-model_v4 Thioesterase domain-containing protein 0.9503 6 126 GO:0016289

Feature Viewer

pLDDT pTM Quality
88.68 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map