F453251

General Info

Members Datasets Scaffolds Average Seq Length
486 193 972 151

Family's Representative Sequence

Representative Sequence 3300009148|Ga0105243_10299997|Ga0105243_102999972
Length 169
Sequence MGAYSAASRRGRQKQEATMTSELDQKVIDFVQQVLGAMGLTLEVGLEETPDNLRLNITGDGAEVLLKRKGEALDALQVIVNTAFRRDARGDRHYVVDAMGFRLDKDRELRQMAQLLMEKAKTTGGLQEIGPLNPYARRIVHLTVAEDPELSSESVGDAFLKTVIISRKS

Samples

Sample ID Description Type Environment
1 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
44 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
45 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
46 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
47 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
52 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
53 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
70 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
73 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
99 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
102 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
103 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
104 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
105 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
106 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
107 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
108 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
109 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
110 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
111 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
112 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
113 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
114 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
115 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
116 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
117 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
118 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
119 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
120 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
121 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
122 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
123 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
124 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
125 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
126 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
127 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
128 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
129 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
130 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
131 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
132 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
133 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
134 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
135 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
136 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
137 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
138 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
139 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
140 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
141 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
142 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
143 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
144 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
145 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
146 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
147 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
163 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
164 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
165 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
166 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
167 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
168 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
169 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
170 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
171 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
172 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
173 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
174 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
175 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
176 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
177 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
180 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
181 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
182 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
183 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
184 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
185 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
186 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
187 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
188 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
189 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
190 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
191 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
192 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
193 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.65
Nodule 0
Rhizoplane 1.65
Rhizosphere 96.71
Stem 0
Stem Tuber 0
Unclassified 14.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105243_10299997 3300009148 Bacteria 1456
2 JGI24751J29686_10023654 3300002459 Bacteria 1274
3 Ga0065712_10200768 3300005290 Bacteria 1092
4 Ga0065715_10045103 3300005293 Unclassified 973
5 Ga0065715_10191778 3300005293 Bacteria 1411
6 Ga0065715_10232878 3300005293 Bacteria 1227
7 Ga0065707_10059552 3300005295 Bacteria 698
8 Ga0070683_100029329 3300005329 Bacteria 4980
9 Ga0070690_100007847 3300005330 Bacteria 6122
10 Ga0070670_100151317 3300005331 Bacteria 2008
11 Ga0070670_100188924 3300005331 Bacteria 1789
12 Ga0068869_100013876 3300005334 Bacteria 5372
13 Ga0068869_100153671 3300005334 Bacteria 1786
14 Ga0068869_100356008 3300005334 Bacteria 1194
15 Ga0070689_100028299 3300005340 Bacteria 4236
16 Ga0070687_100316474 3300005343 Bacteria 995
17 Ga0070692_10576708 3300005345 Bacteria 741
18 Ga0070675_100043321 3300005354 Bacteria 3678
19 Ga0070675_100237448 3300005354 Bacteria 1592
20 Ga0070675_100494329 3300005354 Unclassified 1102
21 Ga0070675_100811990 3300005354 Bacteria 855
22 Ga0070674_101405887 3300005356 Bacteria 625
23 Ga0070688_100026038 3300005365 Bacteria 3471
24 Ga0070688_100029041 3300005365 Bacteria 3308
25 Ga0070688_100632562 3300005365 Bacteria 822
26 Ga0070688_100825011 3300005365 Bacteria 727
27 Ga0070659_100019418 3300005366 Bacteria 5151
28 Ga0070713_100230555 3300005436 Bacteria 1683
29 Ga0070701_10130752 3300005438 Bacteria 1426
30 Ga0070701_10240397 3300005438 Bacteria 1089
31 Ga0070705_101140543 3300005440 Bacteria 640
32 Ga0070694_100054804 3300005444 Bacteria 2702
33 Ga0070694_101338601 3300005444 Unclassified 603
34 Ga0070678_100834100 3300005456 Bacteria 839
35 Ga0068867_100424274 3300005459 Bacteria 1127
36 Ga0068867_100565225 3300005459 Bacteria 987
37 Ga0070685_10158599 3300005466 Bacteria 1440
38 Ga0070685_10330446 3300005466 Bacteria 1036
39 Ga0070707_101272857 3300005468 Unclassified 702
40 Ga0070698_100600629 3300005471 Bacteria 1041
41 Ga0070698_100989011 3300005471 Unclassified 788
42 Ga0070699_100817170 3300005518 Unclassified 853
43 Ga0070679_100170405 3300005530 Unclassified 2150
44 Ga0068853_102026401 3300005539 Bacteria 558
45 Ga0070672_100802466 3300005543 Bacteria 828
46 Ga0070686_100057170 3300005544 Bacteria 2505
47 Ga0070686_100094979 3300005544 Bacteria 2002
48 Ga0070686_100608252 3300005544 Bacteria 862
49 Ga0070695_101002260 3300005545 Bacteria 679
50 Ga0070693_100024016 3300005547 Bacteria 3265
51 Ga0070704_100349966 3300005549 Bacteria 1247
52 Ga0070704_100375657 3300005549 Bacteria 1206
53 Ga0068855_100730945 3300005563 Unclassified 1057
54 Ga0068855_101053783 3300005563 Bacteria 852
55 Ga0068852_100115931 3300005616 Bacteria 2443
56 Ga0068852_101032983 3300005616 Unclassified 841
57 Ga0068859_100010833 3300005617 Bacteria 9174
58 Ga0068859_100143434 3300005617 Bacteria 2462
59 Ga0068859_100321253 3300005617 Unclassified 1642
60 Ga0068859_100355741 3300005617 Bacteria 1559
61 Ga0068859_100388704 3300005617 Bacteria 1491
62 Ga0068859_100848201 3300005617 Bacteria 1000
63 Ga0068859_102439486 3300005617 Bacteria 576
64 Ga0068859_102513142 3300005617 Unclassified 567
65 Ga0068866_10274653 3300005718 Unclassified 1041
66 Ga0068861_100568388 3300005719 Bacteria 1036
67 Ga0068863_100344739 3300005841 Bacteria 1450
68 Ga0068863_100894838 3300005841 Bacteria 888
69 Ga0068858_100058464 3300005842 Bacteria 3565
70 Ga0068860_100060942 3300005843 Bacteria 3585
71 Ga0068862_100237453 3300005844 Bacteria 1656
72 Ga0068862_100559516 3300005844 Bacteria 1093
73 Ga0068862_101448007 3300005844 Unclassified 691
74 Ga0070717_10575510 3300006028 Archaea 1021
75 Ga0075365_10033690 3300006038 Bacteria 3303
76 Ga0075368_10036314 3300006042 Bacteria 1925
77 Ga0075364_10038488 3300006051 Bacteria 3098
78 Ga0075364_10298900 3300006051 Bacteria 1096
79 Ga0075366_10005615 3300006195 Bacteria 6801
80 Ga0097621_100651578 3300006237 Unclassified 966
81 Ga0068871_100237570 3300006358 Bacteria 1583
82 Ga0068871_100329674 3300006358 Bacteria 1346
83 Ga0068871_101587624 3300006358 Bacteria 619
84 Ga0075428_100010961 3300006844 Bacteria 10081
85 Ga0075428_100390546 3300006844 Bacteria 1492
86 Ga0075428_100971636 3300006844 Bacteria 899
87 Ga0075430_100110971 3300006846 Bacteria 2287
88 Ga0075431_100377718 3300006847 Bacteria 1422
89 Ga0075433_10065217 3300006852 Bacteria 3194
90 Ga0075433_10111888 3300006852 Bacteria 2422
91 Ga0075433_10181456 3300006852 Bacteria 1873
92 Ga0075433_10504927 3300006852 Bacteria 1064
93 Ga0075434_100143491 3300006871 Bacteria 2408
94 Ga0075434_100423111 3300006871 Unclassified 1353
95 Ga0075429_100231154 3300006880 Bacteria 1620
96 Ga0097620_100010833 3300006931 Bacteria 9174
97 Ga0097620_100143426 3300006931 Bacteria 2462
98 Ga0097620_100321225 3300006931 Unclassified 1642
99 Ga0097620_100355763 3300006931 Bacteria 1559
100 Ga0097620_100388711 3300006931 Bacteria 1491
101 Ga0097620_100848326 3300006931 Bacteria 1000
102 Ga0097620_102438685 3300006931 Bacteria 576
103 Ga0097620_102513392 3300006931 Unclassified 567
104 Ga0075435_100668376 3300007076 Bacteria 902
105 Ga0111539_10000191 3300009094 Bacteria 71382
106 Ga0111539_10006208 3300009094 Bacteria 15423
107 Ga0111539_10042004 3300009094 Bacteria 5494
108 Ga0111539_10111418 3300009094 Bacteria 3211
109 Ga0111539_10122565 3300009094 Bacteria 3047
110 Ga0111539_10165028 3300009094 Bacteria 2590
111 Ga0111539_10208567 3300009094 Bacteria 2277
112 Ga0111539_11287182 3300009094 Bacteria 849
113 Ga0111539_11543619 3300009094 Bacteria 770
114 Ga0105245_12445308 3300009098 Unclassified 576
115 Ga0114129_10009969 3300009147 Bacteria 13542
116 Ga0105242_10072951 3300009176 Bacteria 2852
117 Ga0105248_10067482 3300009177 Bacteria 4016
118 Ga0105248_10069922 3300009177 Bacteria 3942
119 Ga0105248_10189255 3300009177 Bacteria 2319
120 Ga0105248_11771801 3300009177 Unclassified 700
121 Ga0105249_10036628 3300009553 Bacteria 4451
122 Ga0105249_10074983 3300009553 Unclassified 3132
123 Ga0105249_10115534 3300009553 Bacteria 2543
124 Ga0105249_10261647 3300009553 Unclassified 1719
125 Ga0157324_1010146 3300012506 Unclassified 792
126 Ga0157378_10107723 3300013297 Bacteria 2550
127 Ga0157378_10295946 3300013297 Bacteria 1565
128 Ga0157378_11340455 3300013297 Bacteria 757
129 Ga0163162_10027524 3300013306 Bacteria 5622
130 Ga0163162_10116171 3300013306 Bacteria 2776
131 Ga0157375_11609146 3300013308 Bacteria 768
132 Ga0163163_10000001 3300014325 Bacteria 622185
133 Ga0157380_10005587 3300014326 Bacteria 8784
134 Ga0157380_10062819 3300014326 Bacteria 2976
135 Ga0157380_10169990 3300014326 Bacteria 1904
136 Ga0157380_10303311 3300014326 Unclassified 1472
137 Ga0157380_10494850 3300014326 Bacteria 1186
138 Ga0157380_10879375 3300014326 Unclassified 920
139 Ga0157377_10369929 3300014745 Bacteria 967
140 Ga0157379_11384808 3300014968 Bacteria 681
141 Ga0163161_10739034 3300017792 Unclassified 822
142 Ga0207645_10435846 3300025907 Bacteria 884
143 Ga0207707_11074743 3300025912 Bacteria 657
144 Ga0207662_10063458 3300025918 Bacteria 2221
145 Ga0207652_10118016 3300025921 Unclassified 2358
146 Ga0207681_10056382 3300025923 Bacteria 2680
147 Ga0207681_10252785 3300025923 Bacteria 1377
148 Ga0207681_11044051 3300025923 Unclassified 686
149 Ga0207681_11421738 3300025923 Unclassified 582
150 Ga0207650_10150238 3300025925 Bacteria 1838
151 Ga0207650_10299077 3300025925 Bacteria 1314
152 Ga0207650_10330633 3300025925 Bacteria 1250
153 Ga0207659_10182743 3300025926 Bacteria 1663
154 Ga0207659_10237929 3300025926 Bacteria 1471
155 Ga0207659_10390367 3300025926 Unclassified 1162
156 Ga0207700_10115425 3300025928 Bacteria 2168
157 Ga0207690_10106075 3300025932 Bacteria 2016
158 Ga0207670_10107683 3300025936 Bacteria 2002
159 Ga0207670_10128075 3300025936 Bacteria 1855
160 Ga0207704_10116122 3300025938 Bacteria 1821
161 Ga0207704_11044411 3300025938 Bacteria 693
162 Ga0207711_10043877 3300025941 Bacteria 3816
163 Ga0207711_10056147 3300025941 Bacteria 3383
164 Ga0207711_10713606 3300025941 Bacteria 935
165 Ga0207689_10142115 3300025942 Bacteria 1977
166 Ga0207689_10227318 3300025942 Bacteria 1542
167 Ga0207667_11240345 3300025949 Bacteria 724
168 Ga0207651_10641015 3300025960 Bacteria 932
169 Ga0207712_10232937 3300025961 Unclassified 1479
170 Ga0207712_10717366 3300025961 Unclassified 874
171 Ga0207712_11062287 3300025961 Bacteria 720
172 Ga0207668_10481106 3300025972 Bacteria 1065
173 Ga0207640_10780979 3300025981 Unclassified 826
174 Ga0207658_10070175 3300025986 Bacteria 2650
175 Ga0207658_12044184 3300025986 Bacteria 521
176 Ga0207703_10087746 3300026035 Bacteria 2609
177 Ga0207703_10523385 3300026035 Bacteria 1116
178 Ga0207703_10836140 3300026035 Bacteria 880
179 Ga0207639_11677870 3300026041 Bacteria 596
180 Ga0207708_10412586 3300026075 Unclassified 1119
181 Ga0207648_10474376 3300026089 Unclassified 1142
182 Ga0207648_10511618 3300026089 Bacteria 1099
183 Ga0207648_10542974 3300026089 Bacteria 1067
184 Ga0207676_11300054 3300026095 Bacteria 722
185 Ga0207675_100410115 3300026118 Bacteria 1337
186 Ga0207675_100749592 3300026118 Unclassified 988
187 Ga0207428_10011753 3300027907 Bacteria 7721
188 Ga0207428_10035099 3300027907 Bacteria 4102
189 Ga0207428_10060559 3300027907 Bacteria 2999
190 Ga0207428_10204643 3300027907 Bacteria 1485
191 Ga0207428_10241016 3300027907 Bacteria 1351
192 Ga0268265_10242078 3300028380 Unclassified 1593
193 Ga0268265_10720077 3300028380 Bacteria 966
194 Ga0268265_10739799 3300028380 Bacteria 954
195 Ga0268265_11035637 3300028380 Bacteria 812
196 Ga0268264_10058367 3300028381 Bacteria 3231
197 Ga0268264_11030272 3300028381 Unclassified 830
198 Ga0307408_100299949 3300031548 Bacteria 1345
199 Ga0307408_100878658 3300031548 Unclassified 819
200 Ga0307405_10069405 3300031731 Bacteria 2259
201 Ga0307413_10517614 3300031824 Unclassified 961
202 Ga0307410_10691964 3300031852 Bacteria 859
203 Ga0307406_10156646 3300031901 Bacteria 1632
204 Ga0307407_10040372 3300031903 Unclassified 2602
205 Ga0307412_10024796 3300031911 Bacteria 3706
206 Ga0307416_102046028 3300032002 Unclassified 675
207 Ga0307416_102221035 3300032002 Bacteria 650
208 Ga0307416_102430299 3300032002 Unclassified 623
209 Ga0307414_10133575 3300032004 Bacteria 1931
210 Ga0307414_10176240 3300032004 Bacteria 1715
211 Ga0307411_10007214 3300032005 Bacteria 5637
212 Ga0307415_100083293 3300032126 Bacteria 2291
213 Ga0307415_100112786 3300032126 Bacteria 2021
214 Ga0373928_0267175 3300035084 Unclassified 514
215 Ga0373923_0392633 3300035111 Unclassified 667
216 Ga0373936_0370952 3300035113 Bacteria 654
217 Ga0373941_0405316 3300035115 Unclassified 565
218 Ga0373956_0001364 3300035119 Bacteria 10071
219 Ga0373957_0016238 3300035120 Bacteria 2575
220 Ga0373957_0083217 3300035120 Unclassified 1265
221 Ga0373943_0012554 3300035170 Bacteria 3818
222 Ga0373955_0491648 3300035172 Unclassified 749
223 Ga0373955_0676906 3300035172 Unclassified 633
224 Ga0373931_0364919 3300035691 Bacteria 907
225 Ga0373935_0188378 3300035692 Bacteria 1420
226 Ga0373933_0023911 3300035724 Bacteria 3495
227 Ga0373933_0043402 3300035724 Bacteria 2660
228 Ga0373937_0000088 3300036401 Bacteria 84659
229 Ga0373937_0004375 3300036401 Bacteria 11996
230 Ga0373937_0307519 3300036401 Bacteria 1499
231 Ga0373937_0450744 3300036401 Bacteria 1222
232 Ga0373937_2031877 3300036401 Unclassified 521
233 Ga0373925_0006572 3300037068 Bacteria 8543
234 Ga0373925_0302726 3300037068 Bacteria 1291
235 Ga0373925_1184747 3300037068 Bacteria 628
236 Ga0373925_1652282 3300037068 Archaea 523
237 Ga0439439_0024674 3300041406 Bacteria 1510
238 Ga0439433_0015286 3300041999 Bacteria 1694
239 Ga0439451_051006 3300042009 Bacteria 829
240 Ga0439462_0105465 3300042015 Bacteria 779
241 Ga0439446_0019433 3300042156 Bacteria 1909
242 Ga0439446_0124581 3300042156 Unclassified 832
243 Ga0451576_0835148 3300045051 Unclassified 967
244 Ga0495592_0048117 3300046454 Bacteria 3173
245 Ga0495651_0486471 3300046462 Bacteria 792
246 Ga0495628_0186230 3300046516 Bacteria 1569
247 Ga0495635_0606670 3300046663 Bacteria 714
248 Ga0495599_0211921 3300046678 Bacteria 1187
249 Ga0495599_0335135 3300046678 Bacteria 909
250 Ga0495599_0395085 3300046678 Bacteria 824
251 Ga0495658_1062068 3300046683 Bacteria 516
252 Ga0495600_0163524 3300046809 Bacteria 1438
253 Ga0495672_0233387 3300047320 Bacteria 902
254 Ga0495680_0585828 3300047322 Bacteria 748
255 Ga0495684_0354201 3300047471 Bacteria 1041
256 Ga0496102_0963142 3300048905 Bacteria 774
257 Ga0496104_0065796 3300048907 Bacteria 3441
258 Ga0496104_0535001 3300048907 Bacteria 1083
259 Ga0496106_0848411 3300048909 Bacteria 723
260 Ga0496107_0521607 3300048910 Bacteria 881
261 Ga0496110_0290766 3300048913 Bacteria 1488
262 Ga0496113_0970705 3300048916 Unclassified 670
263 Ga0496113_1461863 3300048916 Unclassified 528
264 Ga0501031_0001595 3300049568 Bacteria 14155
265 Ga0501031_0014594 3300049568 Bacteria 5108
266 Ga0501031_0018303 3300049568 Bacteria 4559
267 Ga0501031_0065676 3300049568 Bacteria 2364
268 Ga0501031_0103488 3300049568 Bacteria 1858
269 Ga0501032_0005777 3300049569 Bacteria 9154
270 Ga0501032_0064515 3300049569 Bacteria 2451
271 Ga0501032_0097215 3300049569 Bacteria 1951
272 Ga0501032_0227637 3300049569 Bacteria 1212
273 Ga0501033_0003843 3300049570 Bacteria 12206
274 Ga0501033_0005859 3300049570 Bacteria 9660
275 Ga0501033_0007623 3300049570 Bacteria 8416
276 Ga0501033_0038558 3300049570 Bacteria 3571
277 Ga0501033_0514254 3300049570 Bacteria 827
278 Ga0501034_0001559 3300049571 Bacteria 29974
279 Ga0501034_0024575 3300049571 Bacteria 6128
280 Ga0501034_0032569 3300049571 Bacteria 5292
281 Ga0501034_0114644 3300049571 Bacteria 2683
282 Ga0501034_0143473 3300049571 Bacteria 2366
283 Ga0501034_0189486 3300049571 Bacteria 2019
284 Ga0501034_0223730 3300049571 Bacteria 1833
285 Ga0501034_0269359 3300049571 Bacteria 1644
286 Ga0501034_0443518 3300049571 Bacteria 1216
287 Ga0501036_0005167 3300049572 Bacteria 10554
288 Ga0501036_0010720 3300049572 Bacteria 7576
289 Ga0501036_0019307 3300049572 Bacteria 5720
290 Ga0501036_0038946 3300049572 Bacteria 4025
291 Ga0501036_0085971 3300049572 Bacteria 2658
292 Ga0501036_0622792 3300049572 Bacteria 894
293 Ga0501036_1376429 3300049572 Bacteria 572
294 Ga0501037_0003377 3300049573 Bacteria 11600
295 Ga0501037_0006784 3300049573 Bacteria 8369
296 Ga0501037_0010127 3300049573 Bacteria 6918
297 Ga0501037_0062125 3300049573 Bacteria 2723
298 Ga0501037_0129939 3300049573 Bacteria 1806
299 Ga0501037_0265747 3300049573 Bacteria 1198
300 Ga0501038_0010345 3300049574 Bacteria 8534
301 Ga0501038_0018746 3300049574 Bacteria 6247
302 Ga0501038_0022710 3300049574 Bacteria 5616
303 Ga0501038_0032965 3300049574 Bacteria 4563
304 Ga0501038_0072793 3300049574 Bacteria 2911
305 Ga0501038_0088919 3300049574 Bacteria 2592
306 Ga0501039_0018098 3300049575 Bacteria 5407
307 Ga0501039_0029818 3300049575 Bacteria 4203
308 Ga0501039_0048601 3300049575 Bacteria 3279
309 Ga0501039_0049961 3300049575 Bacteria 3234
310 Ga0501039_0108234 3300049575 Bacteria 2172
311 Ga0501039_0152656 3300049575 Bacteria 1814
312 Ga0501039_0308323 3300049575 Bacteria 1244
313 Ga0501039_1284408 3300049575 Bacteria 565
314 Ga0501040_0025562 3300049576 Bacteria 3971
315 Ga0501040_0171819 3300049576 Unclassified 1535
316 Ga0501040_0187576 3300049576 Bacteria 1467
317 Ga0501041_0142680 3300049577 Bacteria 1494
318 Ga0501041_0208933 3300049577 Bacteria 1224
319 Ga0501041_0614403 3300049577 Unclassified 694
320 Ga0501042_0021913 3300049578 Bacteria 4459
321 Ga0501042_0060839 3300049578 Bacteria 2698
322 Ga0501042_0070775 3300049578 Bacteria 2495
323 Ga0501042_0355601 3300049578 Bacteria 1060
324 Ga0501043_0004072 3300049579 Bacteria 11947
325 Ga0501043_0006600 3300049579 Bacteria 9294
326 Ga0501043_0007242 3300049579 Bacteria 8810
327 Ga0501043_0007637 3300049579 Bacteria 8567
328 Ga0501043_0008980 3300049579 Bacteria 7866
329 Ga0501043_0035059 3300049579 Bacteria 3946
330 Ga0501043_0037500 3300049579 Bacteria 3812
331 Ga0501046_0006757 3300049580 Bacteria 10129
332 Ga0501046_0022716 3300049580 Bacteria 5166
333 Ga0501046_0022785 3300049580 Bacteria 5157
334 Ga0501046_0049234 3300049580 Bacteria 3333
335 Ga0501046_0214819 3300049580 Bacteria 1426
336 Ga0501046_0237672 3300049580 Bacteria 1344
337 Ga0501046_0692247 3300049580 Bacteria 718
338 Ga0501046_1010345 3300049580 Bacteria 577
339 Ga0501047_0000134 3300049581 Bacteria 89882
340 Ga0501047_0006406 3300049581 Bacteria 11071
341 Ga0501047_0011956 3300049581 Bacteria 8214
342 Ga0501047_0052442 3300049581 Bacteria 3942
343 Ga0501047_0182358 3300049581 Bacteria 1965
344 Ga0501047_0394841 3300049581 Bacteria 1216
345 Ga0501048_0009397 3300049582 Bacteria 7341
346 Ga0501048_0018384 3300049582 Bacteria 5141
347 Ga0501048_0020909 3300049582 Bacteria 4794
348 Ga0501048_0022310 3300049582 Bacteria 4631
349 Ga0501048_0100024 3300049582 Bacteria 2045
350 Ga0501067_0001636 3300049583 Bacteria 12303
351 Ga0501067_0009521 3300049583 Bacteria 5382
352 Ga0501067_0014700 3300049583 Bacteria 4330
353 Ga0501067_0023581 3300049583 Bacteria 3410
354 Ga0501067_0191042 3300049583 Bacteria 1140
355 Ga0501067_0263889 3300049583 Bacteria 959
356 Ga0501068_0025231 3300049584 Bacteria 3496
357 Ga0501068_0025273 3300049584 Bacteria 3493
358 Ga0501068_0031896 3300049584 Bacteria 3130
359 Ga0501068_0107254 3300049584 Unclassified 1734
360 Ga0501068_0130956 3300049584 Bacteria 1568
361 Ga0501068_0400399 3300049584 Bacteria 885
362 Ga0501069_0008162 3300049585 Bacteria 5499
363 Ga0501069_0010910 3300049585 Bacteria 4815
364 Ga0501069_0016339 3300049585 Bacteria 3985
365 Ga0501070_0021584 3300049586 Bacteria 5400
366 Ga0501070_0029102 3300049586 Bacteria 4632
367 Ga0501070_0032881 3300049586 Bacteria 4339
368 Ga0501070_0146065 3300049586 Bacteria 1952
369 Ga0501070_0281049 3300049586 Bacteria 1358
370 Ga0501070_1192453 3300049586 Bacteria 584
371 Ga0501071_0005668 3300049587 Bacteria 8053
372 Ga0501071_0028600 3300049587 Bacteria 3930
373 Ga0501071_0060402 3300049587 Bacteria 2744
374 Ga0501071_0266484 3300049587 Bacteria 1294
375 Ga0501071_0725879 3300049587 Bacteria 765
376 Ga0501071_0950633 3300049587 Unclassified 663
377 Ga0501072_0094107 3300049588 Bacteria 2380
378 Ga0501072_0139143 3300049588 Bacteria 1935
379 Ga0501072_0323984 3300049588 Bacteria 1224
380 Ga0501072_0693804 3300049588 Bacteria 800
381 Ga0501073_0011954 3300049589 Bacteria 6336
382 Ga0501073_0017928 3300049589 Bacteria 5121
383 Ga0501073_0031242 3300049589 Bacteria 3800
384 Ga0501073_0040623 3300049589 Bacteria 3290
385 Ga0501073_0053086 3300049589 Bacteria 2837
386 Ga0501073_0113987 3300049589 Bacteria 1874
387 Ga0501073_0116406 3300049589 Unclassified 1852
388 Ga0501073_0242839 3300049589 Bacteria 1243
389 Ga0501073_0349735 3300049589 Unclassified 1020
390 Ga0501074_0004993 3300049590 Bacteria 9517
391 Ga0501074_0010049 3300049590 Bacteria 6870
392 Ga0501074_0137160 3300049590 Bacteria 1750
393 Ga0501074_0360506 3300049590 Bacteria 1031
394 Ga0501074_1335805 3300049590 Bacteria 502
395 Ga0501075_0006225 3300049591 Bacteria 8205
396 Ga0501075_0674688 3300049591 Unclassified 788
397 Ga0501075_0773172 3300049591 Bacteria 731
398 Ga0501076_0031179 3300049592 Bacteria 4156
399 Ga0501076_0043837 3300049592 Bacteria 3527
400 Ga0501076_0066476 3300049592 Bacteria 2878
401 Ga0501076_0475603 3300049592 Bacteria 1029
402 Ga0501076_0592692 3300049592 Bacteria 914
403 Ga0501077_0062752 3300049593 Bacteria 2357
404 Ga0501077_0111882 3300049593 Bacteria 1731
405 Ga0501079_0003014 3300049741 Bacteria 12316
406 Ga0501079_0026981 3300049741 Bacteria 4403
407 Ga0501079_0032263 3300049741 Bacteria 4026
408 Ga0501079_0181793 3300049741 Bacteria 1641
409 Ga0501079_0301362 3300049741 Bacteria 1254
410 Ga0501080_0001806 3300049742 Bacteria 18344
411 Ga0501080_0009069 3300049742 Bacteria 9052
412 Ga0501080_0035619 3300049742 Bacteria 4645
413 Ga0501080_0077847 3300049742 Bacteria 3084
414 Ga0501080_0095729 3300049742 Bacteria 2757
415 Ga0501080_0131571 3300049742 Bacteria 2316
416 Ga0501080_0197497 3300049742 Bacteria 1847
417 Ga0501080_0207873 3300049742 Bacteria 1795
418 Ga0501080_0258302 3300049742 Bacteria 1587
419 Ga0501080_0760356 3300049742 Bacteria 852
420 Ga0501081_0214628 3300049743 Unclassified 1398
421 Ga0501083_0004794 3300049744 Bacteria 9555
422 Ga0501083_0005389 3300049744 Bacteria 9054
423 Ga0501083_0007308 3300049744 Bacteria 7829
424 Ga0501083_0014445 3300049744 Bacteria 5521
425 Ga0501083_0014625 3300049744 Bacteria 5486
426 Ga0501083_0221834 3300049744 Bacteria 1231
427 Ga0501035_0007284 3300049822 Bacteria 10350
428 Ga0501035_0009947 3300049822 Bacteria 8831
429 Ga0501035_0044058 3300049822 Bacteria 4019
430 Ga0501035_0064589 3300049822 Bacteria 3252
431 Ga0501035_0075670 3300049822 Bacteria 2977
432 Ga0501035_0570219 3300049822 Bacteria 925
433 Ga0501044_0007177 3300049823 Bacteria 12254
434 Ga0501044_0029330 3300049823 Bacteria 5801
435 Ga0501044_0031048 3300049823 Bacteria 5625
436 Ga0501044_0034846 3300049823 Bacteria 5275
437 Ga0501044_0121372 3300049823 Bacteria 2614
438 Ga0501045_0025137 3300049824 Bacteria 4278
439 Ga0501045_0053684 3300049824 Bacteria 2945
440 Ga0501045_0067675 3300049824 Unclassified 2623
441 Ga0501045_0118964 3300049824 Bacteria 1961
442 Ga0501045_0750154 3300049824 Bacteria 719
443 nmdc:mga0k408_7836_c1 3300050493 Bacteria 5711
444 nmdc:mga06z11_16445_c1 3300050494 Bacteria 3333
445 nmdc:mga06z11_474907_c1 3300050494 Bacteria 757
446 nmdc:mga05p37_21_c1 3300050507 Bacteria 122678
447 nmdc:mga09592_222169_c1 3300050508 Bacteria 1636
448 nmdc:mga0qj67_387468_c1 3300050509 Bacteria 1128
449 nmdc:mga06r32_462446_c1 3300050510 Unclassified 1248
450 nmdc:mga08y16_122785_c1 3300050511 Bacteria 2702
451 nmdc:mga08y16_12940_c1 3300050511 Bacteria 8777
452 nmdc:mga08y16_3492_c1 3300050511 Bacteria 16323
453 nmdc:mga08y16_440676_c1 3300050511 Unclassified 1330
454 nmdc:mga08y16_49536_c2 3300050511 Bacteria 2124
455 nmdc:mga08y16_614_c1 3300050511 Bacteria 33280
456 nmdc:mga0n895_141053_c1 3300050512 Bacteria 2438
457 nmdc:mga0n895_495775_c1 3300050512 Unclassified 1231
458 nmdc:mga0a205_19920_c2 3300050515 Bacteria 2825
459 nmdc:mga0a205_219961_c1 3300050515 Bacteria 1785
460 nmdc:mga0a205_94572_c2 3300050515 Unclassified 1422
461 Ga0495601_0065542 3300053077 Bacteria 2312
462 Ga0495601_0265799 3300053077 Bacteria 1119
463 Ga0495619_0269737 3300053085 Bacteria 1179
464 Ga0495619_0400564 3300053085 Unclassified 948
465 Ga0501084_0004869 3300054114 Bacteria 10962
466 Ga0501084_0013013 3300054114 Bacteria 6885
467 Ga0501084_0028901 3300054114 Bacteria 4635
468 Ga0501084_0171849 3300054114 Bacteria 1829
469 Ga0501084_0353162 3300054114 Bacteria 1242
470 Ga0501084_0433608 3300054114 Bacteria 1111
471 Ga0501084_1509577 3300054114 Bacteria 562
472 Ga0501084_1645959 3300054114 Unclassified 536
473 Ga0501082_0003854 3300060353 Bacteria 13109
474 Ga0501082_0004838 3300060353 Bacteria 11743
475 Ga0501082_0012056 3300060353 Bacteria 7428
476 Ga0501082_0014989 3300060353 Bacteria 6679
477 Ga0501082_0028617 3300060353 Bacteria 4799
478 Ga0501082_0076114 3300060353 Bacteria 2892
479 Ga0501082_0161456 3300060353 Bacteria 1947
480 Ga0501082_0503669 3300060353 Bacteria 1058
481 Ga0501082_0529225 3300060353 Bacteria 1031
482 Ga0501082_0616405 3300060353 Bacteria 950
483 Ga0501082_0717955 3300060353 Bacteria 875
484 Ga0501082_1940248 3300060353 Bacteria 513
485 Ga0501082_1986589 3300060353 Unclassified 507
486 Ga0530510_0439799 3300061734 Bacteria 985
487 Ga0105243_10299997
488 JGI24751J29686_10023654
489 Ga0065712_10200768
490 Ga0065715_10045103
491 Ga0065715_10191778
492 Ga0065715_10232878
493 Ga0065707_10059552
494 Ga0070683_100029329
495 Ga0070690_100007847
496 Ga0070670_100151317
497 Ga0070670_100188924
498 Ga0068869_100013876
499 Ga0068869_100153671
500 Ga0068869_100356008
501 Ga0070689_100028299
502 Ga0070687_100316474
503 Ga0070692_10576708
504 Ga0070675_100043321
505 Ga0070675_100237448
506 Ga0070675_100494329
507 Ga0070675_100811990
508 Ga0070674_101405887
509 Ga0070688_100026038
510 Ga0070688_100029041
511 Ga0070688_100632562
512 Ga0070688_100825011
513 Ga0070659_100019418
514 Ga0070713_100230555
515 Ga0070701_10130752
516 Ga0070701_10240397
517 Ga0070705_101140543
518 Ga0070694_100054804
519 Ga0070694_101338601
520 Ga0070678_100834100
521 Ga0068867_100424274
522 Ga0068867_100565225
523 Ga0070685_10158599
524 Ga0070685_10330446
525 Ga0070707_101272857
526 Ga0070698_100600629
527 Ga0070698_100989011
528 Ga0070699_100817170
529 Ga0070679_100170405
530 Ga0068853_102026401
531 Ga0070672_100802466
532 Ga0070686_100057170
533 Ga0070686_100094979
534 Ga0070686_100608252
535 Ga0070695_101002260
536 Ga0070693_100024016
537 Ga0070704_100349966
538 Ga0070704_100375657
539 Ga0068855_100730945
540 Ga0068855_101053783
541 Ga0068852_100115931
542 Ga0068852_101032983
543 Ga0068859_100010833
544 Ga0068859_100143434
545 Ga0068859_100321253
546 Ga0068859_100355741
547 Ga0068859_100388704
548 Ga0068859_100848201
549 Ga0068859_102439486
550 Ga0068859_102513142
551 Ga0068866_10274653
552 Ga0068861_100568388
553 Ga0068863_100344739
554 Ga0068863_100894838
555 Ga0068858_100058464
556 Ga0068860_100060942
557 Ga0068862_100237453
558 Ga0068862_100559516
559 Ga0068862_101448007
560 Ga0070717_10575510
561 Ga0075365_10033690
562 Ga0075368_10036314
563 Ga0075364_10038488
564 Ga0075364_10298900
565 Ga0075366_10005615
566 Ga0097621_100651578
567 Ga0068871_100237570
568 Ga0068871_100329674
569 Ga0068871_101587624
570 Ga0075428_100010961
571 Ga0075428_100390546
572 Ga0075428_100971636
573 Ga0075430_100110971
574 Ga0075431_100377718
575 Ga0075433_10065217
576 Ga0075433_10111888
577 Ga0075433_10181456
578 Ga0075433_10504927
579 Ga0075434_100143491
580 Ga0075434_100423111
581 Ga0075429_100231154
582 Ga0097620_100010833
583 Ga0097620_100143426
584 Ga0097620_100321225
585 Ga0097620_100355763
586 Ga0097620_100388711
587 Ga0097620_100848326
588 Ga0097620_102438685
589 Ga0097620_102513392
590 Ga0075435_100668376
591 Ga0111539_10000191
592 Ga0111539_10006208
593 Ga0111539_10042004
594 Ga0111539_10111418
595 Ga0111539_10122565
596 Ga0111539_10165028
597 Ga0111539_10208567
598 Ga0111539_11287182
599 Ga0111539_11543619
600 Ga0105245_12445308
601 Ga0114129_10009969
602 Ga0105242_10072951
603 Ga0105248_10067482
604 Ga0105248_10069922
605 Ga0105248_10189255
606 Ga0105248_11771801
607 Ga0105249_10036628
608 Ga0105249_10074983
609 Ga0105249_10115534
610 Ga0105249_10261647
611 Ga0157324_1010146
612 Ga0157378_10107723
613 Ga0157378_10295946
614 Ga0157378_11340455
615 Ga0163162_10027524
616 Ga0163162_10116171
617 Ga0157375_11609146
618 Ga0163163_10000001
619 Ga0157380_10005587
620 Ga0157380_10062819
621 Ga0157380_10169990
622 Ga0157380_10303311
623 Ga0157380_10494850
624 Ga0157380_10879375
625 Ga0157377_10369929
626 Ga0157379_11384808
627 Ga0163161_10739034
628 Ga0207645_10435846
629 Ga0207707_11074743
630 Ga0207662_10063458
631 Ga0207652_10118016
632 Ga0207681_10056382
633 Ga0207681_10252785
634 Ga0207681_11044051
635 Ga0207681_11421738
636 Ga0207650_10150238
637 Ga0207650_10299077
638 Ga0207650_10330633
639 Ga0207659_10182743
640 Ga0207659_10237929
641 Ga0207659_10390367
642 Ga0207700_10115425
643 Ga0207690_10106075
644 Ga0207670_10107683
645 Ga0207670_10128075
646 Ga0207704_10116122
647 Ga0207704_11044411
648 Ga0207711_10043877
649 Ga0207711_10056147
650 Ga0207711_10713606
651 Ga0207689_10142115
652 Ga0207689_10227318
653 Ga0207667_11240345
654 Ga0207651_10641015
655 Ga0207712_10232937
656 Ga0207712_10717366
657 Ga0207712_11062287
658 Ga0207668_10481106
659 Ga0207640_10780979
660 Ga0207658_10070175
661 Ga0207658_12044184
662 Ga0207703_10087746
663 Ga0207703_10523385
664 Ga0207703_10836140
665 Ga0207639_11677870
666 Ga0207708_10412586
667 Ga0207648_10474376
668 Ga0207648_10511618
669 Ga0207648_10542974
670 Ga0207676_11300054
671 Ga0207675_100410115
672 Ga0207675_100749592
673 Ga0207428_10011753
674 Ga0207428_10035099
675 Ga0207428_10060559
676 Ga0207428_10204643
677 Ga0207428_10241016
678 Ga0268265_10242078
679 Ga0268265_10720077
680 Ga0268265_10739799
681 Ga0268265_11035637
682 Ga0268264_10058367
683 Ga0268264_11030272
684 Ga0307408_100299949
685 Ga0307408_100878658
686 Ga0307405_10069405
687 Ga0307413_10517614
688 Ga0307410_10691964
689 Ga0307406_10156646
690 Ga0307407_10040372
691 Ga0307412_10024796
692 Ga0307416_102046028
693 Ga0307416_102221035
694 Ga0307416_102430299
695 Ga0307414_10133575
696 Ga0307414_10176240
697 Ga0307411_10007214
698 Ga0307415_100083293
699 Ga0307415_100112786
700 Ga0373928_0267175
701 Ga0373923_0392633
702 Ga0373936_0370952
703 Ga0373941_0405316
704 Ga0373956_0001364
705 Ga0373957_0016238
706 Ga0373957_0083217
707 Ga0373943_0012554
708 Ga0373955_0491648
709 Ga0373955_0676906
710 Ga0373931_0364919
711 Ga0373935_0188378
712 Ga0373933_0023911
713 Ga0373933_0043402
714 Ga0373937_0000088
715 Ga0373937_0004375
716 Ga0373937_0307519
717 Ga0373937_0450744
718 Ga0373937_2031877
719 Ga0373925_0006572
720 Ga0373925_0302726
721 Ga0373925_1184747
722 Ga0373925_1652282
723 Ga0439439_0024674
724 Ga0439433_0015286
725 Ga0439451_051006
726 Ga0439462_0105465
727 Ga0439446_0019433
728 Ga0439446_0124581
729 Ga0451576_0835148
730 Ga0495592_0048117
731 Ga0495651_0486471
732 Ga0495628_0186230
733 Ga0495635_0606670
734 Ga0495599_0211921
735 Ga0495599_0335135
736 Ga0495599_0395085
737 Ga0495658_1062068
738 Ga0495600_0163524
739 Ga0495672_0233387
740 Ga0495680_0585828
741 Ga0495684_0354201
742 Ga0496102_0963142
743 Ga0496104_0065796
744 Ga0496104_0535001
745 Ga0496106_0848411
746 Ga0496107_0521607
747 Ga0496110_0290766
748 Ga0496113_0970705
749 Ga0496113_1461863
750 Ga0501031_0001595
751 Ga0501031_0014594
752 Ga0501031_0018303
753 Ga0501031_0065676
754 Ga0501031_0103488
755 Ga0501032_0005777
756 Ga0501032_0064515
757 Ga0501032_0097215
758 Ga0501032_0227637
759 Ga0501033_0003843
760 Ga0501033_0005859
761 Ga0501033_0007623
762 Ga0501033_0038558
763 Ga0501033_0514254
764 Ga0501034_0001559
765 Ga0501034_0024575
766 Ga0501034_0032569
767 Ga0501034_0114644
768 Ga0501034_0143473
769 Ga0501034_0189486
770 Ga0501034_0223730
771 Ga0501034_0269359
772 Ga0501034_0443518
773 Ga0501036_0005167
774 Ga0501036_0010720
775 Ga0501036_0019307
776 Ga0501036_0038946
777 Ga0501036_0085971
778 Ga0501036_0622792
779 Ga0501036_1376429
780 Ga0501037_0003377
781 Ga0501037_0006784
782 Ga0501037_0010127
783 Ga0501037_0062125
784 Ga0501037_0129939
785 Ga0501037_0265747
786 Ga0501038_0010345
787 Ga0501038_0018746
788 Ga0501038_0022710
789 Ga0501038_0032965
790 Ga0501038_0072793
791 Ga0501038_0088919
792 Ga0501039_0018098
793 Ga0501039_0029818
794 Ga0501039_0048601
795 Ga0501039_0049961
796 Ga0501039_0108234
797 Ga0501039_0152656
798 Ga0501039_0308323
799 Ga0501039_1284408
800 Ga0501040_0025562
801 Ga0501040_0171819
802 Ga0501040_0187576
803 Ga0501041_0142680
804 Ga0501041_0208933
805 Ga0501041_0614403
806 Ga0501042_0021913
807 Ga0501042_0060839
808 Ga0501042_0070775
809 Ga0501042_0355601
810 Ga0501043_0004072
811 Ga0501043_0006600
812 Ga0501043_0007242
813 Ga0501043_0007637
814 Ga0501043_0008980
815 Ga0501043_0035059
816 Ga0501043_0037500
817 Ga0501046_0006757
818 Ga0501046_0022716
819 Ga0501046_0022785
820 Ga0501046_0049234
821 Ga0501046_0214819
822 Ga0501046_0237672
823 Ga0501046_0692247
824 Ga0501046_1010345
825 Ga0501047_0000134
826 Ga0501047_0006406
827 Ga0501047_0011956
828 Ga0501047_0052442
829 Ga0501047_0182358
830 Ga0501047_0394841
831 Ga0501048_0009397
832 Ga0501048_0018384
833 Ga0501048_0020909
834 Ga0501048_0022310
835 Ga0501048_0100024
836 Ga0501067_0001636
837 Ga0501067_0009521
838 Ga0501067_0014700
839 Ga0501067_0023581
840 Ga0501067_0191042
841 Ga0501067_0263889
842 Ga0501068_0025231
843 Ga0501068_0025273
844 Ga0501068_0031896
845 Ga0501068_0107254
846 Ga0501068_0130956
847 Ga0501068_0400399
848 Ga0501069_0008162
849 Ga0501069_0010910
850 Ga0501069_0016339
851 Ga0501070_0021584
852 Ga0501070_0029102
853 Ga0501070_0032881
854 Ga0501070_0146065
855 Ga0501070_0281049
856 Ga0501070_1192453
857 Ga0501071_0005668
858 Ga0501071_0028600
859 Ga0501071_0060402
860 Ga0501071_0266484
861 Ga0501071_0725879
862 Ga0501071_0950633
863 Ga0501072_0094107
864 Ga0501072_0139143
865 Ga0501072_0323984
866 Ga0501072_0693804
867 Ga0501073_0011954
868 Ga0501073_0017928
869 Ga0501073_0031242
870 Ga0501073_0040623
871 Ga0501073_0053086
872 Ga0501073_0113987
873 Ga0501073_0116406
874 Ga0501073_0242839
875 Ga0501073_0349735
876 Ga0501074_0004993
877 Ga0501074_0010049
878 Ga0501074_0137160
879 Ga0501074_0360506
880 Ga0501074_1335805
881 Ga0501075_0006225
882 Ga0501075_0674688
883 Ga0501075_0773172
884 Ga0501076_0031179
885 Ga0501076_0043837
886 Ga0501076_0066476
887 Ga0501076_0475603
888 Ga0501076_0592692
889 Ga0501077_0062752
890 Ga0501077_0111882
891 Ga0501079_0003014
892 Ga0501079_0026981
893 Ga0501079_0032263
894 Ga0501079_0181793
895 Ga0501079_0301362
896 Ga0501080_0001806
897 Ga0501080_0009069
898 Ga0501080_0035619
899 Ga0501080_0077847
900 Ga0501080_0095729
901 Ga0501080_0131571
902 Ga0501080_0197497
903 Ga0501080_0207873
904 Ga0501080_0258302
905 Ga0501080_0760356
906 Ga0501081_0214628
907 Ga0501083_0004794
908 Ga0501083_0005389
909 Ga0501083_0007308
910 Ga0501083_0014445
911 Ga0501083_0014625
912 Ga0501083_0221834
913 Ga0501035_0007284
914 Ga0501035_0009947
915 Ga0501035_0044058
916 Ga0501035_0064589
917 Ga0501035_0075670
918 Ga0501035_0570219
919 Ga0501044_0007177
920 Ga0501044_0029330
921 Ga0501044_0031048
922 Ga0501044_0034846
923 Ga0501044_0121372
924 Ga0501045_0025137
925 Ga0501045_0053684
926 Ga0501045_0067675
927 Ga0501045_0118964
928 Ga0501045_0750154
929 nmdc:mga0k408_7836_c1
930 nmdc:mga06z11_16445_c1
931 nmdc:mga06z11_474907_c1
932 nmdc:mga05p37_21_c1
933 nmdc:mga09592_222169_c1
934 nmdc:mga0qj67_387468_c1
935 nmdc:mga06r32_462446_c1
936 nmdc:mga08y16_122785_c1
937 nmdc:mga08y16_12940_c1
938 nmdc:mga08y16_3492_c1
939 nmdc:mga08y16_440676_c1
940 nmdc:mga08y16_49536_c2
941 nmdc:mga08y16_614_c1
942 nmdc:mga0n895_141053_c1
943 nmdc:mga0n895_495775_c1
944 nmdc:mga0a205_19920_c2
945 nmdc:mga0a205_219961_c1
946 nmdc:mga0a205_94572_c2
947 Ga0495601_0065542
948 Ga0495601_0265799
949 Ga0495619_0269737
950 Ga0495619_0400564
951 Ga0501084_0004869
952 Ga0501084_0013013
953 Ga0501084_0028901
954 Ga0501084_0171849
955 Ga0501084_0353162
956 Ga0501084_0433608
957 Ga0501084_1509577
958 Ga0501084_1645959
959 Ga0501082_0003854
960 Ga0501082_0004838
961 Ga0501082_0012056
962 Ga0501082_0014989
963 Ga0501082_0028617
964 Ga0501082_0076114
965 Ga0501082_0161456
966 Ga0501082_0503669
967 Ga0501082_0529225
968 Ga0501082_0616405
969 Ga0501082_0717955
970 Ga0501082_1940248
971 Ga0501082_1986589
972 Ga0530510_0439799

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01424

R3H

R3H domain

107

167

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3gku-assembly2.cif.gz_C-2 crystal structure of a probable rna-binding protein from clostridium symbiosum atcc 14940 0.867 1 82
2pt7-assembly1.cif.gz_H crystal structure of cag virb11 (hp0525) and an inhibitory protein (hp1451) 0.7986 4 144
2lrr-assembly1.cif.gz_A solution structure of the r3h domain from human smubp-2 in complex with 2'-deoxyguanosine-5'-monophosphate 0.782 87 147
2pt7-assembly1.cif.gz_H crystal structure of cag virb11 (hp0525) and an inhibitory protein (hp1451) 0.7746 4 144
2cpm-assembly1.cif.gz_A solution structure of the r3h domain of human sperm-associated antigen 7 0.7432 85 147
ID Description Score Start End Superfamily
3gkuB03 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S8; Chain: A, domain 1;R3H-like domain 0.9079 81 147 3.30.1370.50
af_O53598_123_187_3.30.1370.50 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S8; Chain: A, domain 1;R3H-like domain 0.9027 86 147 3.30.1370.50
3gkuB03 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S8; Chain: A, domain 1;R3H-like domain 0.8833 81 147 3.30.1370.50
af_Q2FZ84_14_90_3.30.1370.160 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S8; Chain: A, domain 1; 0.8827 85 147 3.30.1370.160
af_A0A1D6NC26_56_123_3.30.1370.160 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S8; Chain: A, domain 1; 0.8548 85 145 3.30.1370.160
ID Description Score Start End GO Terms
AF-A0A2V7ZNT6-F1-model_v4 Uncharacterized protein 0.9471 3 77
AF-A0A2E4FMB5-F1-model_v4 R3H domain-containing protein 0.9284 8 146 GO:0003723
AF-A0A800EZM2-F1-model_v4 R3H domain-containing protein 0.9135 3 147 GO:0003723
AF-A0A353GGL6-F1-model_v4 R3H domain-containing protein 0.9068 3 147 GO:0003723
AF-A0A3D5R4R1-F1-model_v4 RNA-binding protein KhpB N-terminal domain-containing protein 0.903 1 83 GO:0003723

Map