F453176

General Info

Members Datasets Scaffolds Average Seq Length
485 245 466 258

Family's Representative Sequence

Representative Sequence 3300049823|Ga0501044_0226937|Ga0501044_0226937_1017_1802
Length 261
Sequence MTVIIPAVMPPLRRPNKYARNLPASAGLGWLAAGWRDLKTQPVTSLLYGIAVFAVSLGIVYCLFAFGWDYILFPALAGFMVVGPVIAVGLYEKSRRLAAGKSTSVTDMLFVRTGSGQILFVGVLLCLLMVVWMRAAVIVYALFFGVRPFPGLDHVAAMLFTTTTGWALLVVGTLVGGLFAAFSFAISVFAVPMLLDQKPDAFTAMGTSLALVWHNLPAMLVWGVVVMALIAASLATGMLGLVIVFPLLGHATWHAYEAVRQ

Samples

Sample ID Description Type Environment
1 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
2 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
3 2643221651 Afipia sp. Root123D2 Isolate Unclassified
4 2643221733 Bosea sp. Root381 Isolate Unclassified
5 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
6 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
7 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
8 2909042592 Labrys sp. LIt4 Isolate Nodule
9 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
10 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
11 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
12 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
13 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
14 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
15 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
16 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
17 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
18 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
19 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
20 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
21 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
22 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
23 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
24 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
25 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
26 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
27 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
28 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
29 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
30 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
37 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
38 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
39 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
40 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
62 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
63 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
64 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
65 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
66 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
67 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
68 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
69 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
70 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
74 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
75 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
76 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
77 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
81 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
83 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
88 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
89 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
90 3300009988 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG Metagenome Rhizosphere
91 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
94 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
95 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
96 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
97 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
100 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
101 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
102 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
103 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
104 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
105 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
106 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
107 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
108 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
109 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
110 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
111 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
146 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
150 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
151 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
152 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
153 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
154 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
155 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
156 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
157 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
158 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
159 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
160 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
161 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
162 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
163 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
164 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
165 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
166 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
167 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
168 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
169 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
170 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
171 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
172 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
173 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
174 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
175 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
176 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
177 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
178 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
179 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
180 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
181 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
182 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
183 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
184 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
185 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
186 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
187 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
188 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
189 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
190 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
191 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
192 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
193 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
207 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
208 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
209 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
210 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
211 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
212 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
213 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
214 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
215 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
216 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
217 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
218 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
219 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
220 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
223 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
224 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
225 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
226 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
227 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
228 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
229 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
230 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
231 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
232 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
233 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
234 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
235 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
236 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
237 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
238 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
239 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
240 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
241 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
242 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
243 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
244 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
245 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.08
Metatranscriptomes 0
Isolates 3.92

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.77
Nodule 2.89
Rhizoplane 3.51
Rhizosphere 86.6
Stem 0
Stem Tuber 0
Unclassified 1.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10000166 3300002067 Bacteria 23564
2 JGI25406J46586_10020594 3300003203 Bacteria 2664
3 rootH2_10037747 3300003320 Bacteria 6000
4 Ga0055526_1001740 3300003771 Bacteria 15126
5 Ga0055524_1000278 3300003775 Bacteria 50903
6 Ga0055528_1011628 3300003790 Bacteria 3478
7 JGI25405J52794_10006850 3300003911 Bacteria 2087
8 Ga0070658_10014346 3300005327 Bacteria 6357
9 Ga0070658_10060208 3300005327 Bacteria 3092
10 Ga0070683_100003600 3300005329 Bacteria 12622
11 Ga0070683_100249730 3300005329 Bacteria 1687
12 Ga0070690_100340433 3300005330 Bacteria 1086
13 Ga0070680_100003772 3300005336 Bacteria 11324
14 Ga0070680_100016951 3300005336 Bacteria 5736
15 Ga0070680_100091525 3300005336 Bacteria 2518
16 Ga0070680_100105360 3300005336 Bacteria 2344
17 Ga0070680_100352196 3300005336 Bacteria 1252
18 Ga0070660_100059083 3300005339 Bacteria 2973
19 Ga0070660_100120430 3300005339 Bacteria 2094
20 Ga0070689_100239787 3300005340 Bacteria 1493
21 Ga0070691_10015217 3300005341 Bacteria 3534
22 Ga0070669_100059993 3300005353 Bacteria 2793
23 Ga0070669_100132504 3300005353 Bacteria 1914
24 Ga0070671_100084899 3300005355 Bacteria 2648
25 Ga0070674_100005086 3300005356 Bacteria 7559
26 Ga0070674_100006661 3300005356 Bacteria 6754
27 Ga0070673_100320033 3300005364 Bacteria 1370
28 Ga0070659_100046904 3300005366 Bacteria 3387
29 Ga0070709_10130368 3300005434 Bacteria 1716
30 Ga0070709_10432242 3300005434 Bacteria 989
31 Ga0070709_10537841 3300005434 Bacteria 892
32 Ga0070713_100318468 3300005436 Bacteria 1436
33 Ga0070710_10008797 3300005437 Bacteria 4924
34 Ga0070700_100025537 3300005441 Bacteria 3479
35 Ga0070700_100043320 3300005441 Bacteria 2768
36 Ga0070694_100093472 3300005444 Bacteria 2114
37 Ga0070694_100414366 3300005444 Bacteria 1057
38 Ga0070663_100013179 3300005455 Bacteria 5258
39 Ga0070663_100192632 3300005455 Bacteria 1587
40 Ga0070681_10010245 3300005458 Bacteria 9249
41 Ga0070681_10017960 3300005458 Bacteria 7070
42 Ga0070681_10025609 3300005458 Bacteria 5934
43 Ga0070681_10091247 3300005458 Bacteria 2997
44 Ga0070681_10099552 3300005458 Bacteria 2853
45 Ga0070679_100020866 3300005530 Bacteria 6391
46 Ga0070679_100026016 3300005530 Bacteria 5743
47 Ga0070679_100050484 3300005530 Bacteria 4144
48 Ga0070679_100100921 3300005530 Bacteria 2872
49 Ga0070679_100398642 3300005530 Bacteria 1322
50 Ga0070684_100022719 3300005535 Bacteria 5235
51 Ga0070684_100133733 3300005535 Bacteria 2238
52 Ga0068853_100079732 3300005539 Bacteria 2863
53 Ga0068853_100159247 3300005539 Bacteria 2036
54 Ga0070696_100022913 3300005546 Bacteria 4247
55 Ga0070693_100006909 3300005547 Bacteria 5519
56 Ga0070665_100019248 3300005548 Bacteria 6849
57 Ga0070665_100084679 3300005548 Bacteria 3176
58 Ga0070704_100124816 3300005549 Bacteria 1984
59 Ga0068855_100032721 3300005563 Bacteria 6208
60 Ga0068855_100080550 3300005563 Bacteria 3775
61 Ga0068855_100512511 3300005563 Bacteria 1302
62 Ga0068855_100597241 3300005563 Bacteria 1191
63 Ga0068857_100043275 3300005577 Bacteria 3995
64 Ga0068857_100203508 3300005577 Bacteria 1805
65 Ga0068856_100221996 3300005614 Bacteria 1905
66 Ga0070702_100098481 3300005615 Bacteria 1789
67 Ga0068852_100060965 3300005616 Bacteria 3277
68 Ga0068859_100215041 3300005617 Bacteria 2009
69 Ga0068859_100624239 3300005617 Bacteria 1170
70 Ga0068864_100047954 3300005618 Bacteria 3671
71 Ga0068870_10206891 3300005840 Bacteria 1193
72 Ga0068858_100076376 3300005842 Bacteria 3111
73 Ga0068860_100083500 3300005843 Bacteria 3038
74 Ga0068862_100013789 3300005844 Bacteria 6698
75 Ga0081455_10002931 3300005937 Bacteria 19999
76 Ga0081455_10003276 3300005937 Bacteria 18740
77 Ga0081455_10020346 3300005937 Bacteria 6253
78 Ga0081455_10023516 3300005937 Bacteria 5731
79 Ga0081540_1000136 3300005983 Bacteria 78663
80 Ga0081540_1016291 3300005983 Bacteria 4658
81 Ga0081540_1025790 3300005983 Bacteria 3372
82 Ga0081539_10002021 3300005985 Bacteria 30604
83 Ga0075432_10002788 3300006058 Bacteria 5863
84 Ga0070715_10011164 3300006163 Bacteria 3226
85 Ga0070716_100055318 3300006173 Bacteria 2270
86 Ga0070712_100211912 3300006175 Bacteria 1528
87 Ga0075367_10253436 3300006178 Bacteria 1104
88 Ga0075369_10032020 3300006186 Bacteria 2223
89 Ga0075369_10137732 3300006186 Bacteria 1112
90 Ga0075369_10138388 3300006186 Bacteria 1109
91 Ga0075427_10000097 3300006194 Bacteria 7254
92 Ga0068871_100227755 3300006358 Bacteria 1617
93 Ga0075428_100013088 3300006844 Bacteria 9224
94 Ga0075428_100018039 3300006844 Bacteria 7799
95 Ga0075430_100002416 3300006846 Bacteria 15551
96 Ga0075430_100030969 3300006846 Bacteria 4543
97 Ga0075431_100000251 3300006847 Bacteria 40790
98 Ga0075431_100005932 3300006847 Bacteria 12086
99 Ga0075433_10001944 3300006852 Bacteria 15534
100 Ga0075434_100000735 3300006871 Bacteria 25720
101 Ga0075429_100002109 3300006880 Bacteria 16601
102 Ga0075429_100004142 3300006880 Bacteria 12408
103 Ga0068865_100332874 3300006881 Bacteria 1225
104 Ga0097620_100215045 3300006931 Bacteria 2009
105 Ga0097620_100624291 3300006931 Bacteria 1170
106 Ga0075435_100000696 3300007076 Bacteria 20869
107 Ga0111539_10000051 3300009094 Bacteria 117607
108 Ga0111539_10000930 3300009094 Bacteria 38345
109 Ga0111539_10008602 3300009094 Bacteria 12963
110 Ga0105245_10166542 3300009098 Bacteria 2095
111 Ga0114129_10001487 3300009147 Bacteria 31741
112 Ga0114129_10009304 3300009147 Bacteria 14014
113 Ga0105243_10042049 3300009148 Bacteria 3576
114 Ga0105243_10095271 3300009148 Bacteria 2460
115 Ga0105243_10602706 3300009148 Bacteria 1058
116 Ga0105241_10011285 3300009174 Bacteria 6550
117 Ga0105241_10119811 3300009174 Bacteria 2118
118 Ga0105248_10634072 3300009177 Bacteria 1206
119 Ga0105237_10025096 3300009545 Bacteria 6098
120 Ga0105237_10032441 3300009545 Bacteria 5288
121 Ga0105238_10083721 3300009551 Bacteria 3179
122 Ga0105238_10168775 3300009551 Bacteria 2164
123 Ga0105238_10308818 3300009551 Bacteria 1566
124 Ga0105249_10383326 3300009553 Bacteria 1432
125 Ga0105035_105180 3300009988 Bacteria 1051
126 Ga0105028_103044 3300009993 Bacteria 1757
127 Ga0105239_10061779 3300010375 Bacteria 4112
128 Ga0105239_10161104 3300010375 Bacteria 2506
129 Ga0105246_10034073 3300011119 Bacteria 3389
130 Ga0157373_10075358 3300013100 Bacteria 2380
131 Ga0157373_10106696 3300013100 Bacteria 1969
132 Ga0157371_10283082 3300013102 Bacteria 1198
133 Ga0157369_10186616 3300013105 Bacteria 2180
134 Ga0157369_10196208 3300013105 Bacteria 2120
135 Ga0157369_10615913 3300013105 Bacteria 1120
136 Ga0157374_10003630 3300013296 Bacteria 12977
137 Ga0163162_10069528 3300013306 Bacteria 3573
138 Ga0163162_10540994 3300013306 Bacteria 1293
139 Ga0157372_10158029 3300013307 Bacteria 2619
140 Ga0157375_10045904 3300013308 Bacteria 4255
141 Ga0157380_10017684 3300014326 Bacteria 5280
142 Ga0157380_10020957 3300014326 Bacteria 4896
143 Ga0157380_10125417 3300014326 Bacteria 2181
144 Ga0182008_10098832 3300014497 Bacteria 1441
145 Ga0157379_10142514 3300014968 Bacteria 2160
146 Ga0157376_10107997 3300014969 Bacteria 2444
147 Ga0157376_10398929 3300014969 Bacteria 1329
148 Ga0163161_10234862 3300017792 Bacteria 1424
149 Ga0209673_1001289 3300025273 Bacteria 25599
150 Ga0209675_1000285 3300025291 Bacteria 47895
151 Ga0209564_1000017 3300025295 Bacteria 594063
152 Ga0209564_1000206 3300025295 Bacteria 135849
153 Ga0209256_1000133 3300025299 Bacteria 160303
154 Ga0207426_1011052 3300025302 Bacteria 3464
155 Ga0207642_10084822 3300025899 Bacteria 1548
156 Ga0207647_10035503 3300025904 Bacteria 3177
157 Ga0207647_10046522 3300025904 Bacteria 2703
158 Ga0207647_10070580 3300025904 Bacteria 2109
159 Ga0207685_10105603 3300025905 Bacteria 1212
160 Ga0207699_10066295 3300025906 Bacteria 2191
161 Ga0207705_10027871 3300025909 Bacteria 4028
162 Ga0207705_10079092 3300025909 Bacteria 2394
163 Ga0207705_10158145 3300025909 Bacteria 1701
164 Ga0207707_10051385 3300025912 Bacteria 3589
165 Ga0207707_10055542 3300025912 Bacteria 3445
166 Ga0207707_10058957 3300025912 Bacteria 3340
167 Ga0207695_10112225 3300025913 Bacteria 2704
168 Ga0207671_10018289 3300025914 Bacteria 5379
169 Ga0207693_10022650 3300025915 Bacteria 4990
170 Ga0207693_10029350 3300025915 Bacteria 4345
171 Ga0207660_10037440 3300025917 Bacteria 3380
172 Ga0207660_10038539 3300025917 Bacteria 3337
173 Ga0207660_10163554 3300025917 Bacteria 1719
174 Ga0207657_10003352 3300025919 Bacteria 17135
175 Ga0207657_10069148 3300025919 Bacteria 2997
176 Ga0207657_10071311 3300025919 Bacteria 2942
177 Ga0207657_10138030 3300025919 Bacteria 1994
178 Ga0207652_10012632 3300025921 Bacteria 6826
179 Ga0207652_10045035 3300025921 Bacteria 3760
180 Ga0207652_10082513 3300025921 Bacteria 2813
181 Ga0207652_10117406 3300025921 Bacteria 2364
182 Ga0207681_10144335 3300025923 Bacteria 1776
183 Ga0207681_10177079 3300025923 Bacteria 1621
184 Ga0207694_10057335 3300025924 Bacteria 3028
185 Ga0207694_10215942 3300025924 Bacteria 1563
186 Ga0207659_10054295 3300025926 Bacteria 2861
187 Ga0207644_10060718 3300025931 Bacteria 2736
188 Ga0207690_10018147 3300025932 Bacteria 4312
189 Ga0207690_10201680 3300025932 Bacteria 1511
190 Ga0207709_10119277 3300025935 Bacteria 1778
191 Ga0207669_10016058 3300025937 Bacteria 3793
192 Ga0207704_10321501 3300025938 Bacteria 1194
193 Ga0207665_10010418 3300025939 Bacteria 6106
194 Ga0207665_10051754 3300025939 Bacteria 2765
195 Ga0207691_10187155 3300025940 Bacteria 1807
196 Ga0207711_10463027 3300025941 Unclassified 1181
197 Ga0207661_10041197 3300025944 Bacteria 3634
198 Ga0207667_10054232 3300025949 Bacteria 4217
199 Ga0207667_10211388 3300025949 Bacteria 1988
200 Ga0207651_10108770 3300025960 Bacteria 2076
201 Ga0207712_10253291 3300025961 Bacteria 1424
202 Ga0207640_10088833 3300025981 Bacteria 2135
203 Ga0207640_10180110 3300025981 Bacteria 1584
204 Ga0207639_10007560 3300026041 Bacteria 7412
205 Ga0207639_10162636 3300026041 Bacteria 1883
206 Ga0207678_10000595 3300026067 Bacteria 33105
207 Ga0207678_10083550 3300026067 Bacteria 2731
208 Ga0207702_10402092 3300026078 Bacteria 1321
209 Ga0207648_10196341 3300026089 Bacteria 1789
210 Ga0207676_10045068 3300026095 Bacteria 3406
211 Ga0207674_10083437 3300026116 Bacteria 3195
212 Ga0207674_10333838 3300026116 Bacteria 1466
213 Ga0207428_10000016 3300027907 Bacteria 327690
214 Ga0207428_10000322 3300027907 Bacteria 62220
215 Ga0207428_10036638 3300027907 Bacteria 3999
216 Ga0268266_10070015 3300028379 Bacteria 3041
217 Ga0268265_10020698 3300028380 Bacteria 4596
218 Ga0268264_10065942 3300028381 Bacteria 3052
219 Ga0265314_10063171 3300031711 Bacteria 2513
220 Ga0265342_10000717 3300031712 Bacteria 34273
221 Ga0373936_0263277 3300035113 Unclassified 772
222 Ga0373931_0030338 3300035691 Bacteria 2783
223 Ga0395899_0005148 3300037312 Bacteria 10171
224 Ga0395899_0215959 3300037312 Bacteria 1330
225 Ga0395900_0014938 3300037418 Bacteria 7913
226 Ga0395900_0018084 3300037418 Bacteria 7193
227 Ga0395900_0388312 3300037418 Bacteria 1362
228 Ga0395898_0017181 3300037466 Bacteria 7390
229 Ga0395898_0313929 3300037466 Bacteria 1495
230 Ga0395901_0007302 3300038443 Bacteria 11152
231 Ga0395901_0080115 3300038443 Bacteria 3409
232 Ga0395901_0686228 3300038443 Bacteria 1023
233 Ga0495603_0006242 3300046455 Bacteria 7125
234 Ga0495662_0081371 3300046476 Bacteria 1575
235 Ga0495585_0010445 3300046492 Bacteria 5522
236 Ga0495585_0038850 3300046492 Bacteria 2678
237 Ga0495594_0089049 3300046499 Bacteria 1728
238 Ga0495594_0382935 3300046499 Bacteria 800
239 Ga0495632_0086070 3300046519 Bacteria 1495
240 Ga0495644_0043479 3300046523 Bacteria 1690
241 Ga0495648_0023613 3300046524 Bacteria 4205
242 Ga0495663_0016058 3300046525 Bacteria 2115
243 Ga0495598_0002430 3300046537 Bacteria 3846
244 Ga0495598_0014559 3300046537 Bacteria 1969
245 Ga0495609_0111612 3300046538 Bacteria 1180
246 Ga0495621_0002024 3300046539 Bacteria 5352
247 Ga0495622_0066879 3300046557 Bacteria 1661
248 Ga0495656_0001667 3300046615 Bacteria 7262
249 Ga0495668_0098148 3300046616 Bacteria 1603
250 Ga0495611_0252033 3300046648 Bacteria 818
251 Ga0495625_0007227 3300046660 Bacteria 9721
252 Ga0495659_0001341 3300046664 Bacteria 8444
253 Ga0495659_0062585 3300046664 Bacteria 1377
254 Ga0495661_0087583 3300046665 Bacteria 1780
255 Ga0495669_0028262 3300046684 Bacteria 2455
256 Ga0495670_0001984 3300046691 Bacteria 10048
257 Ga0495670_0025194 3300046691 Bacteria 2942
258 Ga0495672_0023035 3300047320 Bacteria 4037
259 Ga0495677_0098561 3300047445 Bacteria 1105
260 Ga0495677_0118003 3300047445 Bacteria 1011
261 Ga0495681_0090787 3300047470 Bacteria 1349
262 Ga0496100_0229419 3300048903 Bacteria 1366
263 Ga0496100_0293506 3300048903 Bacteria 1215
264 Ga0496101_0016829 3300048904 Bacteria 4949
265 Ga0496101_0363725 3300048904 Bacteria 1137
266 Ga0496102_0115853 3300048905 Bacteria 2500
267 Ga0496103_0095263 3300048906 Bacteria 1881
268 Ga0496104_0015333 3300048907 Bacteria 6940
269 Ga0496105_0056649 3300048908 Bacteria 3235
270 Ga0496106_0009208 3300048909 Bacteria 7292
271 Ga0496106_0108307 3300048909 Bacteria 2161
272 Ga0496107_0100408 3300048910 Bacteria 2121
273 Ga0496108_0438671 3300048911 Unclassified 1141
274 Ga0496109_0045841 3300048912 Bacteria 3969
275 Ga0496110_0102329 3300048913 Bacteria 2569
276 Ga0496112_0003127 3300048915 Bacteria 13579
277 Ga0496115_0058740 3300048918 Bacteria 3096
278 Ga0496115_0136806 3300048918 Bacteria 2020
279 Ga0501031_0079580 3300049568 Bacteria 2136
280 Ga0501031_0081658 3300049568 Bacteria 2107
281 Ga0501031_0119502 3300049568 Bacteria 1722
282 Ga0501031_0371922 3300049568 Bacteria 925
283 Ga0501032_0000088 3300049569 Bacteria 79913
284 Ga0501032_0010187 3300049569 Bacteria 6784
285 Ga0501032_0013734 3300049569 Bacteria 5747
286 Ga0501032_0022595 3300049569 Bacteria 4359
287 Ga0501032_0202238 3300049569 Bacteria 1296
288 Ga0501032_0203270 3300049569 Bacteria 1293
289 Ga0501032_0333220 3300049569 Bacteria 978
290 Ga0501032_0440732 3300049569 Bacteria 835
291 Ga0501033_0012549 3300049570 Bacteria 6464
292 Ga0501033_0021686 3300049570 Bacteria 4847
293 Ga0501033_0052224 3300049570 Bacteria 3029
294 Ga0501033_0059478 3300049570 Bacteria 2822
295 Ga0501034_0001025 3300049571 Bacteria 40060
296 Ga0501034_0009514 3300049571 Bacteria 10172
297 Ga0501034_0023476 3300049571 Bacteria 6284
298 Ga0501034_0032696 3300049571 Bacteria 5283
299 Ga0501034_0088735 3300049571 Bacteria 3090
300 Ga0501034_0125719 3300049571 Unclassified 2550
301 Ga0501034_0134576 3300049571 Bacteria 2453
302 Ga0501034_0177083 3300049571 Bacteria 2098
303 Ga0501034_0217799 3300049571 Bacteria 1862
304 Ga0501034_0310016 3300049571 Bacteria 1513
305 Ga0501034_0390270 3300049571 Bacteria 1316
306 Ga0501034_0464370 3300049571 Bacteria 1182
307 Ga0501036_0001583 3300049572 Bacteria 17598
308 Ga0501036_0002162 3300049572 Bacteria 15345
309 Ga0501036_0009356 3300049572 Bacteria 8058
310 Ga0501036_0034806 3300049572 Bacteria 4261
311 Ga0501036_0168957 3300049572 Bacteria 1843
312 Ga0501036_0365744 3300049572 Bacteria 1204
313 Ga0501036_0366531 3300049572 Bacteria 1203
314 Ga0501037_0011718 3300049573 Bacteria 6454
315 Ga0501037_0066608 3300049573 Bacteria 2623
316 Ga0501037_0069521 3300049573 Bacteria 2563
317 Ga0501037_0086171 3300049573 Bacteria 2274
318 Ga0501037_0127836 3300049573 Bacteria 1823
319 Ga0501037_0386582 3300049573 Bacteria 961
320 Ga0501038_0032935 3300049574 Bacteria 4566
321 Ga0501038_0047080 3300049574 Bacteria 3736
322 Ga0501038_0066828 3300049574 Bacteria 3060
323 Ga0501038_0091090 3300049574 Bacteria 2555
324 Ga0501038_0135475 3300049574 Bacteria 2018
325 Ga0501039_0006642 3300049575 Bacteria 8791
326 Ga0501039_0015979 3300049575 Bacteria 5747
327 Ga0501039_0092276 3300049575 Bacteria 2360
328 Ga0501039_0402516 3300049575 Bacteria 1075
329 Ga0501042_0016185 3300049578 Bacteria 5116
330 Ga0501042_0047003 3300049578 Bacteria 3077
331 Ga0501043_0001947 3300049579 Bacteria 17672
332 Ga0501043_0003962 3300049579 Bacteria 12137
333 Ga0501043_0025661 3300049579 Bacteria 4623
334 Ga0501043_0045010 3300049579 Bacteria 3471
335 Ga0501043_0232101 3300049579 Bacteria 1425
336 Ga0501046_0003677 3300049580 Bacteria 14051
337 Ga0501046_0006834 3300049580 Bacteria 10064
338 Ga0501046_0041616 3300049580 Bacteria 3665
339 Ga0501047_0000314 3300049581 Bacteria 55906
340 Ga0501047_0000347 3300049581 Bacteria 52509
341 Ga0501047_0005674 3300049581 Bacteria 11746
342 Ga0501047_0026175 3300049581 Bacteria 5611
343 Ga0501047_0030752 3300049581 Bacteria 5175
344 Ga0501047_0042681 3300049581 Bacteria 4382
345 Ga0501047_0052194 3300049581 Bacteria 3951
346 Ga0501047_0097247 3300049581 Bacteria 2822
347 Ga0501047_0145932 3300049581 Bacteria 2243
348 Ga0501047_0153146 3300049581 Bacteria 2180
349 Ga0501047_0167681 3300049581 Bacteria 2066
350 Ga0501047_0174020 3300049581 Bacteria 2021
351 Ga0501047_0179446 3300049581 Bacteria 1984
352 Ga0501047_0345157 3300049581 Bacteria 1326
353 Ga0501047_0439786 3300049581 Bacteria 1134
354 Ga0501047_0567621 3300049581 Bacteria 958
355 Ga0501048_0004586 3300049582 Bacteria 10516
356 Ga0501067_0002302 3300049583 Bacteria 10553
357 Ga0501067_0010373 3300049583 Bacteria 5156
358 Ga0501067_0045165 3300049583 Bacteria 2447
359 Ga0501067_0082853 3300049583 Bacteria 1779
360 Ga0501068_0001004 3300049584 Bacteria 14854
361 Ga0501068_0010693 3300049584 Bacteria 5161
362 Ga0501068_0014408 3300049584 Bacteria 4520
363 Ga0501068_0036603 3300049584 Bacteria 2935
364 Ga0501069_0003270 3300049585 Bacteria 8316
365 Ga0501069_0030841 3300049585 Bacteria 2946
366 Ga0501069_0050400 3300049585 Bacteria 2315
367 Ga0501069_0121723 3300049585 Bacteria 1490
368 Ga0501069_0123399 3300049585 Bacteria 1480
369 Ga0501070_0002456 3300049586 Bacteria 16246
370 Ga0501070_0003458 3300049586 Bacteria 13697
371 Ga0501070_0017208 3300049586 Bacteria 6068
372 Ga0501070_0026604 3300049586 Bacteria 4854
373 Ga0501070_0036013 3300049586 Bacteria 4133
374 Ga0501070_0049764 3300049586 Bacteria 3480
375 Ga0501070_0067911 3300049586 Bacteria 2952
376 Ga0501071_0000531 3300049587 Bacteria 19526
377 Ga0501071_0006157 3300049587 Bacteria 7776
378 Ga0501072_0028980 3300049588 Bacteria 4322
379 Ga0501072_0315028 3300049588 Bacteria 1243
380 Ga0501072_0322472 3300049588 Bacteria 1228
381 Ga0501073_0005130 3300049589 Bacteria 9827
382 Ga0501073_0029708 3300049589 Bacteria 3905
383 Ga0501073_0076716 3300049589 Bacteria 2325
384 Ga0501073_0437655 3300049589 Bacteria 904
385 Ga0501074_0008112 3300049590 Bacteria 7610
386 Ga0501074_0015123 3300049590 Bacteria 5610
387 Ga0501074_0020517 3300049590 Bacteria 4802
388 Ga0501074_0032290 3300049590 Bacteria 3793
389 Ga0501075_0085956 3300049591 Bacteria 2383
390 Ga0501076_0011296 3300049592 Bacteria 6646
391 Ga0501079_0001610 3300049741 Bacteria 16086
392 Ga0501080_0000240 3300049742 Bacteria 41140
393 Ga0501080_0024265 3300049742 Bacteria 5622
394 Ga0501080_0025121 3300049742 Bacteria 5529
395 Ga0501080_0039674 3300049742 Bacteria 4394
396 Ga0501080_0068143 3300049742 Bacteria 3310
397 Ga0501080_0744871 3300049742 Bacteria 862
398 Ga0501081_0159565 3300049743 Bacteria 1624
399 Ga0501083_0006193 3300049744 Bacteria 8487
400 Ga0501083_0010177 3300049744 Bacteria 6628
401 Ga0501083_0042951 3300049744 Bacteria 3063
402 Ga0501083_0124845 3300049744 Bacteria 1688
403 Ga0501083_0383573 3300049744 Unclassified 914
404 Ga0501035_0007590 3300049822 Bacteria 10134
405 Ga0501035_0008383 3300049822 Bacteria 9623
406 Ga0501035_0038073 3300049822 Bacteria 4354
407 Ga0501035_0147312 3300049822 Bacteria 2044
408 Ga0501035_0175562 3300049822 Bacteria 1848
409 Ga0501035_0254093 3300049822 Bacteria 1491
410 Ga0501035_0386643 3300049822 Bacteria 1166
411 Ga0501044_0000084 3300049823 Bacteria 114544
412 Ga0501044_0000565 3300049823 Bacteria 45019
413 Ga0501044_0002073 3300049823 Bacteria 23111
414 Ga0501044_0006032 3300049823 Bacteria 13377
415 Ga0501044_0043783 3300049823 Bacteria 4649
416 Ga0501044_0047317 3300049823 Bacteria 4448
417 Ga0501044_0051432 3300049823 Bacteria 4248
418 Ga0501044_0078196 3300049823 Bacteria 3353
419 Ga0501044_0084633 3300049823 Bacteria 3205
420 Ga0501044_0089372 3300049823 Bacteria 3109
421 Ga0501044_0092878 3300049823 Bacteria 3043
422 Ga0501044_0118146 3300049823 Bacteria 2655
423 Ga0501044_0220406 3300049823 Bacteria 1848
424 Ga0501044_0226937 3300049823 Bacteria 1817
425 Ga0501044_0288064 3300049823 Bacteria 1574
426 Ga0501044_0368252 3300049823 Unclassified 1354
427 Ga0501044_0561725 3300049823 Bacteria 1037
428 Ga0501044_0729682 3300049823 Bacteria 874
429 Ga0501045_0007068 3300049824 Bacteria 7779
430 nmdc:mga03n38_91806_c1 3300050490 Bacteria 1447
431 nmdc:mga0yw44_162373_c1 3300050492 Bacteria 1463
432 nmdc:mga0yw44_47932_c1 3300050492 Bacteria 2574
433 nmdc:mga05p37_1239_c1 3300050507 Bacteria 29626
434 nmdc:mga05p37_213_c1 3300050507 Bacteria 58791
435 nmdc:mga09592_3152_c1 3300050508 Bacteria 13391
436 nmdc:mga09592_5003_c1 3300050508 Bacteria 10744
437 nmdc:mga0qj67_15592_c1 3300050509 Bacteria 5754
438 nmdc:mga0qj67_7072_c1 3300050509 Bacteria 8277
439 nmdc:mga06r32_4393_c1 3300050510 Bacteria 12608
440 nmdc:mga06r32_571_c1 3300050510 Bacteria 32046
441 nmdc:mga08y16_26_c1 3300050511 Bacteria 223965
442 nmdc:mga08y16_5337_c1 3300050511 Bacteria 13447
443 nmdc:mga08y16_6730_c1 3300050511 Bacteria 12051
444 nmdc:mga0n895_1733_c1 3300050512 Bacteria 16489
445 nmdc:mga0rr50_1133_c1 3300050513 Bacteria 14503
446 nmdc:mga0a205_1982_c1 3300050515 Bacteria 17840
447 nmdc:mga0a205_334054_c1 3300050515 Bacteria 1385
448 nmdc:mga0sz30_100177_c1 3300050516 Bacteria 1265
449 nmdc:mga0sz30_166930_c1 3300050516 Bacteria 976
450 nmdc:mga0sz30_25000_c1 3300050516 Bacteria 2441
451 Ga0500578_0028212 3300053086 Bacteria 3607
452 Ga0500651_0152448 3300053093 Bacteria 1387
453 Ga0500641_0000482 3300053096 Bacteria 14541
454 Ga0500641_0043876 3300053096 Bacteria 1816
455 Ga0500588_0000536 3300053146 Bacteria 6137
456 Ga0500604_0055819 3300053151 Bacteria 1229
457 Ga0500616_0000888 3300053153 Bacteria 32969
458 Ga0500616_0014213 3300053153 Bacteria 4582
459 Ga0500609_003907 3300053731 Bacteria 2077
460 Ga0501084_0006160 3300054114 Bacteria 9864
461 Ga0501084_0011858 3300054114 Bacteria 7215
462 Ga0501084_0256640 3300054114 Bacteria 1476
463 Ga0501082_0000183 3300060353 Bacteria 54241
464 Ga0501082_0009544 3300060353 Bacteria 8351
465 Ga0501082_0043102 3300060353 Bacteria 3890
466 Ga0501082_0066334 3300060353 Bacteria 3109

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009098 Ga0105245_10166542 Ga0105245_101665422 223
2 3300009174 Ga0105241_10119811 Ga0105241_101198113 223
3 3300010375 Ga0105239_10061779 Ga0105239_100617792 223
4 3300011119 Ga0105246_10034073 Ga0105246_100340733 223
5 3300013306 Ga0163162_10069528 Ga0163162_100695284 223
6 3300014968 Ga0157379_10142514 Ga0157379_101425143 223
7 3300014969 Ga0157376_10107997 Ga0157376_101079972 223
8 3300035691 Ga0373931_0030338 Ga0373931_0030338_781_1467 223
9 3300048903 Ga0496100_0293506 Ga0496100_0293506_352_1038 223
10 3300048904 Ga0496101_0363725 Ga0496101_0363725_435_1121 223
11 3300048906 Ga0496103_0095263 Ga0496103_0095263_897_1583 223
12 3300048907 Ga0496104_0015333 Ga0496104_0015333_4564_5250 223
13 3300048908 Ga0496105_0056649 Ga0496105_0056649_1554_2240 223
14 3300048909 Ga0496106_0108307 Ga0496106_0108307_189_875 223
15 3300048910 Ga0496107_0100408 Ga0496107_0100408_357_1043 223
16 3300048912 Ga0496109_0045841 Ga0496109_0045841_2440_3126 223
17 3300048915 Ga0496112_0003127 Ga0496112_0003127_446_1132 223
18 3300048918 Ga0496115_0136806 Ga0496115_0136806_883_1569 223
19 3300049586 Ga0501070_0067911 Ga0501070_0067911_336_1034 226
20 3300049744 Ga0501083_0124845 Ga0501083_0124845_623_1321 226
21 3300006178 Ga0075367_10253436 Ga0075367_102534362 227
22 3300026116 Ga0207674_10333838 Ga0207674_103338381 228
23 3300049581 Ga0501047_0567621 Ga0501047_0567621_58_912 228
24 3300049822 Ga0501035_0007590 Ga0501035_0007590_3878_4732 228
25 3300049822 Ga0501035_0147312 Ga0501035_0147312_104_961 228
26 3300049823 Ga0501044_0092878 Ga0501044_0092878_1929_2786 228
27 3300005937 Ga0081455_10003276 Ga0081455_1000327619 229
28 3300025302 Ga0207426_1011052 Ga0207426_10110524 229
29 3300046557 Ga0495622_0066879 Ga0495622_0066879_29_730 230
30 3300047445 Ga0495677_0118003 Ga0495677_0118003_90_878 230
31 iso_pu_bacteria 2908756301 2908762687 230
32 3300049571 Ga0501034_0217799 Ga0501034_0217799_704_1495 232
33 3300049580 Ga0501046_0003677 Ga0501046_0003677_6845_7849 232
34 3300049581 Ga0501047_0026175 Ga0501047_0026175_2582_3367 232
35 3300049581 Ga0501047_0174020 Ga0501047_0174020_1086_1877 232
36 3300049823 Ga0501044_0043783 Ga0501044_0043783_2249_3040 232
37 3300005563 Ga0068855_100597241 Ga0068855_1005972412 233
38 3300046455 Ga0495603_0006242 Ga0495603_0006242_3371_4084 234
39 3300046492 Ga0495585_0010445 Ga0495585_0010445_1821_2534 234
40 3300046499 Ga0495594_0382935 Ga0495594_0382935_59_772 234
41 3300046519 Ga0495632_0086070 Ga0495632_0086070_626_1339 234
42 3300046523 Ga0495644_0043479 Ga0495644_0043479_847_1560 234
43 3300046525 Ga0495663_0016058 Ga0495663_0016058_1050_1763 234
44 3300046537 Ga0495598_0002430 Ga0495598_0002430_28_741 234
45 3300046539 Ga0495621_0002024 Ga0495621_0002024_1473_2186 234
46 3300046615 Ga0495656_0001667 Ga0495656_0001667_3633_4346 234
47 3300046616 Ga0495668_0098148 Ga0495668_0098148_426_1139 234
48 3300046648 Ga0495611_0252033 Ga0495611_0252033_59_772 234
49 3300046664 Ga0495659_0062585 Ga0495659_0062585_322_1035 234
50 3300046665 Ga0495661_0087583 Ga0495661_0087583_101_814 234
51 3300046684 Ga0495669_0028262 Ga0495669_0028262_422_1135 234
52 3300046691 Ga0495670_0025194 Ga0495670_0025194_1808_2521 234
53 3300047445 Ga0495677_0098561 Ga0495677_0098561_59_772 234
54 3300047470 Ga0495681_0090787 Ga0495681_0090787_316_1029 234
55 3300014326 Ga0157380_10125417 Ga0157380_101254172 235
56 3300035113 Ga0373936_0263277 Ga0373936_0263277_37_744 235
57 3300049574 Ga0501038_0091090 Ga0501038_0091090_68_889 236
58 3300060353 Ga0501082_0066334 Ga0501082_0066334_36_821 237
59 3300049569 Ga0501032_0000088 Ga0501032_0000088_73913_74713 239
60 3300049569 Ga0501032_0203270 Ga0501032_0203270_457_1278 239
61 3300049570 Ga0501033_0059478 Ga0501033_0059478_582_1403 239
62 3300049571 Ga0501034_0001025 Ga0501034_0001025_36147_36923 240
63 3300049571 Ga0501034_0310016 Ga0501034_0310016_750_1475 240
64 3300049572 Ga0501036_0001583 Ga0501036_0001583_13935_14711 240
65 3300049573 Ga0501037_0386582 Ga0501037_0386582_42_767 240
66 3300049579 Ga0501043_0001947 Ga0501043_0001947_14291_15067 240
67 3300049581 Ga0501047_0000314 Ga0501047_0000314_51908_52684 240
68 3300049586 Ga0501070_0003458 Ga0501070_0003458_10430_11206 240
69 3300049590 Ga0501074_0032290 Ga0501074_0032290_771_1547 240
70 3300049742 Ga0501080_0000240 Ga0501080_0000240_3199_3975 240
71 3300049744 Ga0501083_0006193 Ga0501083_0006193_5260_6036 240
72 3300049823 Ga0501044_0000565 Ga0501044_0000565_40437_41213 240
73 3300049823 Ga0501044_0084633 Ga0501044_0084633_37_762 240
74 3300013105 Ga0157369_10196208 Ga0157369_101962082 241
75 3300049586 Ga0501070_0026604 Ga0501070_0026604_754_1536 242
76 3300060353 Ga0501082_0009544 Ga0501082_0009544_1620_2402 242
77 3300025981 Ga0207640_10088833 Ga0207640_100888332 244
78 3300049569 Ga0501032_0013734 Ga0501032_0013734_3424_4224 244
79 3300049570 Ga0501033_0021686 Ga0501033_0021686_107_907 244
80 3300049572 Ga0501036_0009356 Ga0501036_0009356_4000_4800 244
81 3300049574 Ga0501038_0032935 Ga0501038_0032935_2709_3509 244
82 3300049575 Ga0501039_0015979 Ga0501039_0015979_1652_2452 244
83 3300049578 Ga0501042_0047003 Ga0501042_0047003_1639_2439 244
84 3300049579 Ga0501043_0003962 Ga0501043_0003962_5058_5858 244
85 3300049580 Ga0501046_0006834 Ga0501046_0006834_5265_6065 244
86 3300049581 Ga0501047_0005674 Ga0501047_0005674_3815_4615 244
87 3300049583 Ga0501067_0002302 Ga0501067_0002302_5866_6666 244
88 3300049584 Ga0501068_0036603 Ga0501068_0036603_107_907 244
89 3300049585 Ga0501069_0121723 Ga0501069_0121723_235_1035 244
90 3300049586 Ga0501070_0002456 Ga0501070_0002456_9613_10413 244
91 3300049587 Ga0501071_0000531 Ga0501071_0000531_15384_16184 244
92 3300049589 Ga0501073_0029708 Ga0501073_0029708_2999_3799 244
93 3300049590 Ga0501074_0008112 Ga0501074_0008112_3995_4795 244
94 3300049591 Ga0501075_0085956 Ga0501075_0085956_429_1229 244
95 3300049592 Ga0501076_0011296 Ga0501076_0011296_2377_3177 244
96 3300049741 Ga0501079_0001610 Ga0501079_0001610_5650_6450 244
97 3300049742 Ga0501080_0025121 Ga0501080_0025121_4086_4886 244
98 3300049743 Ga0501081_0159565 Ga0501081_0159565_447_1247 244
99 3300049744 Ga0501083_0042951 Ga0501083_0042951_107_907 244
100 3300049822 Ga0501035_0008383 Ga0501035_0008383_3687_4487 244
101 3300049823 Ga0501044_0006032 Ga0501044_0006032_11520_12320 244
102 3300054114 Ga0501084_0006160 Ga0501084_0006160_7413_8213 244
103 3300048918 Ga0496115_0058740 Ga0496115_0058740_2344_3084 245
104 3300014497 Ga0182008_10098832 Ga0182008_100988322 246
105 3300049571 Ga0501034_0088735 Ga0501034_0088735_694_1446 246
106 3300049742 Ga0501080_0744871 Ga0501080_0744871_17_757 246
107 3300005434 Ga0070709_10130368 Ga0070709_101303682 247
108 3300006175 Ga0070712_100211912 Ga0070712_1002119122 247
109 3300025905 Ga0207685_10105603 Ga0207685_101056032 247
110 3300025906 Ga0207699_10066295 Ga0207699_100662952 247
111 3300025915 Ga0207693_10022650 Ga0207693_100226504 247
112 3300025939 Ga0207665_10051754 Ga0207665_100517542 247
113 3300005983 Ga0081540_1000136 Ga0081540_100013617 248
114 3300037312 Ga0395899_0215959 Ga0395899_0215959_301_1110 248
115 3300037418 Ga0395900_0388312 Ga0395900_0388312_423_1232 248
116 3300049581 Ga0501047_0000347 Ga0501047_0000347_30817_31599 248
117 3300049823 Ga0501044_0118146 Ga0501044_0118146_943_1725 248
118 3300005436 Ga0070713_100318468 Ga0070713_1003184681 249
119 3300006163 Ga0070715_10011164 Ga0070715_100111641 249
120 3300006173 Ga0070716_100055318 Ga0070716_1000553183 249
121 3300025939 Ga0207665_10010418 Ga0207665_100104183 249
122 3300049572 Ga0501036_0168957 Ga0501036_0168957_631_1452 250
123 3300049573 Ga0501037_0086171 Ga0501037_0086171_77_850 250
124 3300049822 Ga0501035_0175562 Ga0501035_0175562_704_1525 250
125 3300053153 Ga0500616_0014213 Ga0500616_0014213_982_1767 250
126 3300009094 Ga0111539_10000051 Ga0111539_1000005134 253
127 3300046476 Ga0495662_0081371 Ga0495662_0081371_69_854 253
128 3300046499 Ga0495594_0089049 Ga0495594_0089049_627_1412 253
129 3300046524 Ga0495648_0023613 Ga0495648_0023613_2914_3702 253
130 3300050511 nmdc:mga08y16_26_c1 nmdc:mga08y16_26_c1_204184_204948 253
131 3300050515 nmdc:mga0a205_334054_c1 nmdc:mga0a205_334054_c1_10_774 253
132 3300005434 Ga0070709_10432242 Ga0070709_104322422 254
133 3300005437 Ga0070710_10008797 Ga0070710_100087976 254
134 3300025915 Ga0207693_10029350 Ga0207693_100293502 254
135 3300049571 Ga0501034_0390270 Ga0501034_0390270_321_1211 254
136 3300009148 Ga0105243_10042049 Ga0105243_100420495 255
137 3300009553 Ga0105249_10383326 Ga0105249_103833262 255
138 3300014326 Ga0157380_10017684 Ga0157380_100176843 255
139 3300025935 Ga0207709_10119277 Ga0207709_101192771 255
140 3300025961 Ga0207712_10253291 Ga0207712_102532912 255
141 iso_pu_bacteria 2508501122 2509108763 255
142 iso_pu_bacteria 2513237098 2513674301 256
143 iso_pu_bacteria 2791355123 2792747689 256
144 iso_pu_bacteria 2935684952 2935694071 256
145 iso_pu_bacteria 2935713505 2935722610 256
146 iso_pu_bacteria 2935722832 2935731959 256
147 iso_pu_bacteria 2935732158 2935741288 256
148 iso_pu_bacteria 2935741537 2935750663 256
149 iso_pu_bacteria 2935750917 2935760138 256
150 iso_pu_bacteria 2940556831 2940566003 256
151 iso_pu_bacteria 8006933436 8006942463 256
152 iso_pu_bacteria 8006973647 8006982190 256
153 iso_pu_bacteria 8056681323 8056685931 256
154 iso_pu_bacteria 2643221733 2644728983 257
155 iso_pu_bacteria 2909042592 2909046161 258
156 3300005340 Ga0070689_100239787 Ga0070689_1002397872 259
157 3300005353 Ga0070669_100132504 Ga0070669_1001325042 259
158 3300005441 Ga0070700_100043320 Ga0070700_1000433202 259
159 3300005617 Ga0068859_100215041 Ga0068859_1002150412 259
160 3300005840 Ga0068870_10206891 Ga0068870_102068913 259
161 3300006931 Ga0097620_100215045 Ga0097620_1002150452 259
162 3300009177 Ga0105248_10634072 Ga0105248_106340723 259
163 3300009988 Ga0105035_105180 Ga0105035_1051801 259
164 3300025923 Ga0207681_10177079 Ga0207681_101770792 259
165 3300025926 Ga0207659_10054295 Ga0207659_100542951 259
166 3300049581 Ga0501047_0179446 Ga0501047_0179446_292_1074 259
167 3300049822 Ga0501035_0254093 Ga0501035_0254093_469_1266 259
168 3300049823 Ga0501044_0000084 Ga0501044_0000084_73250_74032 259
169 3300049823 Ga0501044_0226937 Ga0501044_0226937_1017_1802 259
170 iso_pu_bacteria 2903768456 2903769985 259
171 3300002067 JGI24735J21928_10000166 JGI24735J21928_1000016612 260
172 3300003203 JGI25406J46586_10020594 JGI25406J46586_100205941 260
173 3300003320 rootH2_10037747 rootH2_100377474 260
174 3300003771 Ga0055526_1001740 Ga0055526_10017405 260
175 3300003775 Ga0055524_1000278 Ga0055524_10002786 260
176 3300003790 Ga0055528_1011628 Ga0055528_10116282 260
177 3300003911 JGI25405J52794_10006850 JGI25405J52794_100068503 260
178 3300005327 Ga0070658_10014346 Ga0070658_100143464 260
179 3300005327 Ga0070658_10060208 Ga0070658_100602082 260
180 3300005329 Ga0070683_100003600 Ga0070683_10000360017 260
181 3300005329 Ga0070683_100249730 Ga0070683_1002497303 260
182 3300005330 Ga0070690_100340433 Ga0070690_1003404331 260
183 3300005336 Ga0070680_100003772 Ga0070680_1000037727 260
184 3300005336 Ga0070680_100016951 Ga0070680_1000169516 260
185 3300005336 Ga0070680_100091525 Ga0070680_1000915252 260
186 3300005336 Ga0070680_100105360 Ga0070680_1001053603 260
187 3300005336 Ga0070680_100352196 Ga0070680_1003521963 260
188 3300005339 Ga0070660_100059083 Ga0070660_1000590833 260
189 3300005339 Ga0070660_100120430 Ga0070660_1001204302 260
190 3300005341 Ga0070691_10015217 Ga0070691_100152172 260
191 3300005353 Ga0070669_100059993 Ga0070669_1000599932 260
192 3300005355 Ga0070671_100084899 Ga0070671_1000848991 260
193 3300005356 Ga0070674_100005086 Ga0070674_1000050863 260
194 3300005356 Ga0070674_100006661 Ga0070674_1000066612 260
195 3300005364 Ga0070673_100320033 Ga0070673_1003200332 260
196 3300005366 Ga0070659_100046904 Ga0070659_1000469043 260
197 3300005434 Ga0070709_10537841 Ga0070709_105378411 260
198 3300005441 Ga0070700_100025537 Ga0070700_1000255375 260
199 3300005444 Ga0070694_100093472 Ga0070694_1000934722 260
200 3300005444 Ga0070694_100414366 Ga0070694_1004143661 260
201 3300005455 Ga0070663_100013179 Ga0070663_1000131795 260
202 3300005455 Ga0070663_100192632 Ga0070663_1001926323 260
203 3300005458 Ga0070681_10010245 Ga0070681_100102456 260
204 3300005458 Ga0070681_10017960 Ga0070681_100179608 260
205 3300005458 Ga0070681_10025609 Ga0070681_100256096 260
206 3300005458 Ga0070681_10091247 Ga0070681_100912473 260
207 3300005458 Ga0070681_10099552 Ga0070681_100995522 260
208 3300005530 Ga0070679_100020866 Ga0070679_1000208666 260
209 3300005530 Ga0070679_100026016 Ga0070679_1000260166 260
210 3300005530 Ga0070679_100050484 Ga0070679_1000504841 260
211 3300005530 Ga0070679_100100921 Ga0070679_1001009214 260
212 3300005530 Ga0070679_100398642 Ga0070679_1003986422 260
213 3300005535 Ga0070684_100022719 Ga0070684_1000227196 260
214 3300005535 Ga0070684_100133733 Ga0070684_1001337333 260
215 3300005539 Ga0068853_100079732 Ga0068853_1000797322 260
216 3300005539 Ga0068853_100159247 Ga0068853_1001592472 260
217 3300005546 Ga0070696_100022913 Ga0070696_1000229135 260
218 3300005547 Ga0070693_100006909 Ga0070693_1000069092 260
219 3300005548 Ga0070665_100019248 Ga0070665_1000192485 260
220 3300005548 Ga0070665_100084679 Ga0070665_1000846792 260
221 3300005549 Ga0070704_100124816 Ga0070704_1001248162 260
222 3300005563 Ga0068855_100032721 Ga0068855_1000327218 260
223 3300005563 Ga0068855_100080550 Ga0068855_1000805502 260
224 3300005563 Ga0068855_100512511 Ga0068855_1005125112 260
225 3300005577 Ga0068857_100043275 Ga0068857_1000432753 260
226 3300005577 Ga0068857_100203508 Ga0068857_1002035084 260
227 3300005614 Ga0068856_100221996 Ga0068856_1002219963 260
228 3300005615 Ga0070702_100098481 Ga0070702_1000984812 260
229 3300005616 Ga0068852_100060965 Ga0068852_1000609653 260
230 3300005617 Ga0068859_100624239 Ga0068859_1006242391 260
231 3300005618 Ga0068864_100047954 Ga0068864_1000479543 260
232 3300005842 Ga0068858_100076376 Ga0068858_1000763764 260
233 3300005843 Ga0068860_100083500 Ga0068860_1000835005 260
234 3300005844 Ga0068862_100013789 Ga0068862_1000137892 260
235 3300005937 Ga0081455_10002931 Ga0081455_1000293110 260
236 3300005937 Ga0081455_10020346 Ga0081455_100203463 260
237 3300005937 Ga0081455_10023516 Ga0081455_100235165 260
238 3300005983 Ga0081540_1016291 Ga0081540_10162916 260
239 3300005983 Ga0081540_1025790 Ga0081540_10257902 260
240 3300005985 Ga0081539_10002021 Ga0081539_1000202123 260
241 3300006058 Ga0075432_10002788 Ga0075432_100027882 260
242 3300006186 Ga0075369_10032020 Ga0075369_100320204 260
243 3300006186 Ga0075369_10137732 Ga0075369_101377322 260
244 3300006186 Ga0075369_10138388 Ga0075369_101383882 260
245 3300006194 Ga0075427_10000097 Ga0075427_100000978 260
246 3300006358 Ga0068871_100227755 Ga0068871_1002277552 260
247 3300006844 Ga0075428_100013088 Ga0075428_1000130883 260
248 3300006844 Ga0075428_100018039 Ga0075428_1000180393 260
249 3300006846 Ga0075430_100002416 Ga0075430_1000024168 260
250 3300006846 Ga0075430_100030969 Ga0075430_1000309693 260
251 3300006847 Ga0075431_100000251 Ga0075431_1000002516 260
252 3300006847 Ga0075431_100005932 Ga0075431_1000059323 260
253 3300006852 Ga0075433_10001944 Ga0075433_1000194411 260
254 3300006871 Ga0075434_100000735 Ga0075434_1000007357 260
255 3300006880 Ga0075429_100002109 Ga0075429_10000210910 260
256 3300006880 Ga0075429_100004142 Ga0075429_1000041429 260
257 3300006881 Ga0068865_100332874 Ga0068865_1003328742 260
258 3300006931 Ga0097620_100624291 Ga0097620_1006242911 260
259 3300007076 Ga0075435_100000696 Ga0075435_1000006967 260
260 3300009094 Ga0111539_10000930 Ga0111539_1000093020 260
261 3300009094 Ga0111539_10008602 Ga0111539_1000860210 260
262 3300009147 Ga0114129_10001487 Ga0114129_1000148710 260
263 3300009147 Ga0114129_10009304 Ga0114129_1000930411 260
264 3300009148 Ga0105243_10095271 Ga0105243_100952712 260
265 3300009148 Ga0105243_10602706 Ga0105243_106027061 260
266 3300009174 Ga0105241_10011285 Ga0105241_100112855 260
267 3300009545 Ga0105237_10025096 Ga0105237_100250968 260
268 3300009545 Ga0105237_10032441 Ga0105237_100324413 260
269 3300009551 Ga0105238_10083721 Ga0105238_100837211 260
270 3300009551 Ga0105238_10168775 Ga0105238_101687752 260
271 3300009551 Ga0105238_10308818 Ga0105238_103088184 260
272 3300009993 Ga0105028_103044 Ga0105028_1030442 260
273 3300010375 Ga0105239_10161104 Ga0105239_101611042 260
274 3300013100 Ga0157373_10075358 Ga0157373_100753582 260
275 3300013100 Ga0157373_10106696 Ga0157373_101066961 260
276 3300013102 Ga0157371_10283082 Ga0157371_102830822 260
277 3300013105 Ga0157369_10186616 Ga0157369_101866162 260
278 3300013105 Ga0157369_10615913 Ga0157369_106159132 260
279 3300013296 Ga0157374_10003630 Ga0157374_1000363016 260
280 3300013306 Ga0163162_10540994 Ga0163162_105409942 260
281 3300013307 Ga0157372_10158029 Ga0157372_101580292 260
282 3300013308 Ga0157375_10045904 Ga0157375_100459043 260
283 3300014326 Ga0157380_10020957 Ga0157380_100209575 260
284 3300014969 Ga0157376_10398929 Ga0157376_103989292 260
285 3300017792 Ga0163161_10234862 Ga0163161_102348621 260
286 3300025273 Ga0209673_1001289 Ga0209673_10012892 260
287 3300025291 Ga0209675_1000285 Ga0209675_10002855 260
288 3300025295 Ga0209564_1000017 Ga0209564_1000017398 260
289 3300025295 Ga0209564_1000206 Ga0209564_100020687 260
290 3300025299 Ga0209256_1000133 Ga0209256_1000133110 260
291 3300025899 Ga0207642_10084822 Ga0207642_100848222 260
292 3300025904 Ga0207647_10035503 Ga0207647_100355036 260
293 3300025904 Ga0207647_10046522 Ga0207647_100465222 260
294 3300025904 Ga0207647_10070580 Ga0207647_100705804 260
295 3300025909 Ga0207705_10027871 Ga0207705_100278715 260
296 3300025909 Ga0207705_10079092 Ga0207705_100790922 260
297 3300025909 Ga0207705_10158145 Ga0207705_101581453 260
298 3300025912 Ga0207707_10051385 Ga0207707_100513855 260
299 3300025912 Ga0207707_10055542 Ga0207707_100555425 260
300 3300025912 Ga0207707_10058957 Ga0207707_100589575 260
301 3300025913 Ga0207695_10112225 Ga0207695_101122252 260
302 3300025914 Ga0207671_10018289 Ga0207671_100182895 260
303 3300025917 Ga0207660_10037440 Ga0207660_100374406 260
304 3300025917 Ga0207660_10038539 Ga0207660_100385393 260
305 3300025917 Ga0207660_10163554 Ga0207660_101635543 260
306 3300025919 Ga0207657_10003352 Ga0207657_100033528 260
307 3300025919 Ga0207657_10069148 Ga0207657_100691482 260
308 3300025919 Ga0207657_10071311 Ga0207657_100713113 260
309 3300025919 Ga0207657_10138030 Ga0207657_101380303 260
310 3300025921 Ga0207652_10012632 Ga0207652_100126327 260
311 3300025921 Ga0207652_10045035 Ga0207652_100450355 260
312 3300025921 Ga0207652_10082513 Ga0207652_100825132 260
313 3300025921 Ga0207652_10117406 Ga0207652_101174063 260
314 3300025923 Ga0207681_10144335 Ga0207681_101443353 260
315 3300025924 Ga0207694_10057335 Ga0207694_100573352 260
316 3300025924 Ga0207694_10215942 Ga0207694_102159423 260
317 3300025931 Ga0207644_10060718 Ga0207644_100607181 260
318 3300025932 Ga0207690_10018147 Ga0207690_100181476 260
319 3300025932 Ga0207690_10201680 Ga0207690_102016801 260
320 3300025937 Ga0207669_10016058 Ga0207669_100160582 260
321 3300025938 Ga0207704_10321501 Ga0207704_103215011 260
322 3300025940 Ga0207691_10187155 Ga0207691_101871552 260
323 3300025941 Ga0207711_10463027 Ga0207711_104630272 260
324 3300025944 Ga0207661_10041197 Ga0207661_100411975 260
325 3300025949 Ga0207667_10054232 Ga0207667_100542322 260
326 3300025949 Ga0207667_10211388 Ga0207667_102113884 260
327 3300025960 Ga0207651_10108770 Ga0207651_101087702 260
328 3300025981 Ga0207640_10180110 Ga0207640_101801102 260
329 3300026041 Ga0207639_10007560 Ga0207639_100075607 260
330 3300026041 Ga0207639_10162636 Ga0207639_101626363 260
331 3300026067 Ga0207678_10000595 Ga0207678_1000059511 260
332 3300026067 Ga0207678_10083550 Ga0207678_100835503 260
333 3300026078 Ga0207702_10402092 Ga0207702_104020923 260
334 3300026089 Ga0207648_10196341 Ga0207648_101963412 260
335 3300026095 Ga0207676_10045068 Ga0207676_100450683 260
336 3300026116 Ga0207674_10083437 Ga0207674_100834373 260
337 3300027907 Ga0207428_10000016 Ga0207428_1000001619 260
338 3300027907 Ga0207428_10000322 Ga0207428_1000032234 260
339 3300027907 Ga0207428_10036638 Ga0207428_100366382 260
340 3300028379 Ga0268266_10070015 Ga0268266_100700152 260
341 3300028380 Ga0268265_10020698 Ga0268265_100206982 260
342 3300028381 Ga0268264_10065942 Ga0268264_100659422 260
343 3300031711 Ga0265314_10063171 Ga0265314_100631715 260
344 3300031712 Ga0265342_10000717 Ga0265342_1000071736 260
345 3300037312 Ga0395899_0005148 Ga0395899_0005148_3267_4067 260
346 3300037418 Ga0395900_0014938 Ga0395900_0014938_2407_3261 260
347 3300037418 Ga0395900_0018084 Ga0395900_0018084_3923_4723 260
348 3300037466 Ga0395898_0017181 Ga0395898_0017181_563_1417 260
349 3300037466 Ga0395898_0313929 Ga0395898_0313929_240_1040 260
350 3300038443 Ga0395901_0007302 Ga0395901_0007302_6189_6989 260
351 3300038443 Ga0395901_0080115 Ga0395901_0080115_594_1448 260
352 3300038443 Ga0395901_0686228 Ga0395901_0686228_165_950 260
353 3300046492 Ga0495585_0038850 Ga0495585_0038850_994_1779 260
354 3300046537 Ga0495598_0014559 Ga0495598_0014559_1158_1943 260
355 3300046538 Ga0495609_0111612 Ga0495609_0111612_246_1031 260
356 3300046660 Ga0495625_0007227 Ga0495625_0007227_5632_6444 260
357 3300046664 Ga0495659_0001341 Ga0495659_0001341_5399_6184 260
358 3300046691 Ga0495670_0001984 Ga0495670_0001984_6406_7191 260
359 3300047320 Ga0495672_0023035 Ga0495672_0023035_1218_2024 260
360 3300048903 Ga0496100_0229419 Ga0496100_0229419_48_833 260
361 3300048904 Ga0496101_0016829 Ga0496101_0016829_2601_3386 260
362 3300048905 Ga0496102_0115853 Ga0496102_0115853_1130_1915 260
363 3300048909 Ga0496106_0009208 Ga0496106_0009208_4970_5755 260
364 3300048911 Ga0496108_0438671 Ga0496108_0438671_63_848 260
365 3300048913 Ga0496110_0102329 Ga0496110_0102329_652_1452 260
366 3300049568 Ga0501031_0079580 Ga0501031_0079580_1135_1920 260
367 3300049568 Ga0501031_0081658 Ga0501031_0081658_77_862 260
368 3300049568 Ga0501031_0119502 Ga0501031_0119502_740_1549 260
369 3300049568 Ga0501031_0371922 Ga0501031_0371922_128_910 260
370 3300049569 Ga0501032_0010187 Ga0501032_0010187_3551_4336 260
371 3300049569 Ga0501032_0022595 Ga0501032_0022595_601_1404 260
372 3300049569 Ga0501032_0202238 Ga0501032_0202238_439_1224 260
373 3300049569 Ga0501032_0333220 Ga0501032_0333220_109_912 260
374 3300049569 Ga0501032_0440732 Ga0501032_0440732_29_823 260
375 3300049570 Ga0501033_0012549 Ga0501033_0012549_2669_3472 260
376 3300049570 Ga0501033_0052224 Ga0501033_0052224_1978_2763 260
377 3300049571 Ga0501034_0009514 Ga0501034_0009514_2961_3746 260
378 3300049571 Ga0501034_0023476 Ga0501034_0023476_5314_6099 260
379 3300049571 Ga0501034_0032696 Ga0501034_0032696_2950_3732 260
380 3300049571 Ga0501034_0125719 Ga0501034_0125719_1570_2433 260
381 3300049571 Ga0501034_0134576 Ga0501034_0134576_255_1058 260
382 3300049571 Ga0501034_0177083 Ga0501034_0177083_519_1322 260
383 3300049571 Ga0501034_0464370 Ga0501034_0464370_367_1152 260
384 3300049572 Ga0501036_0002162 Ga0501036_0002162_1990_2775 260
385 3300049572 Ga0501036_0034806 Ga0501036_0034806_2489_3274 260
386 3300049572 Ga0501036_0365744 Ga0501036_0365744_344_1147 260
387 3300049572 Ga0501036_0366531 Ga0501036_0366531_228_1013 260
388 3300049573 Ga0501037_0011718 Ga0501037_0011718_2654_3439 260
389 3300049573 Ga0501037_0066608 Ga0501037_0066608_1240_2025 260
390 3300049573 Ga0501037_0069521 Ga0501037_0069521_51_836 260
391 3300049573 Ga0501037_0127836 Ga0501037_0127836_593_1396 260
392 3300049574 Ga0501038_0047080 Ga0501038_0047080_1560_2345 260
393 3300049574 Ga0501038_0066828 Ga0501038_0066828_684_1487 260
394 3300049574 Ga0501038_0135475 Ga0501038_0135475_221_1006 260
395 3300049575 Ga0501039_0006642 Ga0501039_0006642_1990_2775 260
396 3300049575 Ga0501039_0092276 Ga0501039_0092276_611_1414 260
397 3300049575 Ga0501039_0402516 Ga0501039_0402516_243_1055 260
398 3300049578 Ga0501042_0016185 Ga0501042_0016185_87_872 260
399 3300049579 Ga0501043_0025661 Ga0501043_0025661_1702_2487 260
400 3300049579 Ga0501043_0045010 Ga0501043_0045010_41_826 260
401 3300049579 Ga0501043_0232101 Ga0501043_0232101_271_1089 260
402 3300049580 Ga0501046_0041616 Ga0501046_0041616_1031_1816 260
403 3300049581 Ga0501047_0030752 Ga0501047_0030752_1698_2483 260
404 3300049581 Ga0501047_0042681 Ga0501047_0042681_908_1699 260
405 3300049581 Ga0501047_0052194 Ga0501047_0052194_2128_2913 260
406 3300049581 Ga0501047_0097247 Ga0501047_0097247_1156_1956 260
407 3300049581 Ga0501047_0145932 Ga0501047_0145932_933_1736 260
408 3300049581 Ga0501047_0153146 Ga0501047_0153146_801_1619 260
409 3300049581 Ga0501047_0167681 Ga0501047_0167681_851_1636 260
410 3300049581 Ga0501047_0345157 Ga0501047_0345157_244_1062 260
411 3300049581 Ga0501047_0439786 Ga0501047_0439786_153_944 260
412 3300049582 Ga0501048_0004586 Ga0501048_0004586_4115_4900 260
413 3300049583 Ga0501067_0010373 Ga0501067_0010373_2872_3657 260
414 3300049583 Ga0501067_0045165 Ga0501067_0045165_1200_1985 260
415 3300049583 Ga0501067_0082853 Ga0501067_0082853_853_1653 260
416 3300049584 Ga0501068_0001004 Ga0501068_0001004_1676_2476 260
417 3300049584 Ga0501068_0010693 Ga0501068_0010693_2431_3216 260
418 3300049584 Ga0501068_0014408 Ga0501068_0014408_2622_3422 260
419 3300049585 Ga0501069_0003270 Ga0501069_0003270_2564_3349 260
420 3300049585 Ga0501069_0030841 Ga0501069_0030841_552_1349 260
421 3300049585 Ga0501069_0050400 Ga0501069_0050400_1112_1918 260
422 3300049585 Ga0501069_0123399 Ga0501069_0123399_269_1069 260
423 3300049586 Ga0501070_0017208 Ga0501070_0017208_2835_3620 260
424 3300049586 Ga0501070_0036013 Ga0501070_0036013_293_1111 260
425 3300049586 Ga0501070_0049764 Ga0501070_0049764_1198_1998 260
426 3300049587 Ga0501071_0006157 Ga0501071_0006157_122_907 260
427 3300049588 Ga0501072_0028980 Ga0501072_0028980_1169_1951 260
428 3300049588 Ga0501072_0315028 Ga0501072_0315028_429_1229 260
429 3300049588 Ga0501072_0322472 Ga0501072_0322472_250_1044 260
430 3300049589 Ga0501073_0005130 Ga0501073_0005130_1977_2762 260
431 3300049589 Ga0501073_0076716 Ga0501073_0076716_1202_1987 260
432 3300049589 Ga0501073_0437655 Ga0501073_0437655_17_817 260
433 3300049590 Ga0501074_0015123 Ga0501074_0015123_1978_2763 260
434 3300049590 Ga0501074_0020517 Ga0501074_0020517_1188_1988 260
435 3300049742 Ga0501080_0024265 Ga0501080_0024265_1990_2775 260
436 3300049742 Ga0501080_0039674 Ga0501080_0039674_330_1130 260
437 3300049742 Ga0501080_0068143 Ga0501080_0068143_41_826 260
438 3300049744 Ga0501083_0010177 Ga0501083_0010177_1442_2227 260
439 3300049744 Ga0501083_0383573 Ga0501083_0383573_64_867 260
440 3300049822 Ga0501035_0038073 Ga0501035_0038073_267_1052 260
441 3300049822 Ga0501035_0386643 Ga0501035_0386643_233_1027 260
442 3300049823 Ga0501044_0002073 Ga0501044_0002073_14645_15430 260
443 3300049823 Ga0501044_0047317 Ga0501044_0047317_1039_1824 260
444 3300049823 Ga0501044_0051432 Ga0501044_0051432_319_1104 260
445 3300049823 Ga0501044_0078196 Ga0501044_0078196_2513_3331 260
446 3300049823 Ga0501044_0089372 Ga0501044_0089372_1287_2150 260
447 3300049823 Ga0501044_0220406 Ga0501044_0220406_488_1273 260
448 3300049823 Ga0501044_0288064 Ga0501044_0288064_577_1380 260
449 3300049823 Ga0501044_0368252 Ga0501044_0368252_533_1318 260
450 3300049823 Ga0501044_0561725 Ga0501044_0561725_75_860 260
451 3300049823 Ga0501044_0729682 Ga0501044_0729682_47_832 260
452 3300049824 Ga0501045_0007068 Ga0501045_0007068_5711_6496 260
453 3300050490 nmdc:mga03n38_91806_c1 nmdc:mga03n38_91806_c1_286_1080 260
454 3300050492 nmdc:mga0yw44_162373_c1 nmdc:mga0yw44_162373_c1_416_1204 260
455 3300050492 nmdc:mga0yw44_47932_c1 nmdc:mga0yw44_47932_c1_1247_2035 260
456 3300050507 nmdc:mga05p37_1239_c1 nmdc:mga05p37_1239_c1_24524_25309 260
457 3300050507 nmdc:mga05p37_213_c1 nmdc:mga05p37_213_c1_8435_9220 260
458 3300050508 nmdc:mga09592_3152_c1 nmdc:mga09592_3152_c1_9256_10041 260
459 3300050508 nmdc:mga09592_5003_c1 nmdc:mga09592_5003_c1_5514_6299 260
460 3300050509 nmdc:mga0qj67_15592_c1 nmdc:mga0qj67_15592_c1_4631_5416 260
461 3300050509 nmdc:mga0qj67_7072_c1 nmdc:mga0qj67_7072_c1_125_910 260
462 3300050510 nmdc:mga06r32_4393_c1 nmdc:mga06r32_4393_c1_2309_3094 260
463 3300050510 nmdc:mga06r32_571_c1 nmdc:mga06r32_571_c1_21202_21987 260
464 3300050511 nmdc:mga08y16_5337_c1 nmdc:mga08y16_5337_c1_2854_3639 260
465 3300050511 nmdc:mga08y16_6730_c1 nmdc:mga08y16_6730_c1_3900_4685 260
466 3300050512 nmdc:mga0n895_1733_c1 nmdc:mga0n895_1733_c1_11805_12590 260
467 3300050513 nmdc:mga0rr50_1133_c1 nmdc:mga0rr50_1133_c1_12637_13422 260
468 3300050515 nmdc:mga0a205_1982_c1 nmdc:mga0a205_1982_c1_7578_8363 260
469 3300050516 nmdc:mga0sz30_100177_c1 nmdc:mga0sz30_100177_c1_231_1016 260
470 3300050516 nmdc:mga0sz30_166930_c1 nmdc:mga0sz30_166930_c1_133_918 260
471 3300050516 nmdc:mga0sz30_25000_c1 nmdc:mga0sz30_25000_c1_345_1133 260
472 3300053086 Ga0500578_0028212 Ga0500578_0028212_674_1468 260
473 3300053093 Ga0500651_0152448 Ga0500651_0152448_425_1219 260
474 3300053096 Ga0500641_0000482 Ga0500641_0000482_7271_8059 260
475 3300053096 Ga0500641_0043876 Ga0500641_0043876_322_1116 260
476 3300053146 Ga0500588_0000536 Ga0500588_0000536_225_1019 260
477 3300053151 Ga0500604_0055819 Ga0500604_0055819_89_901 260
478 3300053153 Ga0500616_0000888 Ga0500616_0000888_13683_14477 260
479 3300053731 Ga0500609_003907 Ga0500609_003907_905_1699 260
480 3300054114 Ga0501084_0011858 Ga0501084_0011858_6062_6847 260
481 3300054114 Ga0501084_0256640 Ga0501084_0256640_29_811 260
482 3300060353 Ga0501082_0000183 Ga0501082_0000183_40368_41153 260
483 3300060353 Ga0501082_0043102 Ga0501082_0043102_804_1589 260
484 iso_pu_bacteria 2643221651 2644288962 260
485 iso_pu_bacteria 2938014810 2938017800 260

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09955

DUF2189

Predicted integral membrane protein (DUF2189)

72

196

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6d9z-assembly1.cif.gz_B structure of cysz, a sulfate permease from pseudomonas denitrificans 0.5111 29 257
6d9z-assembly1.cif.gz_B structure of cysz, a sulfate permease from pseudomonas denitrificans 0.4973 29 257
7wwb-assembly1.cif.gz_B choline transporter-like protein 1 0.459 43 259
5vox-assembly1.cif.gz_W yeast v-atpase in complex with legionella pneumophila effector sidk (rotational state 1) 0.4319 72 224
5vox-assembly1.cif.gz_W yeast v-atpase in complex with legionella pneumophila effector sidk (rotational state 1) 0.4114 72 224
ID Description Score Start End Superfamily
af_I1KMF2_37_348_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.4858 26 259 1.20.1070.10
af_I1KMF2_37_348_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.4443 26 259 1.20.1070.10
af_P34651_608_792_1.20.120.1900 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Gamma-tubulin complex, C-terminal domain 0.3477 75 219 1.20.120.1900
af_O94344_10_254_1.50.40.10 Mainly Alpha;Alpha/alpha barrel;Mitochondrial carrier fold;Mitochondrial carrier domain 0.3405 15 256 1.50.40.10
af_Q9LV18_10_217_1.20.58.390 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Neurotransmitter-gated ion-channel transmembrane domain 0.3389 25 221 1.20.58.390
ID Description Score Start End GO Terms
AF-A0A5C7LXK7-F1-model_v4 deleted 0.9847 1 260
AF-A0A1H3NZQ1-F1-model_v4 Uncharacterized membrane protein 0.9731 2 260 GO:0016020
AF-A0A3B8XPI4-F1-model_v4 DUF2189 domain-containing protein 0.9728 21 258 GO:0016020
AF-A0A2H5F658-F1-model_v4 DUF2189 domain-containing protein 0.972 18 260 GO:0016020
AF-A0A3M0ZZ04-F1-model_v4 DUF2189 domain-containing protein 0.971 21 258 GO:0016020

Feature Viewer

pLDDT pTM Quality
91.99 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map