F453214

General Info

Members Datasets Scaffolds Average Seq Length
486 270 972 131

Family's Representative Sequence

Representative Sequence 3300005434|Ga0070709_10036383|Ga0070709_100363835
Length 127
Sequence MPKVEKSEEQWRQELTREQFNVLRQKGTEAPFTGEYDHVFEPGTYRCAGCGADLFESDAKYDYAPADADAVAEETDASHGMVRTEVLCASCGGHLGHVFPDGPHPTGVRYCINSAALKLVSDTDSGV

Samples

Sample ID Description Type Environment
1 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
2 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
3 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
4 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
67 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
68 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
77 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
78 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
79 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
90 3300012481 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 Metagenome Rhizosphere
91 3300012491 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 Metagenome Rhizosphere
92 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
93 3300013059 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
94 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
95 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
96 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
97 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
98 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
103 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
104 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
105 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
106 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
107 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
108 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
112 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
113 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
114 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
116 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
117 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
175 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
176 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
177 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
178 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
179 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
180 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
181 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
182 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
183 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
184 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
185 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
186 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
187 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
188 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
189 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
190 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
191 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
192 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
193 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
194 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
195 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
196 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
197 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
198 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
199 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
200 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
201 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
202 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
203 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
204 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
205 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
206 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
207 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
208 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
209 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
210 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
211 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
212 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
213 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
214 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
215 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
216 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
217 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
218 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
219 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
220 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
221 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
222 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
223 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
224 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
225 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
226 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
227 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
228 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
229 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
230 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
231 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
232 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
233 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
234 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
235 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
236 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
237 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
238 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
239 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
240 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
241 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
242 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
243 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
244 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
245 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
246 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
247 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
248 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
249 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
250 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
252 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
253 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
254 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
255 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
256 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
257 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
258 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
259 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
261 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
262 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
263 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
264 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
265 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
266 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
267 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
268 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
269 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
270 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.47
Metatranscriptomes 4.53
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 15.23
Rhizosphere 83.95
Stem 0
Stem Tuber 0
Unclassified 1.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070709_10036383 3300005434 Bacteria 2999
2 JGI24747J21853_1014387 3300001978 Bacteria 823
3 JGI24744J21845_10003623 3300002077 Bacteria 3185
4 JGI24742J22300_10016073 3300002244 Bacteria 1261
5 Ga0070658_10008240 3300005327 Bacteria 8383
6 Ga0070658_10211879 3300005327 Bacteria 1637
7 Ga0070658_10364072 3300005327 Bacteria 1239
8 Ga0070676_10249899 3300005328 Bacteria 1183
9 Ga0070683_100139670 3300005329 Bacteria 2295
10 Ga0070683_100793732 3300005329 Bacteria 907
11 Ga0070683_101471987 3300005329 Bacteria 654
12 Ga0070690_100068257 3300005330 Bacteria 2306
13 Ga0070677_10489241 3300005333 Bacteria 665
14 Ga0068869_100314711 3300005334 Bacteria 1268
15 Ga0070666_10394797 3300005335 Bacteria 994
16 Ga0070680_100132307 3300005336 Bacteria 2088
17 Ga0070680_101026183 3300005336 Bacteria 712
18 Ga0070682_100023527 3300005337 Bacteria 3658
19 Ga0068868_100008821 3300005338 Bacteria 7223
20 Ga0068868_100754266 3300005338 Bacteria 875
21 Ga0070660_100002972 3300005339 Bacteria 11667
22 Ga0070689_100003475 3300005340 Bacteria 10490
23 Ga0070689_100370054 3300005340 Bacteria 1206
24 Ga0070691_10014901 3300005341 Bacteria 3570
25 Ga0070691_10051673 3300005341 Bacteria 1964
26 Ga0070687_100022310 3300005343 Bacteria 2991
27 Ga0070687_100068298 3300005343 Bacteria 1900
28 Ga0070692_10016374 3300005345 Bacteria 3525
29 Ga0070692_10352542 3300005345 Bacteria 915
30 Ga0070668_100036890 3300005347 Bacteria 3731
31 Ga0070668_100049990 3300005347 Bacteria 3218
32 Ga0070669_100025585 3300005353 Bacteria 4240
33 Ga0070671_100010906 3300005355 Bacteria 7298
34 Ga0070671_101524090 3300005355 Archaea 592
35 Ga0070674_100023258 3300005356 Bacteria 4008
36 Ga0070674_100027065 3300005356 Bacteria 3754
37 Ga0070688_100002353 3300005365 Bacteria 9533
38 Ga0070688_100741403 3300005365 Bacteria 764
39 Ga0070659_100087608 3300005366 Bacteria 2493
40 Ga0070659_100372422 3300005366 Bacteria 1202
41 Ga0070659_100992546 3300005366 Bacteria 737
42 Ga0070667_100163317 3300005367 Bacteria 1963
43 Ga0070714_101365135 3300005435 Bacteria 692
44 Ga0070714_101642295 3300005435 Bacteria 628
45 Ga0070710_10006577 3300005437 Bacteria 5588
46 Ga0070701_10019888 3300005438 Bacteria 3177
47 Ga0070711_100038756 3300005439 Bacteria 3206
48 Ga0070705_100059749 3300005440 Bacteria 2258
49 Ga0070705_100697510 3300005440 Bacteria 797
50 Ga0070700_100001877 3300005441 Bacteria 10607
51 Ga0070700_100199498 3300005441 Bacteria 1404
52 Ga0070694_100013450 3300005444 Bacteria 5111
53 Ga0070694_100020582 3300005444 Bacteria 4208
54 Ga0070708_100364513 3300005445 Bacteria 1362
55 Ga0070663_100016932 3300005455 Bacteria 4744
56 Ga0070678_100009004 3300005456 Bacteria 6014
57 Ga0070678_100120381 3300005456 Bacteria 2069
58 Ga0070662_100111477 3300005457 Bacteria 2085
59 Ga0070681_10038073 3300005458 Bacteria 4822
60 Ga0068867_100000375 3300005459 Bacteria 29759
61 Ga0068867_100081899 3300005459 Bacteria 2434
62 Ga0070685_10008017 3300005466 Bacteria 5415
63 Ga0070706_100142318 3300005467 Bacteria 2239
64 Ga0070707_100088450 3300005468 Bacteria 2996
65 Ga0070707_100248623 3300005468 Bacteria 1730
66 Ga0070699_100720547 3300005518 Bacteria 912
67 Ga0070679_100258778 3300005530 Bacteria 1696
68 Ga0070679_102157755 3300005530 Bacteria 507
69 Ga0070684_100070571 3300005535 Bacteria 3074
70 Ga0070684_100112479 3300005535 Bacteria 2443
71 Ga0070684_100230334 3300005535 Bacteria 1692
72 Ga0070684_100591149 3300005535 Bacteria 1032
73 Ga0070684_101458664 3300005535 Bacteria 645
74 Ga0070697_100918696 3300005536 Bacteria 777
75 Ga0068853_100017797 3300005539 Bacteria 5868
76 Ga0068853_100176257 3300005539 Bacteria 1937
77 Ga0070672_100196006 3300005543 Bacteria 1688
78 Ga0070672_100507656 3300005543 Bacteria 1043
79 Ga0070686_100000954 3300005544 Bacteria 16658
80 Ga0070686_100021490 3300005544 Bacteria 3837
81 Ga0070695_100023343 3300005545 Bacteria 3800
82 Ga0070695_100037555 3300005545 Bacteria 3053
83 Ga0070695_100709893 3300005545 Bacteria 799
84 Ga0070696_100058931 3300005546 Bacteria 2682
85 Ga0070696_100135773 3300005546 Bacteria 1793
86 Ga0070693_100131076 3300005547 Bacteria 1567
87 Ga0070665_100014747 3300005548 Bacteria 7843
88 Ga0070704_100037092 3300005549 Bacteria 3326
89 Ga0070704_100076548 3300005549 Bacteria 2447
90 Ga0068855_100029691 3300005563 Bacteria 6536
91 Ga0068855_100069762 3300005563 Bacteria 4090
92 Ga0068857_100585985 3300005577 Bacteria 1053
93 Ga0068854_100593282 3300005578 Bacteria 945
94 Ga0068856_100002618 3300005614 Bacteria 18503
95 Ga0068856_100012426 3300005614 Bacteria 8243
96 Ga0070702_100000651 3300005615 Bacteria 12927
97 Ga0068852_100030961 3300005616 Bacteria 4409
98 Ga0068852_100036101 3300005616 Bacteria 4132
99 Ga0068859_100208752 3300005617 Bacteria 2039
100 Ga0068861_100016380 3300005719 Bacteria 5244
101 Ga0068858_100238464 3300005842 Bacteria 1725
102 Ga0068858_100417590 3300005842 Bacteria 1290
103 Ga0068860_100132914 3300005843 Bacteria 2389
104 Ga0068860_100173116 3300005843 Bacteria 2086
105 Ga0068862_100096856 3300005844 Bacteria 2576
106 Ga0081455_10001979 3300005937 Bacteria 24466
107 Ga0081455_10023775 3300005937 Bacteria 5694
108 Ga0070716_100391894 3300006173 Bacteria 996
109 Ga0070712_100004831 3300006175 Bacteria 8331
110 Ga0097621_100395353 3300006237 Bacteria 1237
111 Ga0097621_100625579 3300006237 Bacteria 986
112 Ga0068871_100005190 3300006358 Bacteria 9102
113 Ga0075433_11053025 3300006852 Bacteria 708
114 Ga0075434_100426227 3300006871 Bacteria 1348
115 Ga0068865_100003429 3300006881 Bacteria 9487
116 Ga0075436_100274700 3300006914 Bacteria 1204
117 Ga0097620_100208747 3300006931 Bacteria 2039
118 Ga0097620_101482213 3300006931 Bacteria 749
119 Ga0075435_100064824 3300007076 Bacteria 2969
120 Ga0105250_10207995 3300009092 Bacteria 827
121 Ga0105240_10027311 3300009093 Bacteria 7474
122 Ga0105240_10210219 3300009093 Bacteria 2274
123 Ga0111539_10790803 3300009094 Unclassified 1104
124 Ga0105245_10008200 3300009098 Bacteria 9137
125 Ga0114129_10341441 3300009147 Bacteria 1986
126 Ga0105243_10021607 3300009148 Bacteria 4885
127 Ga0105241_11200689 3300009174 Bacteria 718
128 Ga0105242_10005756 3300009176 Bacteria 9554
129 Ga0105242_10103925 3300009176 Bacteria 2411
130 Ga0105242_12654481 3300009176 Bacteria 550
131 Ga0105248_10003741 3300009177 Bacteria 16882
132 Ga0105248_10134743 3300009177 Bacteria 2787
133 Ga0105248_10418938 3300009177 Bacteria 1508
134 Ga0105237_10330321 3300009545 Bacteria 1529
135 Ga0105249_10013783 3300009553 Bacteria 7142
136 Ga0105249_10025909 3300009553 Bacteria 5282
137 Ga0105239_10057791 3300010375 Bacteria 4255
138 Ga0105239_10059684 3300010375 Bacteria 4186
139 Ga0105239_11448887 3300010375 Bacteria 793
140 Ga0105239_13386393 3300010375 Bacteria 519
141 Ga0105246_10247683 3300011119 Bacteria 1412
142 Ga0157320_1012973 3300012481 Bacteria 676
143 Ga0157329_1045112 3300012491 Archaea 506
144 Ga0157326_1005561 3300012513 Bacteria 1336
145 Ga0154012_148485 3300013059 Bacteria 633
146 Ga0157371_10229372 3300013102 Bacteria 1334
147 Ga0157370_10015343 3300013104 Bacteria 7789
148 Ga0157370_10849025 3300013104 Bacteria 830
149 Ga0157369_10003190 3300013105 Bacteria 19560
150 Ga0157369_10004573 3300013105 Bacteria 16261
151 Ga0157369_10910742 3300013105 Bacteria 902
152 Ga0157369_11112400 3300013105 Bacteria 807
153 Ga0157374_10016950 3300013296 Bacteria 6413
154 Ga0157374_10167811 3300013296 Bacteria 2140
155 Ga0157378_10050739 3300013297 Bacteria 3692
156 Ga0163162_10004432 3300013306 Bacteria 13521
157 Ga0163162_10115661 3300013306 Bacteria 2782
158 Ga0157372_10448136 3300013307 Bacteria 1504
159 Ga0157375_10012129 3300013308 Bacteria 7635
160 Ga0157375_10086828 3300013308 Bacteria 3180
161 Ga0157375_10375371 3300013308 Bacteria 1588
162 Ga0157375_11083970 3300013308 Bacteria 937
163 Ga0163163_11369176 3300014325 Bacteria 769
164 Ga0157380_10020823 3300014326 Bacteria 4909
165 Ga0157380_10119361 3300014326 Bacteria 2231
166 Ga0157377_10025905 3300014745 Bacteria 3132
167 Ga0157379_10097344 3300014968 Bacteria 2641
168 Ga0157379_11731384 3300014968 Bacteria 613
169 Ga0157376_10010417 3300014969 Bacteria 6801
170 Ga0157376_10288759 3300014969 Bacteria 1548
171 Ga0157376_11976331 3300014969 Bacteria 621
172 Ga0163161_10248025 3300017792 Bacteria 1387
173 Ga0163161_10385563 3300017792 Bacteria 1121
174 Ga0197907_11463924 3300020069 Bacteria 1287
175 Ga0206356_10668287 3300020070 Bacteria 1198
176 Ga0206356_10868470 3300020070 Bacteria 1744
177 Ga0206349_1519780 3300020075 Bacteria 590
178 Ga0206355_1634637 3300020076 Bacteria 1649
179 Ga0206352_10044897 3300020078 Bacteria 604
180 Ga0206352_10401206 3300020078 Bacteria 809
181 Ga0206350_10240984 3300020080 Bacteria 868
182 Ga0206350_10986134 3300020080 Bacteria 905
183 Ga0206350_11309106 3300020080 Bacteria 1579
184 Ga0206350_11380068 3300020080 Bacteria 689
185 Ga0206354_10220427 3300020081 Bacteria 1312
186 Ga0206354_10819210 3300020081 Bacteria 894
187 Ga0206354_10820007 3300020081 Bacteria 1626
188 Ga0206354_11130422 3300020081 Bacteria 1217
189 Ga0206353_10617204 3300020082 Bacteria 1291
190 Ga0206353_10879637 3300020082 Bacteria 715
191 Ga0206353_11788081 3300020082 Bacteria 2337
192 Ga0224712_10023476 3300022467 Bacteria 2142
193 Ga0224712_10290255 3300022467 Bacteria 763
194 Ga0224712_10388837 3300022467 Bacteria 664
195 Ga0207653_10024678 3300025885 Bacteria 1919
196 Ga0207682_10381324 3300025893 Bacteria 666
197 Ga0207692_10009521 3300025898 Bacteria 4061
198 Ga0207692_11094089 3300025898 Bacteria 528
199 Ga0207642_10019462 3300025899 Bacteria 2629
200 Ga0207642_10293484 3300025899 Bacteria 940
201 Ga0207688_10035810 3300025901 Bacteria 2750
202 Ga0207680_10061738 3300025903 Bacteria 2287
203 Ga0207647_10217136 3300025904 Bacteria 1103
204 Ga0207699_10097701 3300025906 Bacteria 1856
205 Ga0207705_10251404 3300025909 Bacteria 1348
206 Ga0207705_10368235 3300025909 Bacteria 1109
207 Ga0207684_10072182 3300025910 Bacteria 2932
208 Ga0207707_10218395 3300025912 Bacteria 1659
209 Ga0207695_10049456 3300025913 Bacteria 4431
210 Ga0207671_10415139 3300025914 Bacteria 1071
211 Ga0207693_10001020 3300025915 Bacteria 25070
212 Ga0207663_10030980 3300025916 Bacteria 3161
213 Ga0207660_10165649 3300025917 Bacteria 1708
214 Ga0207660_10838892 3300025917 Bacteria 750
215 Ga0207662_10021004 3300025918 Bacteria 3727
216 Ga0207662_10042725 3300025918 Bacteria 2673
217 Ga0207657_10017045 3300025919 Bacteria 6987
218 Ga0207657_10031163 3300025919 Bacteria 4833
219 Ga0207657_10088595 3300025919 Bacteria 2586
220 Ga0207649_10363707 3300025920 Bacteria 1074
221 Ga0207649_10747981 3300025920 Bacteria 760
222 Ga0207652_10130499 3300025921 Bacteria 2241
223 Ga0207652_10182512 3300025921 Bacteria 1886
224 Ga0207652_10295943 3300025921 Bacteria 1461
225 Ga0207646_10329467 3300025922 Bacteria 1379
226 Ga0207681_10202393 3300025923 Bacteria 1525
227 Ga0207694_11462373 3300025924 Bacteria 577
228 Ga0207659_10253908 3300025926 Bacteria 1428
229 Ga0207687_10012343 3300025927 Bacteria 5587
230 Ga0207687_10138143 3300025927 Bacteria 1846
231 Ga0207700_10455385 3300025928 Bacteria 1128
232 Ga0207700_10926817 3300025928 Bacteria 780
233 Ga0207664_10149910 3300025929 Bacteria 1980
234 Ga0207664_10872146 3300025929 Bacteria 809
235 Ga0207664_11481734 3300025929 Bacteria 600
236 Ga0207644_10024387 3300025931 Bacteria 4152
237 Ga0207690_10370435 3300025932 Bacteria 1136
238 Ga0207690_10373800 3300025932 Bacteria 1131
239 Ga0207706_10043333 3300025933 Bacteria 3988
240 Ga0207706_11539175 3300025933 Bacteria 541
241 Ga0207686_10004083 3300025934 Bacteria 7837
242 Ga0207686_10322738 3300025934 Bacteria 1154
243 Ga0207686_10501242 3300025934 Bacteria 942
244 Ga0207709_10000824 3300025935 Bacteria 23927
245 Ga0207709_10339852 3300025935 Bacteria 1130
246 Ga0207670_10016399 3300025936 Bacteria 4452
247 Ga0207669_10014106 3300025937 Bacteria 3996
248 Ga0207669_10017508 3300025937 Bacteria 3679
249 Ga0207704_10003216 3300025938 Bacteria 7395
250 Ga0207704_10136941 3300025938 Bacteria 1706
251 Ga0207665_10251290 3300025939 Archaea 1306
252 Ga0207665_10473342 3300025939 Bacteria 964
253 Ga0207691_10123877 3300025940 Bacteria 2288
254 Ga0207711_10096462 3300025941 Bacteria 2610
255 Ga0207689_10225722 3300025942 Bacteria 1548
256 Ga0207661_10018928 3300025944 Bacteria 5124
257 Ga0207661_10283032 3300025944 Bacteria 1482
258 Ga0207661_10730685 3300025944 Bacteria 911
259 Ga0207661_10785531 3300025944 Bacteria 877
260 Ga0207667_10028507 3300025949 Bacteria 6065
261 Ga0207667_10400618 3300025949 Bacteria 1397
262 Ga0207667_11725556 3300025949 Bacteria 592
263 Ga0207712_10040417 3300025961 Bacteria 3201
264 Ga0207668_10027908 3300025972 Bacteria 3684
265 Ga0207668_10056467 3300025972 Bacteria 2735
266 Ga0207640_10023210 3300025981 Bacteria 3726
267 Ga0207640_10685591 3300025981 Bacteria 877
268 Ga0207658_10601574 3300025986 Bacteria 988
269 Ga0207658_10613954 3300025986 Bacteria 978
270 Ga0207677_10042871 3300026023 Bacteria 3004
271 Ga0207677_10495569 3300026023 Unclassified 1055
272 Ga0207677_12134314 3300026023 Bacteria 521
273 Ga0207703_10206904 3300026035 Bacteria 1747
274 Ga0207639_10028987 3300026041 Bacteria 4048
275 Ga0207708_10002034 3300026075 Bacteria 14912
276 Ga0207708_10009742 3300026075 Bacteria 7129
277 Ga0207708_11542287 3300026075 Bacteria 584
278 Ga0207702_10154072 3300026078 Bacteria 2093
279 Ga0207702_10429143 3300026078 Bacteria 1279
280 Ga0207648_10001753 3300026089 Bacteria 23761
281 Ga0207648_10104822 3300026089 Bacteria 2480
282 Ga0207676_10043245 3300026095 Bacteria 3468
283 Ga0207676_10423221 3300026095 Bacteria 1249
284 Ga0207675_100015594 3300026118 Bacteria 7087
285 Ga0207675_100048658 3300026118 Bacteria 3957
286 Ga0207675_100589403 3300026118 Bacteria 1114
287 Ga0207683_10000041 3300026121 Bacteria 94017
288 Ga0207683_10749892 3300026121 Bacteria 906
289 Ga0207698_10098909 3300026142 Bacteria 2411
290 Ga0207698_10120993 3300026142 Bacteria 2216
291 Ga0268266_10115578 3300028379 Bacteria 2382
292 Ga0268264_10107852 3300028381 Bacteria 2433
293 Ga0268264_10818046 3300028381 Bacteria 931
294 Ga0265334_10040072 3300028573 Bacteria 1836
295 Ga0265323_10066981 3300028653 Bacteria 1236
296 Ga0265338_10001764 3300028800 Bacteria 34197
297 Ga0265338_10109292 3300028800 Bacteria 2231
298 Ga0265338_10135230 3300028800 Bacteria 1939
299 Ga0265324_10008497 3300029957 Bacteria 4076
300 Ga0265327_10014469 3300031251 Bacteria 5158
301 Ga0265327_10113880 3300031251 Bacteria 1289
302 Ga0265313_10003866 3300031595 Bacteria 11819
303 Ga0307406_10780511 3300031901 Bacteria 805
304 Ga0307406_11650556 3300031901 Bacteria 567
305 Ga0307415_100201527 3300032126 Bacteria 1580
306 Ga0373944_0188259 3300035089 Unclassified 743
307 Ga0373937_0425201 3300036401 Bacteria 1261
308 Ga0373925_0282192 3300037068 Bacteria 1338
309 Ga0395899_0308084 3300037312 Bacteria 1070
310 Ga0395900_0016589 3300037418 Bacteria 7512
311 Ga0395900_0398351 3300037418 Bacteria 1341
312 Ga0395898_0280129 3300037466 Bacteria 1591
313 Ga0395898_0858320 3300037466 Bacteria 847
314 Ga0395898_0959560 3300037466 Bacteria 792
315 Ga0395905_1719372 3300037471 Bacteria 533
316 Ga0395901_0029886 3300038443 Bacteria 5612
317 Ga0395901_0137419 3300038443 Bacteria 2568
318 Ga0395901_0203818 3300038443 Archaea 2073
319 Ga0395901_0533558 3300038443 Bacteria 1191
320 Ga0395901_0613491 3300038443 Bacteria 1096
321 Ga0436363_0041857 3300039450 Bacteria 715
322 Ga0451807_0089392 3300041486 Bacteria 616
323 Ga0451839_1591190 3300041496 Bacteria 546
324 Ga0451849_1487720 3300041505 Bacteria 676
325 Ga0451853_1802146 3300041512 Bacteria 641
326 Ga0466966_0004108 3300044684 Bacteria 9612
327 Ga0466966_0008685 3300044684 Bacteria 6724
328 Ga0466966_0208577 3300044684 Bacteria 1181
329 Ga0466963_0046950 3300044694 Bacteria 2849
330 Ga0466963_0075188 3300044694 Bacteria 2279
331 Ga0466963_0261839 3300044694 Bacteria 1214
332 Ga0466963_0575491 3300044694 Bacteria 795
333 Ga0466963_1334283 3300044694 Bacteria 503
334 Ga0466964_0066150 3300044706 Bacteria 1516
335 Ga0466964_0084260 3300044706 Bacteria 1370
336 Ga0466968_0079430 3300044735 Bacteria 1439
337 Ga0466968_0309575 3300044735 Unclassified 761
338 Ga0466957_0057899 3300044842 Bacteria 2373
339 Ga0466957_0262957 3300044842 Bacteria 1150
340 Ga0466960_0420152 3300044901 Bacteria 773
341 Ga0466960_0952587 3300044901 Archaea 526
342 Ga0466959_0002761 3300045049 Bacteria 11304
343 Ga0466959_0035597 3300045049 Bacteria 3681
344 Ga0451576_0063534 3300045051 Bacteria 3848
345 Ga0451576_1246740 3300045051 Bacteria 776
346 Ga0466958_0018234 3300045836 Bacteria 4071
347 Ga0466958_0045007 3300045836 Bacteria 2662
348 Ga0466958_0161351 3300045836 Bacteria 1416
349 Ga0466967_0040584 3300045976 Bacteria 4008
350 Ga0466967_0075615 3300045976 Bacteria 3027
351 Ga0466967_0175075 3300045976 Bacteria 2021
352 Ga0466967_0218451 3300045976 Bacteria 1810
353 Ga0466967_0364164 3300045976 Bacteria 1401
354 Ga0466967_0458284 3300045976 Bacteria 1247
355 Ga0466967_0552096 3300045976 Bacteria 1134
356 Ga0495592_0013555 3300046454 Bacteria 6203
357 Ga0495592_0900020 3300046454 Bacteria 520
358 Ga0495603_0177630 3300046455 Bacteria 1232
359 Ga0495603_0824190 3300046455 Bacteria 529
360 Ga0495641_0080155 3300046461 Bacteria 1463
361 Ga0495580_0142766 3300046472 Bacteria 1660
362 Ga0495582_0016652 3300046473 Bacteria 4025
363 Ga0495605_0409606 3300046474 Bacteria 563
364 Ga0495639_0050983 3300046475 Unclassified 1881
365 Ga0495585_0574910 3300046492 Unclassified 531
366 Ga0495594_0031060 3300046499 Bacteria 2894
367 Ga0495596_0216559 3300046500 Bacteria 744
368 Ga0495583_0137823 3300046506 Bacteria 1018
369 Ga0495628_0161520 3300046516 Bacteria 1702
370 Ga0495642_0302059 3300046528 Bacteria 701
371 Ga0495652_0009431 3300046529 Bacteria 8866
372 Ga0495667_0322510 3300046559 Bacteria 977
373 Ga0495588_0183514 3300046674 Bacteria 1106
374 Ga0495588_0208016 3300046674 Unclassified 1033
375 Ga0495657_0136191 3300046675 Bacteria 1534
376 Ga0495599_0004834 3300046678 Bacteria 8015
377 Ga0495646_0063509 3300046680 Bacteria 2192
378 Ga0495647_0166134 3300046681 Unclassified 953
379 Ga0495658_0072435 3300046683 Bacteria 2004
380 Ga0495624_0164382 3300046690 Unclassified 1355
381 Ga0495670_0340377 3300046691 Bacteria 807
382 Ga0495600_0112755 3300046809 Bacteria 1770
383 Ga0495674_1012109 3300047319 Bacteria 636
384 Ga0495676_0056621 3300047321 Bacteria 3099
385 Ga0495676_0102761 3300047321 Bacteria 2111
386 Ga0495676_0714783 3300047321 Bacteria 648
387 Ga0495680_0476330 3300047322 Bacteria 851
388 Ga0495677_0191637 3300047445 Archaea 794
389 Ga0495602_0038433 3300048088 Bacteria 4425
390 Ga0496100_0006916 3300048903 Bacteria 6214
391 Ga0496100_0037205 3300048903 Bacteria 3075
392 Ga0496100_0156069 3300048903 Bacteria 1632
393 Ga0496100_0516598 3300048903 Bacteria 921
394 Ga0496101_0005413 3300048904 Bacteria 8132
395 Ga0496101_0025289 3300048904 Bacteria 4118
396 Ga0496101_0060141 3300048904 Bacteria 2756
397 Ga0496101_0601059 3300048904 Bacteria 870
398 Ga0496101_0713212 3300048904 Bacteria 792
399 Ga0496101_0917639 3300048904 Bacteria 689
400 Ga0496102_0036038 3300048905 Bacteria 4455
401 Ga0496102_0036506 3300048905 Bacteria 4428
402 Ga0496102_0630118 3300048905 Bacteria 995
403 Ga0496102_0678149 3300048905 Bacteria 954
404 Ga0496103_0002218 3300048906 Bacteria 12305
405 Ga0496103_0324006 3300048906 Bacteria 991
406 Ga0496104_0015130 3300048907 Bacteria 6984
407 Ga0496104_0145097 3300048907 Bacteria 2279
408 Ga0496104_0227901 3300048907 Bacteria 1775
409 Ga0496104_0527485 3300048907 Bacteria 1092
410 Ga0496104_0794931 3300048907 Bacteria 852
411 Ga0496105_0001088 3300048908 Bacteria 18847
412 Ga0496105_0018476 3300048908 Bacteria 5605
413 Ga0496105_0166260 3300048908 Bacteria 1810
414 Ga0496105_0248236 3300048908 Bacteria 1442
415 Ga0496106_0006371 3300048909 Bacteria 8736
416 Ga0496106_0198494 3300048909 Bacteria 1596
417 Ga0496106_0503982 3300048909 Bacteria 972
418 Ga0496106_1043801 3300048909 Bacteria 642
419 Ga0496107_0002183 3300048910 Bacteria 12567
420 Ga0496107_0140776 3300048910 Bacteria 1783
421 Ga0496107_0151952 3300048910 Bacteria 1713
422 Ga0496107_0761816 3300048910 Bacteria 710
423 Ga0496108_0005531 3300048911 Bacteria 10221
424 Ga0496108_0058584 3300048911 Bacteria 3238
425 Ga0496108_0084838 3300048911 Bacteria 2688
426 Ga0496108_0345446 3300048911 Bacteria 1298
427 Ga0496108_1168985 3300048911 Bacteria 652
428 Ga0496109_0016183 3300048912 Bacteria 6518
429 Ga0496109_0056547 3300048912 Bacteria 3580
430 Ga0496109_0656802 3300048912 Bacteria 985
431 Ga0496109_1774548 3300048912 Bacteria 550
432 Ga0496110_0061462 3300048913 Bacteria 3315
433 Ga0496110_0108611 3300048913 Bacteria 2491
434 Ga0496110_0171566 3300048913 Bacteria 1968
435 Ga0496110_0172432 3300048913 Bacteria 1963
436 Ga0496110_0564873 3300048913 Bacteria 1033
437 Ga0496110_1137558 3300048913 Bacteria 689
438 Ga0496111_0001024 3300048914 Bacteria 15342
439 Ga0496111_0082544 3300048914 Bacteria 2348
440 Ga0496111_0090239 3300048914 Bacteria 2245
441 Ga0496111_0198150 3300048914 Bacteria 1493
442 Ga0496111_0413612 3300048914 Bacteria 996
443 Ga0496112_0032765 3300048915 Bacteria 5045
444 Ga0496112_0063613 3300048915 Bacteria 3639
445 Ga0496112_0104747 3300048915 Bacteria 2799
446 Ga0496112_0108506 3300048915 Bacteria 2746
447 Ga0496112_0245137 3300048915 Bacteria 1744
448 Ga0496113_0011791 3300048916 Bacteria 5854
449 Ga0496113_0028181 3300048916 Bacteria 4037
450 Ga0496113_0241227 3300048916 Bacteria 1442
451 Ga0496113_0246400 3300048916 Bacteria 1426
452 Ga0496114_0015637 3300048917 Bacteria 6103
453 Ga0496114_0031633 3300048917 Bacteria 4353
454 Ga0496114_0033805 3300048917 Bacteria 4215
455 Ga0496114_0097455 3300048917 Bacteria 2505
456 Ga0496114_0218559 3300048917 Bacteria 1672
457 Ga0496114_0338872 3300048917 Bacteria 1329
458 Ga0496114_0739714 3300048917 Bacteria 860
459 Ga0496115_0006192 3300048918 Bacteria 8748
460 Ga0496115_0023358 3300048918 Bacteria 4798
461 Ga0496115_0363445 3300048918 Bacteria 1179
462 Ga0496115_0638225 3300048918 Bacteria 843
463 Ga0501034_0072691 3300049571 Bacteria 3448
464 Ga0501042_0245805 3300049578 Bacteria 1291
465 Ga0501067_0012383 3300049583 Bacteria 4731
466 Ga0501069_0029558 3300049585 Bacteria 3007
467 Ga0501070_0021375 3300049586 Bacteria 5429
468 Ga0501070_0287649 3300049586 Bacteria 1340
469 Ga0501073_0038345 3300049589 Bacteria 3399
470 Ga0501074_0038502 3300049590 Bacteria 3465
471 Ga0501074_0086927 3300049590 Bacteria 2240
472 Ga0501079_0340215 3300049741 Bacteria 1175
473 Ga0501080_0002936 3300049742 Bacteria 14977
474 Ga0501080_0877561 3300049742 Bacteria 783
475 Ga0501035_0694800 3300049822 Bacteria 821
476 Ga0501044_0508759 3300049823 Bacteria 1105
477 nmdc:mga05p37_305666_c1 3300050507 Bacteria 1887
478 nmdc:mga0qj67_941162_c1 3300050509 Bacteria 679
479 nmdc:mga06r32_953893_c1 3300050510 Bacteria 812
480 nmdc:mga0n895_594974_c1 3300050512 Bacteria 1109
481 nmdc:mga0rr50_249662_c1 3300050513 Bacteria 1473
482 nmdc:mga08x19_166658_c1 3300050514 Bacteria 1498
483 Ga0495601_0012414 3300053077 Bacteria 5111
484 Ga0495595_0051902 3300053084 Bacteria 1901
485 Ga0466962_0688824 3300061719 Bacteria 524
486 Ga0530510_0060890 3300061734 Bacteria 2732
487 Ga0070709_10036383
488 JGI24747J21853_1014387
489 JGI24744J21845_10003623
490 JGI24742J22300_10016073
491 Ga0070658_10008240
492 Ga0070658_10211879
493 Ga0070658_10364072
494 Ga0070676_10249899
495 Ga0070683_100139670
496 Ga0070683_100793732
497 Ga0070683_101471987
498 Ga0070690_100068257
499 Ga0070677_10489241
500 Ga0068869_100314711
501 Ga0070666_10394797
502 Ga0070680_100132307
503 Ga0070680_101026183
504 Ga0070682_100023527
505 Ga0068868_100008821
506 Ga0068868_100754266
507 Ga0070660_100002972
508 Ga0070689_100003475
509 Ga0070689_100370054
510 Ga0070691_10014901
511 Ga0070691_10051673
512 Ga0070687_100022310
513 Ga0070687_100068298
514 Ga0070692_10016374
515 Ga0070692_10352542
516 Ga0070668_100036890
517 Ga0070668_100049990
518 Ga0070669_100025585
519 Ga0070671_100010906
520 Ga0070671_101524090
521 Ga0070674_100023258
522 Ga0070674_100027065
523 Ga0070688_100002353
524 Ga0070688_100741403
525 Ga0070659_100087608
526 Ga0070659_100372422
527 Ga0070659_100992546
528 Ga0070667_100163317
529 Ga0070714_101365135
530 Ga0070714_101642295
531 Ga0070710_10006577
532 Ga0070701_10019888
533 Ga0070711_100038756
534 Ga0070705_100059749
535 Ga0070705_100697510
536 Ga0070700_100001877
537 Ga0070700_100199498
538 Ga0070694_100013450
539 Ga0070694_100020582
540 Ga0070708_100364513
541 Ga0070663_100016932
542 Ga0070678_100009004
543 Ga0070678_100120381
544 Ga0070662_100111477
545 Ga0070681_10038073
546 Ga0068867_100000375
547 Ga0068867_100081899
548 Ga0070685_10008017
549 Ga0070706_100142318
550 Ga0070707_100088450
551 Ga0070707_100248623
552 Ga0070699_100720547
553 Ga0070679_100258778
554 Ga0070679_102157755
555 Ga0070684_100070571
556 Ga0070684_100112479
557 Ga0070684_100230334
558 Ga0070684_100591149
559 Ga0070684_101458664
560 Ga0070697_100918696
561 Ga0068853_100017797
562 Ga0068853_100176257
563 Ga0070672_100196006
564 Ga0070672_100507656
565 Ga0070686_100000954
566 Ga0070686_100021490
567 Ga0070695_100023343
568 Ga0070695_100037555
569 Ga0070695_100709893
570 Ga0070696_100058931
571 Ga0070696_100135773
572 Ga0070693_100131076
573 Ga0070665_100014747
574 Ga0070704_100037092
575 Ga0070704_100076548
576 Ga0068855_100029691
577 Ga0068855_100069762
578 Ga0068857_100585985
579 Ga0068854_100593282
580 Ga0068856_100002618
581 Ga0068856_100012426
582 Ga0070702_100000651
583 Ga0068852_100030961
584 Ga0068852_100036101
585 Ga0068859_100208752
586 Ga0068861_100016380
587 Ga0068858_100238464
588 Ga0068858_100417590
589 Ga0068860_100132914
590 Ga0068860_100173116
591 Ga0068862_100096856
592 Ga0081455_10001979
593 Ga0081455_10023775
594 Ga0070716_100391894
595 Ga0070712_100004831
596 Ga0097621_100395353
597 Ga0097621_100625579
598 Ga0068871_100005190
599 Ga0075433_11053025
600 Ga0075434_100426227
601 Ga0068865_100003429
602 Ga0075436_100274700
603 Ga0097620_100208747
604 Ga0097620_101482213
605 Ga0075435_100064824
606 Ga0105250_10207995
607 Ga0105240_10027311
608 Ga0105240_10210219
609 Ga0111539_10790803
610 Ga0105245_10008200
611 Ga0114129_10341441
612 Ga0105243_10021607
613 Ga0105241_11200689
614 Ga0105242_10005756
615 Ga0105242_10103925
616 Ga0105242_12654481
617 Ga0105248_10003741
618 Ga0105248_10134743
619 Ga0105248_10418938
620 Ga0105237_10330321
621 Ga0105249_10013783
622 Ga0105249_10025909
623 Ga0105239_10057791
624 Ga0105239_10059684
625 Ga0105239_11448887
626 Ga0105239_13386393
627 Ga0105246_10247683
628 Ga0157320_1012973
629 Ga0157329_1045112
630 Ga0157326_1005561
631 Ga0154012_148485
632 Ga0157371_10229372
633 Ga0157370_10015343
634 Ga0157370_10849025
635 Ga0157369_10003190
636 Ga0157369_10004573
637 Ga0157369_10910742
638 Ga0157369_11112400
639 Ga0157374_10016950
640 Ga0157374_10167811
641 Ga0157378_10050739
642 Ga0163162_10004432
643 Ga0163162_10115661
644 Ga0157372_10448136
645 Ga0157375_10012129
646 Ga0157375_10086828
647 Ga0157375_10375371
648 Ga0157375_11083970
649 Ga0163163_11369176
650 Ga0157380_10020823
651 Ga0157380_10119361
652 Ga0157377_10025905
653 Ga0157379_10097344
654 Ga0157379_11731384
655 Ga0157376_10010417
656 Ga0157376_10288759
657 Ga0157376_11976331
658 Ga0163161_10248025
659 Ga0163161_10385563
660 Ga0197907_11463924
661 Ga0206356_10668287
662 Ga0206356_10868470
663 Ga0206349_1519780
664 Ga0206355_1634637
665 Ga0206352_10044897
666 Ga0206352_10401206
667 Ga0206350_10240984
668 Ga0206350_10986134
669 Ga0206350_11309106
670 Ga0206350_11380068
671 Ga0206354_10220427
672 Ga0206354_10819210
673 Ga0206354_10820007
674 Ga0206354_11130422
675 Ga0206353_10617204
676 Ga0206353_10879637
677 Ga0206353_11788081
678 Ga0224712_10023476
679 Ga0224712_10290255
680 Ga0224712_10388837
681 Ga0207653_10024678
682 Ga0207682_10381324
683 Ga0207692_10009521
684 Ga0207692_11094089
685 Ga0207642_10019462
686 Ga0207642_10293484
687 Ga0207688_10035810
688 Ga0207680_10061738
689 Ga0207647_10217136
690 Ga0207699_10097701
691 Ga0207705_10251404
692 Ga0207705_10368235
693 Ga0207684_10072182
694 Ga0207707_10218395
695 Ga0207695_10049456
696 Ga0207671_10415139
697 Ga0207693_10001020
698 Ga0207663_10030980
699 Ga0207660_10165649
700 Ga0207660_10838892
701 Ga0207662_10021004
702 Ga0207662_10042725
703 Ga0207657_10017045
704 Ga0207657_10031163
705 Ga0207657_10088595
706 Ga0207649_10363707
707 Ga0207649_10747981
708 Ga0207652_10130499
709 Ga0207652_10182512
710 Ga0207652_10295943
711 Ga0207646_10329467
712 Ga0207681_10202393
713 Ga0207694_11462373
714 Ga0207659_10253908
715 Ga0207687_10012343
716 Ga0207687_10138143
717 Ga0207700_10455385
718 Ga0207700_10926817
719 Ga0207664_10149910
720 Ga0207664_10872146
721 Ga0207664_11481734
722 Ga0207644_10024387
723 Ga0207690_10370435
724 Ga0207690_10373800
725 Ga0207706_10043333
726 Ga0207706_11539175
727 Ga0207686_10004083
728 Ga0207686_10322738
729 Ga0207686_10501242
730 Ga0207709_10000824
731 Ga0207709_10339852
732 Ga0207670_10016399
733 Ga0207669_10014106
734 Ga0207669_10017508
735 Ga0207704_10003216
736 Ga0207704_10136941
737 Ga0207665_10251290
738 Ga0207665_10473342
739 Ga0207691_10123877
740 Ga0207711_10096462
741 Ga0207689_10225722
742 Ga0207661_10018928
743 Ga0207661_10283032
744 Ga0207661_10730685
745 Ga0207661_10785531
746 Ga0207667_10028507
747 Ga0207667_10400618
748 Ga0207667_11725556
749 Ga0207712_10040417
750 Ga0207668_10027908
751 Ga0207668_10056467
752 Ga0207640_10023210
753 Ga0207640_10685591
754 Ga0207658_10601574
755 Ga0207658_10613954
756 Ga0207677_10042871
757 Ga0207677_10495569
758 Ga0207677_12134314
759 Ga0207703_10206904
760 Ga0207639_10028987
761 Ga0207708_10002034
762 Ga0207708_10009742
763 Ga0207708_11542287
764 Ga0207702_10154072
765 Ga0207702_10429143
766 Ga0207648_10001753
767 Ga0207648_10104822
768 Ga0207676_10043245
769 Ga0207676_10423221
770 Ga0207675_100015594
771 Ga0207675_100048658
772 Ga0207675_100589403
773 Ga0207683_10000041
774 Ga0207683_10749892
775 Ga0207698_10098909
776 Ga0207698_10120993
777 Ga0268266_10115578
778 Ga0268264_10107852
779 Ga0268264_10818046
780 Ga0265334_10040072
781 Ga0265323_10066981
782 Ga0265338_10001764
783 Ga0265338_10109292
784 Ga0265338_10135230
785 Ga0265324_10008497
786 Ga0265327_10014469
787 Ga0265327_10113880
788 Ga0265313_10003866
789 Ga0307406_10780511
790 Ga0307406_11650556
791 Ga0307415_100201527
792 Ga0373944_0188259
793 Ga0373937_0425201
794 Ga0373925_0282192
795 Ga0395899_0308084
796 Ga0395900_0016589
797 Ga0395900_0398351
798 Ga0395898_0280129
799 Ga0395898_0858320
800 Ga0395898_0959560
801 Ga0395905_1719372
802 Ga0395901_0029886
803 Ga0395901_0137419
804 Ga0395901_0203818
805 Ga0395901_0533558
806 Ga0395901_0613491
807 Ga0436363_0041857
808 Ga0451807_0089392
809 Ga0451839_1591190
810 Ga0451849_1487720
811 Ga0451853_1802146
812 Ga0466966_0004108
813 Ga0466966_0008685
814 Ga0466966_0208577
815 Ga0466963_0046950
816 Ga0466963_0075188
817 Ga0466963_0261839
818 Ga0466963_0575491
819 Ga0466963_1334283
820 Ga0466964_0066150
821 Ga0466964_0084260
822 Ga0466968_0079430
823 Ga0466968_0309575
824 Ga0466957_0057899
825 Ga0466957_0262957
826 Ga0466960_0420152
827 Ga0466960_0952587
828 Ga0466959_0002761
829 Ga0466959_0035597
830 Ga0451576_0063534
831 Ga0451576_1246740
832 Ga0466958_0018234
833 Ga0466958_0045007
834 Ga0466958_0161351
835 Ga0466967_0040584
836 Ga0466967_0075615
837 Ga0466967_0175075
838 Ga0466967_0218451
839 Ga0466967_0364164
840 Ga0466967_0458284
841 Ga0466967_0552096
842 Ga0495592_0013555
843 Ga0495592_0900020
844 Ga0495603_0177630
845 Ga0495603_0824190
846 Ga0495641_0080155
847 Ga0495580_0142766
848 Ga0495582_0016652
849 Ga0495605_0409606
850 Ga0495639_0050983
851 Ga0495585_0574910
852 Ga0495594_0031060
853 Ga0495596_0216559
854 Ga0495583_0137823
855 Ga0495628_0161520
856 Ga0495642_0302059
857 Ga0495652_0009431
858 Ga0495667_0322510
859 Ga0495588_0183514
860 Ga0495588_0208016
861 Ga0495657_0136191
862 Ga0495599_0004834
863 Ga0495646_0063509
864 Ga0495647_0166134
865 Ga0495658_0072435
866 Ga0495624_0164382
867 Ga0495670_0340377
868 Ga0495600_0112755
869 Ga0495674_1012109
870 Ga0495676_0056621
871 Ga0495676_0102761
872 Ga0495676_0714783
873 Ga0495680_0476330
874 Ga0495677_0191637
875 Ga0495602_0038433
876 Ga0496100_0006916
877 Ga0496100_0037205
878 Ga0496100_0156069
879 Ga0496100_0516598
880 Ga0496101_0005413
881 Ga0496101_0025289
882 Ga0496101_0060141
883 Ga0496101_0601059
884 Ga0496101_0713212
885 Ga0496101_0917639
886 Ga0496102_0036038
887 Ga0496102_0036506
888 Ga0496102_0630118
889 Ga0496102_0678149
890 Ga0496103_0002218
891 Ga0496103_0324006
892 Ga0496104_0015130
893 Ga0496104_0145097
894 Ga0496104_0227901
895 Ga0496104_0527485
896 Ga0496104_0794931
897 Ga0496105_0001088
898 Ga0496105_0018476
899 Ga0496105_0166260
900 Ga0496105_0248236
901 Ga0496106_0006371
902 Ga0496106_0198494
903 Ga0496106_0503982
904 Ga0496106_1043801
905 Ga0496107_0002183
906 Ga0496107_0140776
907 Ga0496107_0151952
908 Ga0496107_0761816
909 Ga0496108_0005531
910 Ga0496108_0058584
911 Ga0496108_0084838
912 Ga0496108_0345446
913 Ga0496108_1168985
914 Ga0496109_0016183
915 Ga0496109_0056547
916 Ga0496109_0656802
917 Ga0496109_1774548
918 Ga0496110_0061462
919 Ga0496110_0108611
920 Ga0496110_0171566
921 Ga0496110_0172432
922 Ga0496110_0564873
923 Ga0496110_1137558
924 Ga0496111_0001024
925 Ga0496111_0082544
926 Ga0496111_0090239
927 Ga0496111_0198150
928 Ga0496111_0413612
929 Ga0496112_0032765
930 Ga0496112_0063613
931 Ga0496112_0104747
932 Ga0496112_0108506
933 Ga0496112_0245137
934 Ga0496113_0011791
935 Ga0496113_0028181
936 Ga0496113_0241227
937 Ga0496113_0246400
938 Ga0496114_0015637
939 Ga0496114_0031633
940 Ga0496114_0033805
941 Ga0496114_0097455
942 Ga0496114_0218559
943 Ga0496114_0338872
944 Ga0496114_0739714
945 Ga0496115_0006192
946 Ga0496115_0023358
947 Ga0496115_0363445
948 Ga0496115_0638225
949 Ga0501034_0072691
950 Ga0501042_0245805
951 Ga0501067_0012383
952 Ga0501069_0029558
953 Ga0501070_0021375
954 Ga0501070_0287649
955 Ga0501073_0038345
956 Ga0501074_0038502
957 Ga0501074_0086927
958 Ga0501079_0340215
959 Ga0501080_0002936
960 Ga0501080_0877561
961 Ga0501035_0694800
962 Ga0501044_0508759
963 nmdc:mga05p37_305666_c1
964 nmdc:mga0qj67_941162_c1
965 nmdc:mga06r32_953893_c1
966 nmdc:mga0n895_594974_c1
967 nmdc:mga0rr50_249662_c1
968 nmdc:mga08x19_166658_c1
969 Ga0495601_0012414
970 Ga0495595_0051902
971 Ga0466962_0688824
972 Ga0530510_0060890

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01641

SelR

SelR domain

10

121

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6q9v-assembly1.cif.gz_A msrb3 0.8598 1 129
6q9v-assembly2.cif.gz_B msrb3 0.8595 2 128
3cxk-assembly1.cif.gz_A 1.7 a crystal structure of methionine-r-sulfoxide reductase from burkholderia pseudomallei: crystallization in a microfluidic crystal card. 0.8563 3 129
6q9v-assembly1.cif.gz_A msrb3 0.8536 1 129
5fa9-assembly1.cif.gz_A bifunctional methionine sulfoxide reductase ab (msrab) from treponema denticola 0.8467 6 128
ID Description Score Start End Superfamily
af_Q8BU85_97_242_2.170.150.20 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A;Peptide methionine sulfoxide reductase. 0.8622 1 128 2.170.150.20
3cezB00 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A;Peptide methionine sulfoxide reductase. 0.8572 3 129 2.170.150.20
af_I6YA00_1_135_2.170.150.20 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A;Peptide methionine sulfoxide reductase. 0.8538 1 128 2.170.150.20
af_Q8BU85_97_242_2.170.150.20 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A;Peptide methionine sulfoxide reductase. 0.8498 1 128 2.170.150.20
af_Q78J03_33_175_2.170.150.20 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A;Peptide methionine sulfoxide reductase. 0.8494 6 129 2.170.150.20
ID Description Score Start End GO Terms
AF-A0A5M4ABL7-F1-model_v4 Peptide methionine sulfoxide reductase MsrB (EC 1.8.4.12) (Peptide-methionine (R)-S-oxide reductase) 0.88 2 129 GO:0005737
GO:0006979
GO:0008270
GO:0030091
GO:0033743
AF-A0A4Q5Q066-F1-model_v4 Peptide methionine sulfoxide reductase MsrB (EC 1.8.4.12) (Peptide-methionine (R)-S-oxide reductase) 0.8799 1 129 GO:0005737
GO:0006979
GO:0008270
GO:0030091
GO:0033743
AF-A0A1G2VK69-F1-model_v4 peptide-methionine (R)-S-oxide reductase (EC 1.8.4.12) 0.8799 1 129 GO:0005737
GO:0006979
GO:0016020
GO:0030091
GO:0033743
AF-H0SR20-F1-model_v4 Peptide methionine sulfoxide reductase MsrB (EC 1.8.4.12) (Peptide-methionine (R)-S-oxide reductase) 0.8795 1 129 GO:0005737
GO:0006979
GO:0008270
GO:0030091
GO:0033743
AF-W0SGX8-F1-model_v4 Peptide methionine sulfoxide reductase MsrB (EC 1.8.4.12) (Peptide-methionine (R)-S-oxide reductase) 0.8795 1 129 GO:0005737
GO:0006979
GO:0008270
GO:0030091
GO:0033743

Map