F453274

General Info

Members Datasets Scaffolds Average Seq Length
486 240 972 178

Family's Representative Sequence

Representative Sequence 3300021388|Ga0213875_10003790|Ga0213875_100037907
Length 204
Sequence MSAPPPDARHGALAAAGAPSFLHRAAHGWDFIEKTIVGLLGACALLAGTVQVIGRYIDPANAISWAEEVIVYLIIWAVMIVSSQLVRTDGHVRPDLLLRVLPPQGQRVLEIFNCLVGIAFAAGLAWYGKQIVDTALLLDETSSTDLQFPMWIYYSALPVGGGLMAVRYLIRLLRFLFAYDPATMTVGHTAIAHETPANLDLISG

Samples

Sample ID Description Type Environment
1 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
40 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
41 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
42 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
43 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
44 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
45 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
49 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
52 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
53 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
56 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
59 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
60 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
68 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
69 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
70 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
71 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
104 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
105 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
106 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
107 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
108 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
109 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
110 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
111 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
112 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
113 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
114 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
115 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
116 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
117 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
118 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
119 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
120 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
121 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
122 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
123 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
124 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
125 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
126 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
127 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
128 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
129 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
130 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
131 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
132 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
133 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
134 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
135 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
136 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
137 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
138 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
139 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
140 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
141 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
142 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
143 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
144 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
145 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
146 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
147 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
148 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
149 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
150 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
151 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
152 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
153 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
154 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
155 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
156 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
157 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
158 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
159 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
160 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
161 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
162 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
163 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
164 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
165 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
166 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
167 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
168 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
169 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
170 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
171 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
172 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
173 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
174 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
175 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
176 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
177 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
178 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
179 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
180 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
181 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
182 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
183 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
184 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
185 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
186 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
187 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
188 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
189 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
190 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
191 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
192 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
193 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
194 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
195 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
196 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
197 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
198 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
199 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
200 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
201 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
202 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
203 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
204 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
205 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
206 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
207 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
208 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
209 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
210 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
211 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
212 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
213 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
214 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
215 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
216 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
217 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
218 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
220 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
221 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
222 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
223 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
224 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
225 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
226 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
227 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
228 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
229 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
230 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
231 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
232 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
233 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
234 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
235 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
236 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
237 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
238 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
239 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
240 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.94
Metatranscriptomes 0
Isolates 2.06

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.06
Nodule 1.65
Rhizoplane 5.35
Rhizosphere 86.63
Stem 0
Stem Tuber 0
Unclassified 9.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0213875_10003790 3300021388 Bacteria 8501
2 rootH2_10070118 3300003320 Bacteria 1256
3 Ga0070658_10090873 3300005327 Bacteria 2516
4 Ga0070658_10249427 3300005327 Bacteria 1506
5 Ga0070658_11182004 3300005327 Bacteria 665
6 Ga0070683_100011578 3300005329 Bacteria 7632
7 Ga0070683_100043970 3300005329 Bacteria 4118
8 Ga0070683_100102308 3300005329 Bacteria 2698
9 Ga0070680_100071776 3300005336 Bacteria 2845
10 Ga0070680_100117758 3300005336 Bacteria 2215
11 Ga0070680_100127517 3300005336 Bacteria 2126
12 Ga0070682_100243979 3300005337 Bacteria 1291
13 Ga0070660_100279263 3300005339 Bacteria 1366
14 Ga0070691_10539763 3300005341 Bacteria 680
15 Ga0070661_100449182 3300005344 Bacteria 1025
16 Ga0070661_100702186 3300005344 Unclassified 824
17 Ga0070661_100716098 3300005344 Unclassified 816
18 Ga0070668_100252576 3300005347 Bacteria 1464
19 Ga0070668_100705615 3300005347 Bacteria 890
20 Ga0070659_100268540 3300005366 Bacteria 1417
21 Ga0070709_10029579 3300005434 Bacteria 3278
22 Ga0070709_10070666 3300005434 Bacteria 2251
23 Ga0070709_10591979 3300005434 Bacteria 853
24 Ga0070713_100130349 3300005436 Bacteria 2216
25 Ga0070713_100615943 3300005436 Unclassified 1032
26 Ga0070711_100024240 3300005439 Bacteria 3955
27 Ga0070711_100136937 3300005439 Bacteria 1831
28 Ga0070705_100358035 3300005440 Bacteria 1066
29 Ga0070663_100020527 3300005455 Bacteria 4376
30 Ga0070663_100057012 3300005455 Bacteria 2801
31 Ga0070678_100010290 3300005456 Bacteria 5705
32 Ga0070662_100259432 3300005457 Bacteria 1400
33 Ga0070681_10016908 3300005458 Bacteria 7287
34 Ga0070681_10114120 3300005458 Bacteria 2641
35 Ga0070681_10120679 3300005458 Bacteria 2556
36 Ga0070681_10232252 3300005458 Bacteria 1759
37 Ga0068867_100460054 3300005459 Bacteria 1086
38 Ga0070706_100171033 3300005467 Bacteria 2029
39 Ga0070707_100435132 3300005468 Bacteria 1272
40 Ga0070698_100096615 3300005471 Bacteria 2931
41 Ga0070679_100003976 3300005530 Bacteria 13614
42 Ga0070679_100073494 3300005530 Bacteria 3410
43 Ga0070679_100165049 3300005530 Bacteria 2188
44 Ga0070679_100291898 3300005530 Bacteria 1582
45 Ga0070684_100006536 3300005535 Bacteria 9024
46 Ga0070684_100123874 3300005535 Bacteria 2326
47 Ga0070684_100801857 3300005535 Bacteria 880
48 Ga0068853_100310556 3300005539 Unclassified 1459
49 Ga0068853_100610683 3300005539 Unclassified 1036
50 Ga0068853_100819890 3300005539 Bacteria 891
51 Ga0070695_100645617 3300005545 Unclassified 835
52 Ga0070693_100394509 3300005547 Bacteria 958
53 Ga0070665_100377562 3300005548 Bacteria 1425
54 Ga0070665_100790344 3300005548 Bacteria 962
55 Ga0068855_100043156 3300005563 Bacteria 5343
56 Ga0068855_100124375 3300005563 Bacteria 2950
57 Ga0068855_100313106 3300005563 Bacteria 1736
58 Ga0068855_100549807 3300005563 Bacteria 1250
59 Ga0068855_100553224 3300005563 Bacteria 1245
60 Ga0068855_100976319 3300005563 Bacteria 891
61 Ga0070664_100006363 3300005564 Bacteria 9532
62 Ga0070664_100477264 3300005564 Bacteria 1147
63 Ga0070664_100642076 3300005564 Unclassified 986
64 Ga0068857_100048375 3300005577 Bacteria 3776
65 Ga0068857_100255734 3300005577 Unclassified 1606
66 Ga0068857_100286276 3300005577 Bacteria 1516
67 Ga0068854_100054859 3300005578 Bacteria 2868
68 Ga0068856_100000091 3300005614 Bacteria 85048
69 Ga0070702_100027392 3300005615 Bacteria 3074
70 Ga0068852_100152010 3300005616 Bacteria 2153
71 Ga0068864_100302666 3300005618 Bacteria 1497
72 Ga0068860_100624660 3300005843 Bacteria 1084
73 Ga0081455_10016462 3300005937 Bacteria 7138
74 Ga0081540_1026378 3300005983 Bacteria 3317
75 Ga0070717_10063087 3300006028 Bacteria 3074
76 Ga0075363_100276797 3300006048 Unclassified 970
77 Ga0070715_10112237 3300006163 Bacteria 1287
78 Ga0070716_100021272 3300006173 Bacteria 3415
79 Ga0070716_100087088 3300006173 Bacteria 1881
80 Ga0070712_100107298 3300006175 Bacteria 2077
81 Ga0070712_100244381 3300006175 Unclassified 1431
82 Ga0097621_101141404 3300006237 Bacteria 733
83 Ga0068865_100018611 3300006881 Bacteria 4484
84 Ga0099794_10079189 3300007265 Unclassified 1619
85 Ga0099795_10116197 3300007788 Bacteria 1065
86 Ga0099795_10219619 3300007788 Bacteria 808
87 Ga0105240_10356319 3300009093 Bacteria 1659
88 Ga0105240_11312080 3300009093 Bacteria 763
89 Ga0105247_10049990 3300009101 Unclassified 2572
90 Ga0105247_10131193 3300009101 Bacteria 1633
91 Ga0105241_10082583 3300009174 Bacteria 2519
92 Ga0105241_10109452 3300009174 Bacteria 2210
93 Ga0105237_10013867 3300009545 Bacteria 8434
94 Ga0105237_10318241 3300009545 Bacteria 1559
95 Ga0105237_10589253 3300009545 Bacteria 1119
96 Ga0105238_10228945 3300009551 Bacteria 1836
97 Ga0105238_10294470 3300009551 Unclassified 1606
98 Ga0105249_10249628 3300009553 Bacteria 1759
99 Ga0099796_10204798 3300010159 Unclassified 802
100 Ga0105239_10090388 3300010375 Bacteria 3378
101 Ga0105239_10347649 3300010375 Bacteria 1674
102 Ga0105246_10056567 3300011119 Bacteria 2712
103 Ga0105246_11194327 3300011119 Unclassified 700
104 Ga0157373_10083935 3300013100 Bacteria 2245
105 Ga0157370_10012479 3300013104 Bacteria 8806
106 Ga0157370_10026147 3300013104 Bacteria 5766
107 Ga0157370_10357542 3300013104 Bacteria 1346
108 Ga0157369_10021402 3300013105 Bacteria 7234
109 Ga0157369_10032113 3300013105 Bacteria 5775
110 Ga0157369_10312890 3300013105 Bacteria 1633
111 Ga0157369_10851077 3300013105 Bacteria 936
112 Ga0157374_10154945 3300013296 Bacteria 2229
113 Ga0157374_10786726 3300013296 Bacteria 967
114 Ga0163162_10124207 3300013306 Bacteria 2687
115 Ga0163162_10207366 3300013306 Bacteria 2089
116 Ga0157372_10299680 3300013307 Bacteria 1870
117 Ga0157375_10115963 3300013308 Bacteria 2782
118 Ga0157375_10196038 3300013308 Bacteria 2175
119 Ga0157375_10404800 3300013308 Bacteria 1531
120 Ga0163163_10007629 3300014325 Bacteria 9555
121 Ga0163163_10242548 3300014325 Bacteria 1852
122 Ga0163163_11611747 3300014325 Unclassified 710
123 Ga0157380_10416868 3300014326 Bacteria 1279
124 Ga0157379_10191605 3300014968 Bacteria 1848
125 Ga0157376_10107214 3300014969 Bacteria 2452
126 Ga0213871_10177729 3300021441 Unclassified 657
127 Ga0207647_10105089 3300025904 Bacteria 1673
128 Ga0207685_10003219 3300025905 Bacteria 3929
129 Ga0207699_10012230 3300025906 Bacteria 4361
130 Ga0207699_10040223 3300025906 Bacteria 2693
131 Ga0207705_10350924 3300025909 Bacteria 1136
132 Ga0207654_10061739 3300025911 Bacteria 2193
133 Ga0207707_10014571 3300025912 Bacteria 6850
134 Ga0207707_10014733 3300025912 Bacteria 6813
135 Ga0207707_10063692 3300025912 Bacteria 3209
136 Ga0207707_10610925 3300025912 Bacteria 922
137 Ga0207671_10107605 3300025914 Bacteria 2118
138 Ga0207693_10006814 3300025915 Bacteria 9435
139 Ga0207663_10005499 3300025916 Bacteria 6389
140 Ga0207663_10032594 3300025916 Bacteria 3095
141 Ga0207660_10014589 3300025917 Bacteria 5170
142 Ga0207660_10385176 3300025917 Unclassified 1127
143 Ga0207657_10123546 3300025919 Bacteria 2128
144 Ga0207657_10246815 3300025919 Bacteria 1424
145 Ga0207652_10047962 3300025921 Bacteria 3650
146 Ga0207652_10092337 3300025921 Bacteria 2663
147 Ga0207652_10097487 3300025921 Bacteria 2591
148 Ga0207646_10469445 3300025922 Bacteria 1135
149 Ga0207694_10034686 3300025924 Bacteria 3869
150 Ga0207694_10271995 3300025924 Bacteria 1390
151 Ga0207687_10876590 3300025927 Bacteria 767
152 Ga0207664_10315524 3300025929 Bacteria 1378
153 Ga0207664_10855855 3300025929 Bacteria 817
154 Ga0207690_10168829 3300025932 Bacteria 1637
155 Ga0207706_10085822 3300025933 Bacteria 2767
156 Ga0207665_10042438 3300025939 Bacteria 3040
157 Ga0207661_10003533 3300025944 Bacteria 10857
158 Ga0207661_10012643 3300025944 Bacteria 6144
159 Ga0207679_10414581 3300025945 Bacteria 1187
160 Ga0207667_10233290 3300025949 Bacteria 1884
161 Ga0207667_10549540 3300025949 Bacteria 1168
162 Ga0207712_10651050 3300025961 Bacteria 916
163 Ga0207668_10191672 3300025972 Bacteria 1620
164 Ga0207668_10618886 3300025972 Bacteria 945
165 Ga0207640_10107019 3300025981 Bacteria 1974
166 Ga0207640_10380984 3300025981 Bacteria 1143
167 Ga0207678_10015997 3300026067 Bacteria 6589
168 Ga0207702_10000041 3300026078 Bacteria 150754
169 Ga0207702_10356024 3300026078 Bacteria 1402
170 Ga0207702_11133345 3300026078 Bacteria 776
171 Ga0207674_10112121 3300026116 Bacteria 2701
172 Ga0207674_10278895 3300026116 Bacteria 1619
173 Ga0207674_10309511 3300026116 Bacteria 1529
174 Ga0207683_10025732 3300026121 Bacteria 5076
175 Ga0207698_10073836 3300026142 Bacteria 2717
176 Ga0268266_10584378 3300028379 Bacteria 1072
177 Ga0268264_10806094 3300028381 Bacteria 938
178 Ga0265334_10009519 3300028573 Bacteria 4109
179 Ga0307511_10097404 3300030521 Bacteria 1953
180 Ga0265316_10425584 3300031344 Bacteria 954
181 Ga0265316_10652981 3300031344 Bacteria 744
182 Ga0307509_10020003 3300031507 Bacteria 7610
183 Ga0307508_10000199 3300031616 Bacteria 72296
184 Ga0307508_10024356 3300031616 Bacteria 5492
185 Ga0307508_10173866 3300031616 Bacteria 1757
186 Ga0307508_10448403 3300031616 Bacteria 882
187 Ga0265314_10003843 3300031711 Bacteria 14320
188 Ga0265314_10024022 3300031711 Bacteria 4631
189 Ga0265342_10005010 3300031712 Bacteria 10223
190 Ga0307516_10017586 3300031730 Bacteria 7449
191 Ga0307510_10489544 3300033180 Bacteria 672
192 Ga0373926_0056613 3300035083 Bacteria 1423
193 Ga0373926_0069882 3300035083 Bacteria 1289
194 Ga0373934_0034957 3300035086 Bacteria 1976
195 Ga0373934_0041561 3300035086 Unclassified 1815
196 Ga0373944_0025136 3300035089 Bacteria 1751
197 Ga0373923_0007010 3300035111 Bacteria 3935
198 Ga0373923_0040743 3300035111 Bacteria 1913
199 Ga0373923_0047762 3300035111 Bacteria 1785
200 Ga0373936_0011143 3300035113 Bacteria 3397
201 Ga0373936_0041633 3300035113 Bacteria 1843
202 Ga0373936_0064503 3300035113 Bacteria 1501
203 Ga0373945_0018233 3300035116 Bacteria 2387
204 Ga0373945_0359864 3300035116 Unclassified 632
205 Ga0373953_0016636 3300035117 Bacteria 2688
206 Ga0373953_0031117 3300035117 Bacteria 2074
207 Ga0373954_0002963 3300035118 Bacteria 7167
208 Ga0373954_0203999 3300035118 Unclassified 971
209 Ga0373956_0035957 3300035119 Bacteria 2185
210 Ga0373956_0160179 3300035119 Unclassified 1060
211 Ga0373957_0005082 3300035120 Bacteria 4061
212 Ga0373957_0040053 3300035120 Unclassified 1760
213 Ga0373957_0160023 3300035120 Unclassified 927
214 Ga0373943_0023261 3300035170 Bacteria 2880
215 Ga0373943_0203166 3300035170 Bacteria 1097
216 Ga0373946_0014171 3300035171 Unclassified 3004
217 Ga0373955_0001157 3300035172 Bacteria 11196
218 Ga0373955_0033744 3300035172 Bacteria 2697
219 Ga0373955_0044412 3300035172 Bacteria 2393
220 Ga0373955_0467581 3300035172 Unclassified 769
221 Ga0373924_0005774 3300035410 Bacteria 4401
222 Ga0373931_0133208 3300035691 Bacteria 1433
223 Ga0373935_0000091 3300035692 Bacteria 39600
224 Ga0373935_0021612 3300035692 Bacteria 3941
225 Ga0373935_0103311 3300035692 Unclassified 1882
226 Ga0373927_0032215 3300035695 Bacteria 3413
227 Ga0373927_0034187 3300035695 Bacteria 3307
228 Ga0373927_0055414 3300035695 Bacteria 2563
229 Ga0373927_0095839 3300035695 Bacteria 1929
230 Ga0373933_0002696 3300035724 Bacteria 9942
231 Ga0373933_0044185 3300035724 Bacteria 2638
232 Ga0373947_0001563 3300035725 Bacteria 14019
233 Ga0373947_0004298 3300035725 Bacteria 8370
234 Ga0373947_0031012 3300035725 Bacteria 3143
235 Ga0373947_0671797 3300035725 Bacteria 706
236 Ga0373937_0002525 3300036401 Bacteria 15194
237 Ga0373937_0033736 3300036401 Bacteria 4652
238 Ga0373937_0152419 3300036401 Bacteria 2165
239 Ga0373937_0266036 3300036401 Unclassified 1617
240 Ga0373937_0463923 3300036401 Bacteria 1203
241 Ga0373937_0497270 3300036401 Unclassified 1158
242 Ga0373937_0726449 3300036401 Bacteria 940
243 Ga0373925_0000038 3300037068 Bacteria 142088
244 Ga0373925_0029322 3300037068 Bacteria 4037
245 Ga0373925_0036436 3300037068 Bacteria 3631
246 Ga0373925_0057363 3300037068 Bacteria 2917
247 Ga0373925_0169380 3300037068 Bacteria 1724
248 Ga0373925_0220718 3300037068 Bacteria 1513
249 Ga0395899_0015971 3300037312 Bacteria 5725
250 Ga0395899_0091329 3300037312 Bacteria 2206
251 Ga0395900_0001383 3300037418 Bacteria 29135
252 Ga0395900_0053028 3300037418 Bacteria 4174
253 Ga0395900_0200981 3300037418 Bacteria 2016
254 Ga0395898_0066203 3300037466 Bacteria 3501
255 Ga0395898_0350637 3300037466 Bacteria 1407
256 Ga0436364_0775609 3300037853 Bacteria 31150
257 Ga0395901_0029620 3300038443 Bacteria 5637
258 Ga0395901_0067252 3300038443 Bacteria 3731
259 Ga0395901_0088930 3300038443 Bacteria 3231
260 Ga0395901_0107651 3300038443 Bacteria 2926
261 Ga0395901_0142509 3300038443 Bacteria 2519
262 Ga0436360_0079994 3300039438 Unclassified 800
263 Ga0436360_0206681 3300039438 Bacteria 2829
264 Ga0436360_0240220 3300039438 Unclassified 945
265 Ga0436360_0377280 3300039438 Bacteria 1066
266 Ga0436360_1002242 3300039438 Bacteria 994
267 Ga0436361_0266818 3300039447 Bacteria 3013
268 Ga0436361_0730675 3300039447 Bacteria 4833
269 Ga0436363_1017620 3300039450 Bacteria 2180
270 Ga0436362_0869184 3300039453 Bacteria 1483
271 Ga0436362_1125054 3300039453 Bacteria 800
272 Ga0439448_0080701 3300042005 Bacteria 1092
273 Ga0466969_0091954 3300044656 Bacteria 1437
274 Ga0466961_0347735 3300044693 Bacteria 903
275 Ga0466961_0353195 3300044693 Bacteria 895
276 Ga0466963_0019020 3300044694 Bacteria 4301
277 Ga0466964_0136981 3300044706 Bacteria 1121
278 Ga0466970_0329924 3300044765 Unclassified 864
279 Ga0466957_0044792 3300044842 Bacteria 2682
280 Ga0466957_1337466 3300044842 Unclassified 520
281 Ga0466960_0528457 3300044901 Bacteria 694
282 Ga0466959_0020313 3300045049 Bacteria 4892
283 Ga0466958_0227924 3300045836 Bacteria 1189
284 Ga0466967_0123174 3300045976 Bacteria 2398
285 Ga0495592_0000155 3300046454 Bacteria 59925
286 Ga0495592_0051328 3300046454 Bacteria 3063
287 Ga0495592_0113231 3300046454 Unclassified 1917
288 Ga0495603_0003570 3300046455 Bacteria 9265
289 Ga0495603_0031448 3300046455 Bacteria 3195
290 Ga0495603_0161895 3300046455 Bacteria 1298
291 Ga0495629_0000835 3300046459 Bacteria 24987
292 Ga0495629_0024363 3300046459 Bacteria 4309
293 Ga0495629_0099900 3300046459 Unclassified 2025
294 Ga0495629_0142710 3300046459 Bacteria 1666
295 Ga0495638_0003352 3300046460 Bacteria 12638
296 Ga0495641_0016730 3300046461 Bacteria 3853
297 Ga0495641_0173443 3300046461 Bacteria 965
298 Ga0495651_0000750 3300046462 Bacteria 25090
299 Ga0495651_0030436 3300046462 Bacteria 4209
300 Ga0495651_0030803 3300046462 Bacteria 4183
301 Ga0495651_0203320 3300046462 Bacteria 1384
302 Ga0495653_0000075 3300046463 Bacteria 82856
303 Ga0495653_0070945 3300046463 Bacteria 2605
304 Ga0495580_0016825 3300046472 Bacteria 5486
305 Ga0495580_0048245 3300046472 Bacteria 3016
306 Ga0495582_0013579 3300046473 Bacteria 4484
307 Ga0495582_0066788 3300046473 Bacteria 1987
308 Ga0495582_0118549 3300046473 Bacteria 1490
309 Ga0495582_0184402 3300046473 Unclassified 1189
310 Ga0495639_0002753 3300046475 Bacteria 7634
311 Ga0495639_0006018 3300046475 Bacteria 5215
312 Ga0495639_0182571 3300046475 Bacteria 1022
313 Ga0495662_0015473 3300046476 Bacteria 3702
314 Ga0495662_0019880 3300046476 Bacteria 3249
315 Ga0495664_0000009 3300046477 Bacteria 289534
316 Ga0495664_0019073 3300046477 Bacteria 3939
317 Ga0495664_0030743 3300046477 Bacteria 3146
318 Ga0495664_0182470 3300046477 Bacteria 1272
319 Ga0495594_0011774 3300046499 Bacteria 4546
320 Ga0495594_0132128 3300046499 Bacteria 1414
321 Ga0495608_0000022 3300046511 Bacteria 165111
322 Ga0495608_0012812 3300046511 Bacteria 5819
323 Ga0495618_0000016 3300046514 Bacteria 151770
324 Ga0495618_0018589 3300046514 Bacteria 4268
325 Ga0495618_0073174 3300046514 Bacteria 2181
326 Ga0495618_0281103 3300046514 Unclassified 1038
327 Ga0495628_0000012 3300046516 Bacteria 224162
328 Ga0495628_0063697 3300046516 Bacteria 2888
329 Ga0495630_0000648 3300046517 Bacteria 25194
330 Ga0495630_0251894 3300046517 Bacteria 1349
331 Ga0495652_0000021 3300046529 Bacteria 181454
332 Ga0495652_0059200 3300046529 Bacteria 3242
333 Ga0495652_0087364 3300046529 Bacteria 2558
334 Ga0495665_0047637 3300046531 Bacteria 2274
335 Ga0495665_0051098 3300046531 Bacteria 2190
336 Ga0495665_0143647 3300046531 Bacteria 1246
337 Ga0495640_0000031 3300046533 Bacteria 77381
338 Ga0495640_0018387 3300046533 Bacteria 5186
339 Ga0495640_0031409 3300046533 Bacteria 3790
340 Ga0495640_0058616 3300046533 Bacteria 2625
341 Ga0495640_0081545 3300046533 Bacteria 2150
342 Ga0495587_0000052 3300046536 Bacteria 100154
343 Ga0495587_0060784 3300046536 Bacteria 2214
344 Ga0495645_0000361 3300046543 Bacteria 31642
345 Ga0495645_0019536 3300046543 Bacteria 4877
346 Ga0495645_0055682 3300046543 Bacteria 2872
347 Ga0495645_0065887 3300046543 Bacteria 2620
348 Ga0495622_0033746 3300046557 Bacteria 2388
349 Ga0495667_0000011 3300046559 Bacteria 222545
350 Ga0495667_0019193 3300046559 Bacteria 4613
351 Ga0495667_0254127 3300046559 Bacteria 1118
352 Ga0495634_0000080 3300046642 Bacteria 76133
353 Ga0495634_0001398 3300046642 Bacteria 21701
354 Ga0495634_0025764 3300046642 Bacteria 4108
355 Ga0495634_0027129 3300046642 Bacteria 3987
356 Ga0495634_0051140 3300046642 Bacteria 2773
357 Ga0495625_0142060 3300046660 Bacteria 1619
358 Ga0495635_0000018 3300046663 Bacteria 193591
359 Ga0495635_0009070 3300046663 Bacteria 6941
360 Ga0495635_0064878 3300046663 Bacteria 2506
361 Ga0495635_0154806 3300046663 Bacteria 1560
362 Ga0495635_0223713 3300046663 Bacteria 1272
363 Ga0495588_0160077 3300046674 Bacteria 1191
364 Ga0495588_0223085 3300046674 Bacteria 995
365 Ga0495657_0004321 3300046675 Bacteria 11349
366 Ga0495599_0000288 3300046678 Bacteria 30832
367 Ga0495599_0021185 3300046678 Bacteria 4055
368 Ga0495599_0067176 3300046678 Bacteria 2239
369 Ga0495599_0686440 3300046678 Bacteria 591
370 Ga0495623_0000127 3300046679 Bacteria 46032
371 Ga0495623_0066227 3300046679 Bacteria 2257
372 Ga0495623_0076317 3300046679 Bacteria 2079
373 Ga0495623_0077995 3300046679 Bacteria 2054
374 Ga0495646_0000038 3300046680 Bacteria 75050
375 Ga0495646_0010382 3300046680 Bacteria 5923
376 Ga0495646_0099196 3300046680 Bacteria 1672
377 Ga0495647_0007809 3300046681 Bacteria 3592
378 Ga0495647_0010326 3300046681 Bacteria 3178
379 Ga0495647_0152875 3300046681 Bacteria 990
380 Ga0495658_0034620 3300046683 Bacteria 2772
381 Ga0495658_0043470 3300046683 Bacteria 2513
382 Ga0495658_0086551 3300046683 Bacteria 1849
383 Ga0495658_0234585 3300046683 Bacteria 1151
384 Ga0495613_0021540 3300046689 Bacteria 4802
385 Ga0495613_0286511 3300046689 Bacteria 1143
386 Ga0495624_0086486 3300046690 Bacteria 1936
387 Ga0495600_0000197 3300046809 Bacteria 34960
388 Ga0495600_0024192 3300046809 Bacteria 3908
389 Ga0495600_0082824 3300046809 Unclassified 2093
390 Ga0495600_0222276 3300046809 Bacteria 1208
391 Ga0495600_0593203 3300046809 Unclassified 674
392 Ga0495581_0010753 3300047315 Bacteria 5291
393 Ga0495581_0141515 3300047315 Bacteria 1403
394 Ga0495604_0000011 3300047317 Bacteria 292024
395 Ga0495604_0066661 3300047317 Bacteria 2737
396 Ga0495674_0000015 3300047319 Bacteria 224071
397 Ga0495674_0014752 3300047319 Bacteria 7310
398 Ga0495674_0084752 3300047319 Bacteria 2715
399 Ga0495674_0095242 3300047319 Unclassified 2538
400 Ga0495674_0131838 3300047319 Unclassified 2105
401 Ga0495672_0138596 3300047320 Bacteria 1273
402 Ga0495676_0093910 3300047321 Bacteria 2236
403 Ga0495680_0004021 3300047322 Bacteria 14186
404 Ga0495680_0023620 3300047322 Bacteria 5109
405 Ga0495680_0366804 3300047322 Bacteria 1000
406 Ga0495675_0000142 3300047444 Bacteria 49912
407 Ga0495675_0079687 3300047444 Bacteria 2062
408 Ga0495675_0308061 3300047444 Unclassified 939
409 Ga0495684_0000012 3300047471 Bacteria 187118
410 Ga0495684_0025911 3300047471 Bacteria 4506
411 Ga0495684_0201381 3300047471 Bacteria 1467
412 Ga0495593_0003874 3300047673 Bacteria 8939
413 Ga0495593_0005678 3300047673 Bacteria 7361
414 Ga0495593_0006908 3300047673 Bacteria 6647
415 Ga0495593_0119510 3300047673 Unclassified 1342
416 Ga0495602_0000018 3300048088 Bacteria 183837
417 Ga0495602_0082230 3300048088 Unclassified 2703
418 Ga0496100_0218064 3300048903 Bacteria 1399
419 Ga0496100_1075617 3300048903 Bacteria 634
420 Ga0496101_0508171 3300048904 Bacteria 952
421 Ga0496102_0037588 3300048905 Bacteria 4368
422 Ga0496102_0058256 3300048905 Bacteria 3529
423 Ga0496103_0042822 3300048906 Bacteria 2787
424 Ga0496104_0050443 3300048907 Bacteria 3926
425 Ga0496105_0032788 3300048908 Bacteria 4264
426 Ga0496105_0125069 3300048908 Bacteria 2120
427 Ga0496106_0067580 3300048909 Bacteria 2725
428 Ga0496107_0364768 3300048910 Unclassified 1074
429 Ga0496107_0385468 3300048910 Bacteria 1042
430 Ga0496108_0153335 3300048911 Bacteria 1989
431 Ga0496109_0063961 3300048912 Bacteria 3365
432 Ga0496109_0263124 3300048912 Bacteria 1625
433 Ga0496110_0135540 3300048913 Bacteria 2225
434 Ga0496110_0169330 3300048913 Bacteria 1981
435 Ga0496111_0027300 3300048914 Bacteria 4037
436 Ga0496112_0000419 3300048915 Bacteria 28061
437 Ga0496112_0028482 3300048915 Bacteria 5392
438 Ga0496113_0047499 3300048916 Bacteria 3190
439 Ga0496113_0281529 3300048916 Bacteria 1330
440 Ga0496114_0144635 3300048917 Bacteria 2061
441 Ga0496115_0046993 3300048918 Bacteria 3451
442 Ga0496115_0095858 3300048918 Bacteria 2429
443 Ga0496115_0210603 3300048918 Bacteria 1606
444 Ga0496121_0011656 3300048924 Bacteria 9716
445 Ga0496121_0013259 3300048924 Bacteria 8876
446 Ga0496126_0018279 3300048929 Bacteria 6953
447 Ga0496126_0046871 3300048929 Bacteria 3960
448 Ga0496126_0061521 3300048929 Bacteria 3372
449 Ga0496126_0289652 3300048929 Bacteria 1354
450 Ga0496126_0587556 3300048929 Bacteria 879
451 Ga0501034_0300628 3300049571 Bacteria 1541
452 Ga0501072_0785508 3300049588 Bacteria 746
453 nmdc:mga0sz30_47766_c1 3300050516 Bacteria 868
454 Ga0495601_0000015 3300053077 Bacteria 213851
455 Ga0495601_0013534 3300053077 Bacteria 4906
456 Ga0495601_0102955 3300053077 Bacteria 1845
457 Ga0495601_0112966 3300053077 Bacteria 1760
458 Ga0495612_0000016 3300053078 Bacteria 158947
459 Ga0495612_0013300 3300053078 Bacteria 3315
460 Ga0495612_0024014 3300053078 Bacteria 2448
461 Ga0495595_0000037 3300053084 Bacteria 78496
462 Ga0495595_0001034 3300053084 Bacteria 10719
463 Ga0495595_0033250 3300053084 Bacteria 2326
464 Ga0495619_0000066 3300053085 Bacteria 83667
465 Ga0495619_0007058 3300053085 Bacteria 7109
466 Ga0495619_0032998 3300053085 Bacteria 3361
467 Ga0495619_0079292 3300053085 Unclassified 2208
468 Ga0495619_0386235 3300053085 Bacteria 967
469 Ga0500578_0471698 3300053086 Bacteria 711
470 Ga0500641_0017535 3300053096 Bacteria 2680
471 Ga0500595_057487 3300053119 Bacteria 1185
472 Ga0500603_019892 3300053150 Bacteria 1634
473 Ga0500639_065923 3300053163 Bacteria 1857
474 Ga0500639_246129 3300053163 Bacteria 721
475 Ga0500637_0057754 3300053178 Bacteria 2218
476 Ga0500552_009059 3300053733 Bacteria 1191
477 2513889868 2513237141 Bacteria 8496279
478 2885416050 2885409591 Bacteria 9235467
479 2885418707 2885409591 Bacteria 9235467
480 2935690948 2935684952 Bacteria 9590419
481 2935718329 2935713505 Bacteria 9608509
482 2935727691 2935722832 Bacteria 9608746
483 2935736394 2935732158 Bacteria 9706831
484 2935745774 2935741537 Bacteria 9707219
485 2935756155 2935750917 Bacteria 9590372
486 2940561870 2940556831 Bacteria 9590747
487 Ga0213875_10003790
488 rootH2_10070118
489 Ga0070658_10090873
490 Ga0070658_10249427
491 Ga0070658_11182004
492 Ga0070683_100011578
493 Ga0070683_100043970
494 Ga0070683_100102308
495 Ga0070680_100071776
496 Ga0070680_100117758
497 Ga0070680_100127517
498 Ga0070682_100243979
499 Ga0070660_100279263
500 Ga0070691_10539763
501 Ga0070661_100449182
502 Ga0070661_100702186
503 Ga0070661_100716098
504 Ga0070668_100252576
505 Ga0070668_100705615
506 Ga0070659_100268540
507 Ga0070709_10029579
508 Ga0070709_10070666
509 Ga0070709_10591979
510 Ga0070713_100130349
511 Ga0070713_100615943
512 Ga0070711_100024240
513 Ga0070711_100136937
514 Ga0070705_100358035
515 Ga0070663_100020527
516 Ga0070663_100057012
517 Ga0070678_100010290
518 Ga0070662_100259432
519 Ga0070681_10016908
520 Ga0070681_10114120
521 Ga0070681_10120679
522 Ga0070681_10232252
523 Ga0068867_100460054
524 Ga0070706_100171033
525 Ga0070707_100435132
526 Ga0070698_100096615
527 Ga0070679_100003976
528 Ga0070679_100073494
529 Ga0070679_100165049
530 Ga0070679_100291898
531 Ga0070684_100006536
532 Ga0070684_100123874
533 Ga0070684_100801857
534 Ga0068853_100310556
535 Ga0068853_100610683
536 Ga0068853_100819890
537 Ga0070695_100645617
538 Ga0070693_100394509
539 Ga0070665_100377562
540 Ga0070665_100790344
541 Ga0068855_100043156
542 Ga0068855_100124375
543 Ga0068855_100313106
544 Ga0068855_100549807
545 Ga0068855_100553224
546 Ga0068855_100976319
547 Ga0070664_100006363
548 Ga0070664_100477264
549 Ga0070664_100642076
550 Ga0068857_100048375
551 Ga0068857_100255734
552 Ga0068857_100286276
553 Ga0068854_100054859
554 Ga0068856_100000091
555 Ga0070702_100027392
556 Ga0068852_100152010
557 Ga0068864_100302666
558 Ga0068860_100624660
559 Ga0081455_10016462
560 Ga0081540_1026378
561 Ga0070717_10063087
562 Ga0075363_100276797
563 Ga0070715_10112237
564 Ga0070716_100021272
565 Ga0070716_100087088
566 Ga0070712_100107298
567 Ga0070712_100244381
568 Ga0097621_101141404
569 Ga0068865_100018611
570 Ga0099794_10079189
571 Ga0099795_10116197
572 Ga0099795_10219619
573 Ga0105240_10356319
574 Ga0105240_11312080
575 Ga0105247_10049990
576 Ga0105247_10131193
577 Ga0105241_10082583
578 Ga0105241_10109452
579 Ga0105237_10013867
580 Ga0105237_10318241
581 Ga0105237_10589253
582 Ga0105238_10228945
583 Ga0105238_10294470
584 Ga0105249_10249628
585 Ga0099796_10204798
586 Ga0105239_10090388
587 Ga0105239_10347649
588 Ga0105246_10056567
589 Ga0105246_11194327
590 Ga0157373_10083935
591 Ga0157370_10012479
592 Ga0157370_10026147
593 Ga0157370_10357542
594 Ga0157369_10021402
595 Ga0157369_10032113
596 Ga0157369_10312890
597 Ga0157369_10851077
598 Ga0157374_10154945
599 Ga0157374_10786726
600 Ga0163162_10124207
601 Ga0163162_10207366
602 Ga0157372_10299680
603 Ga0157375_10115963
604 Ga0157375_10196038
605 Ga0157375_10404800
606 Ga0163163_10007629
607 Ga0163163_10242548
608 Ga0163163_11611747
609 Ga0157380_10416868
610 Ga0157379_10191605
611 Ga0157376_10107214
612 Ga0213871_10177729
613 Ga0207647_10105089
614 Ga0207685_10003219
615 Ga0207699_10012230
616 Ga0207699_10040223
617 Ga0207705_10350924
618 Ga0207654_10061739
619 Ga0207707_10014571
620 Ga0207707_10014733
621 Ga0207707_10063692
622 Ga0207707_10610925
623 Ga0207671_10107605
624 Ga0207693_10006814
625 Ga0207663_10005499
626 Ga0207663_10032594
627 Ga0207660_10014589
628 Ga0207660_10385176
629 Ga0207657_10123546
630 Ga0207657_10246815
631 Ga0207652_10047962
632 Ga0207652_10092337
633 Ga0207652_10097487
634 Ga0207646_10469445
635 Ga0207694_10034686
636 Ga0207694_10271995
637 Ga0207687_10876590
638 Ga0207664_10315524
639 Ga0207664_10855855
640 Ga0207690_10168829
641 Ga0207706_10085822
642 Ga0207665_10042438
643 Ga0207661_10003533
644 Ga0207661_10012643
645 Ga0207679_10414581
646 Ga0207667_10233290
647 Ga0207667_10549540
648 Ga0207712_10651050
649 Ga0207668_10191672
650 Ga0207668_10618886
651 Ga0207640_10107019
652 Ga0207640_10380984
653 Ga0207678_10015997
654 Ga0207702_10000041
655 Ga0207702_10356024
656 Ga0207702_11133345
657 Ga0207674_10112121
658 Ga0207674_10278895
659 Ga0207674_10309511
660 Ga0207683_10025732
661 Ga0207698_10073836
662 Ga0268266_10584378
663 Ga0268264_10806094
664 Ga0265334_10009519
665 Ga0307511_10097404
666 Ga0265316_10425584
667 Ga0265316_10652981
668 Ga0307509_10020003
669 Ga0307508_10000199
670 Ga0307508_10024356
671 Ga0307508_10173866
672 Ga0307508_10448403
673 Ga0265314_10003843
674 Ga0265314_10024022
675 Ga0265342_10005010
676 Ga0307516_10017586
677 Ga0307510_10489544
678 Ga0373926_0056613
679 Ga0373926_0069882
680 Ga0373934_0034957
681 Ga0373934_0041561
682 Ga0373944_0025136
683 Ga0373923_0007010
684 Ga0373923_0040743
685 Ga0373923_0047762
686 Ga0373936_0011143
687 Ga0373936_0041633
688 Ga0373936_0064503
689 Ga0373945_0018233
690 Ga0373945_0359864
691 Ga0373953_0016636
692 Ga0373953_0031117
693 Ga0373954_0002963
694 Ga0373954_0203999
695 Ga0373956_0035957
696 Ga0373956_0160179
697 Ga0373957_0005082
698 Ga0373957_0040053
699 Ga0373957_0160023
700 Ga0373943_0023261
701 Ga0373943_0203166
702 Ga0373946_0014171
703 Ga0373955_0001157
704 Ga0373955_0033744
705 Ga0373955_0044412
706 Ga0373955_0467581
707 Ga0373924_0005774
708 Ga0373931_0133208
709 Ga0373935_0000091
710 Ga0373935_0021612
711 Ga0373935_0103311
712 Ga0373927_0032215
713 Ga0373927_0034187
714 Ga0373927_0055414
715 Ga0373927_0095839
716 Ga0373933_0002696
717 Ga0373933_0044185
718 Ga0373947_0001563
719 Ga0373947_0004298
720 Ga0373947_0031012
721 Ga0373947_0671797
722 Ga0373937_0002525
723 Ga0373937_0033736
724 Ga0373937_0152419
725 Ga0373937_0266036
726 Ga0373937_0463923
727 Ga0373937_0497270
728 Ga0373937_0726449
729 Ga0373925_0000038
730 Ga0373925_0029322
731 Ga0373925_0036436
732 Ga0373925_0057363
733 Ga0373925_0169380
734 Ga0373925_0220718
735 Ga0395899_0015971
736 Ga0395899_0091329
737 Ga0395900_0001383
738 Ga0395900_0053028
739 Ga0395900_0200981
740 Ga0395898_0066203
741 Ga0395898_0350637
742 Ga0436364_0775609
743 Ga0395901_0029620
744 Ga0395901_0067252
745 Ga0395901_0088930
746 Ga0395901_0107651
747 Ga0395901_0142509
748 Ga0436360_0079994
749 Ga0436360_0206681
750 Ga0436360_0240220
751 Ga0436360_0377280
752 Ga0436360_1002242
753 Ga0436361_0266818
754 Ga0436361_0730675
755 Ga0436363_1017620
756 Ga0436362_0869184
757 Ga0436362_1125054
758 Ga0439448_0080701
759 Ga0466969_0091954
760 Ga0466961_0347735
761 Ga0466961_0353195
762 Ga0466963_0019020
763 Ga0466964_0136981
764 Ga0466970_0329924
765 Ga0466957_0044792
766 Ga0466957_1337466
767 Ga0466960_0528457
768 Ga0466959_0020313
769 Ga0466958_0227924
770 Ga0466967_0123174
771 Ga0495592_0000155
772 Ga0495592_0051328
773 Ga0495592_0113231
774 Ga0495603_0003570
775 Ga0495603_0031448
776 Ga0495603_0161895
777 Ga0495629_0000835
778 Ga0495629_0024363
779 Ga0495629_0099900
780 Ga0495629_0142710
781 Ga0495638_0003352
782 Ga0495641_0016730
783 Ga0495641_0173443
784 Ga0495651_0000750
785 Ga0495651_0030436
786 Ga0495651_0030803
787 Ga0495651_0203320
788 Ga0495653_0000075
789 Ga0495653_0070945
790 Ga0495580_0016825
791 Ga0495580_0048245
792 Ga0495582_0013579
793 Ga0495582_0066788
794 Ga0495582_0118549
795 Ga0495582_0184402
796 Ga0495639_0002753
797 Ga0495639_0006018
798 Ga0495639_0182571
799 Ga0495662_0015473
800 Ga0495662_0019880
801 Ga0495664_0000009
802 Ga0495664_0019073
803 Ga0495664_0030743
804 Ga0495664_0182470
805 Ga0495594_0011774
806 Ga0495594_0132128
807 Ga0495608_0000022
808 Ga0495608_0012812
809 Ga0495618_0000016
810 Ga0495618_0018589
811 Ga0495618_0073174
812 Ga0495618_0281103
813 Ga0495628_0000012
814 Ga0495628_0063697
815 Ga0495630_0000648
816 Ga0495630_0251894
817 Ga0495652_0000021
818 Ga0495652_0059200
819 Ga0495652_0087364
820 Ga0495665_0047637
821 Ga0495665_0051098
822 Ga0495665_0143647
823 Ga0495640_0000031
824 Ga0495640_0018387
825 Ga0495640_0031409
826 Ga0495640_0058616
827 Ga0495640_0081545
828 Ga0495587_0000052
829 Ga0495587_0060784
830 Ga0495645_0000361
831 Ga0495645_0019536
832 Ga0495645_0055682
833 Ga0495645_0065887
834 Ga0495622_0033746
835 Ga0495667_0000011
836 Ga0495667_0019193
837 Ga0495667_0254127
838 Ga0495634_0000080
839 Ga0495634_0001398
840 Ga0495634_0025764
841 Ga0495634_0027129
842 Ga0495634_0051140
843 Ga0495625_0142060
844 Ga0495635_0000018
845 Ga0495635_0009070
846 Ga0495635_0064878
847 Ga0495635_0154806
848 Ga0495635_0223713
849 Ga0495588_0160077
850 Ga0495588_0223085
851 Ga0495657_0004321
852 Ga0495599_0000288
853 Ga0495599_0021185
854 Ga0495599_0067176
855 Ga0495599_0686440
856 Ga0495623_0000127
857 Ga0495623_0066227
858 Ga0495623_0076317
859 Ga0495623_0077995
860 Ga0495646_0000038
861 Ga0495646_0010382
862 Ga0495646_0099196
863 Ga0495647_0007809
864 Ga0495647_0010326
865 Ga0495647_0152875
866 Ga0495658_0034620
867 Ga0495658_0043470
868 Ga0495658_0086551
869 Ga0495658_0234585
870 Ga0495613_0021540
871 Ga0495613_0286511
872 Ga0495624_0086486
873 Ga0495600_0000197
874 Ga0495600_0024192
875 Ga0495600_0082824
876 Ga0495600_0222276
877 Ga0495600_0593203
878 Ga0495581_0010753
879 Ga0495581_0141515
880 Ga0495604_0000011
881 Ga0495604_0066661
882 Ga0495674_0000015
883 Ga0495674_0014752
884 Ga0495674_0084752
885 Ga0495674_0095242
886 Ga0495674_0131838
887 Ga0495672_0138596
888 Ga0495676_0093910
889 Ga0495680_0004021
890 Ga0495680_0023620
891 Ga0495680_0366804
892 Ga0495675_0000142
893 Ga0495675_0079687
894 Ga0495675_0308061
895 Ga0495684_0000012
896 Ga0495684_0025911
897 Ga0495684_0201381
898 Ga0495593_0003874
899 Ga0495593_0005678
900 Ga0495593_0006908
901 Ga0495593_0119510
902 Ga0495602_0000018
903 Ga0495602_0082230
904 Ga0496100_0218064
905 Ga0496100_1075617
906 Ga0496101_0508171
907 Ga0496102_0037588
908 Ga0496102_0058256
909 Ga0496103_0042822
910 Ga0496104_0050443
911 Ga0496105_0032788
912 Ga0496105_0125069
913 Ga0496106_0067580
914 Ga0496107_0364768
915 Ga0496107_0385468
916 Ga0496108_0153335
917 Ga0496109_0063961
918 Ga0496109_0263124
919 Ga0496110_0135540
920 Ga0496110_0169330
921 Ga0496111_0027300
922 Ga0496112_0000419
923 Ga0496112_0028482
924 Ga0496113_0047499
925 Ga0496113_0281529
926 Ga0496114_0144635
927 Ga0496115_0046993
928 Ga0496115_0095858
929 Ga0496115_0210603
930 Ga0496121_0011656
931 Ga0496121_0013259
932 Ga0496126_0018279
933 Ga0496126_0046871
934 Ga0496126_0061521
935 Ga0496126_0289652
936 Ga0496126_0587556
937 Ga0501034_0300628
938 Ga0501072_0785508
939 nmdc:mga0sz30_47766_c1
940 Ga0495601_0000015
941 Ga0495601_0013534
942 Ga0495601_0102955
943 Ga0495601_0112966
944 Ga0495612_0000016
945 Ga0495612_0013300
946 Ga0495612_0024014
947 Ga0495595_0000037
948 Ga0495595_0001034
949 Ga0495595_0033250
950 Ga0495619_0000066
951 Ga0495619_0007058
952 Ga0495619_0032998
953 Ga0495619_0079292
954 Ga0495619_0386235
955 Ga0500578_0471698
956 Ga0500641_0017535
957 Ga0500595_057487
958 Ga0500603_019892
959 Ga0500639_065923
960 Ga0500639_246129
961 Ga0500637_0057754
962 Ga0500552_009059
963 2513889868
964 2885416050
965 2885418707
966 2935690948
967 2935718329
968 2935727691
969 2935736394
970 2935745774
971 2935756155
972 2940561870

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04290

DctQ

Tripartite ATP-independent periplasmic transporters, DctQ component

44

178

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7vrc-assembly1.cif.gz_A structure of the yeast snf11/snf2 complex 0.8282 70 139
5j0j-assembly1.cif.gz_C de novo design of protein homo-oligomers with modular hydrogen bond network-mediated specificity 0.7993 74 140
6msr-assembly1.cif.gz_B crystal structure of pro-2.5 0.797 71 140
5j0h-assembly2.cif.gz_B de novo design of protein homo-oligomers with modular hydrogen bond network-mediated specificity 0.7941 73 138
5j0j-assembly1.cif.gz_B de novo design of protein homo-oligomers with modular hydrogen bond network-mediated specificity 0.7893 74 140
ID Description Score Start End Superfamily
af_D3ZWV8_556_669_6.10.140.680 Special;Helix non-globular;Helix Hairpins; 0.837 62 139 6.10.140.680
af_A0A286Y9S9_612_725_6.10.140.680 Special;Helix non-globular;Helix Hairpins; 0.8345 62 139 6.10.140.680
af_Q9NB13_8_220_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.8249 71 140 1.20.140.150
2f1mA03 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Helix hairpin bin 0.8154 70 142 1.10.287.470
4khnB04 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;B family DNA polymerase, finger domain 0.804 71 142 1.10.287.690
ID Description Score Start End GO Terms
AF-A0A061NDC3-F1-model_v4 TRAP-type C4-dicarboxylate transport system, small permease component 0.9841 66 140 GO:0005886
AF-A0A349QDJ2-F1-model_v4 deleted 0.8335 41 149
AF-A0A0R2RB89-F1-model_v4 TRAP transporter small permease protein 0.8166 48 140 GO:0005886
GO:0022857
AF-A0A7K4DYJ8-F1-model_v4 deleted 0.8048 65 158
AF-A0A7K4DYJ8-F1-model_v4 deleted 0.7821 65 158

Map