F453176
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 485 | 245 | 466 | 258 |
Family's Representative Sequence
| Representative Sequence | 3300049823|Ga0501044_0226937|Ga0501044_0226937_1017_1802 |
| Length | 261 |
| Sequence | MTVIIPAVMPPLRRPNKYARNLPASAGLGWLAAGWRDLKTQPVTSLLYGIAVFAVSLGIVYCLFAFGWDYILFPALAGFMVVGPVIAVGLYEKSRRLAAGKSTSVTDMLFVRTGSGQILFVGVLLCLLMVVWMRAAVIVYALFFGVRPFPGLDHVAAMLFTTTTGWALLVVGTLVGGLFAAFSFAISVFAVPMLLDQKPDAFTAMGTSLALVWHNLPAMLVWGVVVMALIAASLATGMLGLVIVFPLLGHATWHAYEAVRQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501122 | Ensifer yinggardensis WSM1721 | Isolate | Nodule |
| 2 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 3 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 4 | 2643221733 | Bosea sp. Root381 | Isolate | Unclassified |
| 5 | 2791355123 | Mesorhizobium sophorae ICMP 19535 | Isolate | Unclassified |
| 6 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 7 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 8 | 2909042592 | Labrys sp. LIt4 | Isolate | Nodule |
| 9 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 10 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 11 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 12 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 13 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 14 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 15 | 2938014810 | Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 | Isolate | Nodule |
| 16 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 17 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 18 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 19 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 20 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 21 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 22 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 23 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 24 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 46 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 51 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 52 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 53 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 55 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 56 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 57 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 58 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 59 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 60 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 61 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 62 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 63 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 64 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 65 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 69 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 70 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 71 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 72 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 73 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 74 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 75 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 76 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 77 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 78 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 79 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 81 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009988 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG | Metagenome | Rhizosphere |
| 91 | 3300009993 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG | Metagenome | Rhizosphere |
| 92 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 103 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 107 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 108 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 109 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 110 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 146 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 150 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 151 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 152 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 153 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 154 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 155 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 156 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 157 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 181 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 182 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 183 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 184 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 185 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 186 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 187 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 188 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 189 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 190 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 191 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 192 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 193 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 194 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 195 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 196 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 197 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 198 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 199 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 200 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 201 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 202 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 203 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 204 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 205 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 206 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 207 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 208 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 209 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 210 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 211 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 212 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 213 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 214 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 215 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 216 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 217 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 218 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 219 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 220 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 221 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 222 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 223 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 224 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 225 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 226 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 227 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 228 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 229 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 230 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 231 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 232 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 233 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 234 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 235 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 236 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 237 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 238 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 239 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 240 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 241 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 242 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 243 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 244 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 245 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.08 |
| Metatranscriptomes | 0 |
| Isolates | 3.92 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.77 |
| Nodule | 2.89 |
| Rhizoplane | 3.51 |
| Rhizosphere | 86.6 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.24 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24735J21928_10000166 | 3300002067 | Bacteria | 23564 |
| 2 | JGI25406J46586_10020594 | 3300003203 | Bacteria | 2664 |
| 3 | rootH2_10037747 | 3300003320 | Bacteria | 6000 |
| 4 | Ga0055526_1001740 | 3300003771 | Bacteria | 15126 |
| 5 | Ga0055524_1000278 | 3300003775 | Bacteria | 50903 |
| 6 | Ga0055528_1011628 | 3300003790 | Bacteria | 3478 |
| 7 | JGI25405J52794_10006850 | 3300003911 | Bacteria | 2087 |
| 8 | Ga0070658_10014346 | 3300005327 | Bacteria | 6357 |
| 9 | Ga0070658_10060208 | 3300005327 | Bacteria | 3092 |
| 10 | Ga0070683_100003600 | 3300005329 | Bacteria | 12622 |
| 11 | Ga0070683_100249730 | 3300005329 | Bacteria | 1687 |
| 12 | Ga0070690_100340433 | 3300005330 | Bacteria | 1086 |
| 13 | Ga0070680_100003772 | 3300005336 | Bacteria | 11324 |
| 14 | Ga0070680_100016951 | 3300005336 | Bacteria | 5736 |
| 15 | Ga0070680_100091525 | 3300005336 | Bacteria | 2518 |
| 16 | Ga0070680_100105360 | 3300005336 | Bacteria | 2344 |
| 17 | Ga0070680_100352196 | 3300005336 | Bacteria | 1252 |
| 18 | Ga0070660_100059083 | 3300005339 | Bacteria | 2973 |
| 19 | Ga0070660_100120430 | 3300005339 | Bacteria | 2094 |
| 20 | Ga0070689_100239787 | 3300005340 | Bacteria | 1493 |
| 21 | Ga0070691_10015217 | 3300005341 | Bacteria | 3534 |
| 22 | Ga0070669_100059993 | 3300005353 | Bacteria | 2793 |
| 23 | Ga0070669_100132504 | 3300005353 | Bacteria | 1914 |
| 24 | Ga0070671_100084899 | 3300005355 | Bacteria | 2648 |
| 25 | Ga0070674_100005086 | 3300005356 | Bacteria | 7559 |
| 26 | Ga0070674_100006661 | 3300005356 | Bacteria | 6754 |
| 27 | Ga0070673_100320033 | 3300005364 | Bacteria | 1370 |
| 28 | Ga0070659_100046904 | 3300005366 | Bacteria | 3387 |
| 29 | Ga0070709_10130368 | 3300005434 | Bacteria | 1716 |
| 30 | Ga0070709_10432242 | 3300005434 | Bacteria | 989 |
| 31 | Ga0070709_10537841 | 3300005434 | Bacteria | 892 |
| 32 | Ga0070713_100318468 | 3300005436 | Bacteria | 1436 |
| 33 | Ga0070710_10008797 | 3300005437 | Bacteria | 4924 |
| 34 | Ga0070700_100025537 | 3300005441 | Bacteria | 3479 |
| 35 | Ga0070700_100043320 | 3300005441 | Bacteria | 2768 |
| 36 | Ga0070694_100093472 | 3300005444 | Bacteria | 2114 |
| 37 | Ga0070694_100414366 | 3300005444 | Bacteria | 1057 |
| 38 | Ga0070663_100013179 | 3300005455 | Bacteria | 5258 |
| 39 | Ga0070663_100192632 | 3300005455 | Bacteria | 1587 |
| 40 | Ga0070681_10010245 | 3300005458 | Bacteria | 9249 |
| 41 | Ga0070681_10017960 | 3300005458 | Bacteria | 7070 |
| 42 | Ga0070681_10025609 | 3300005458 | Bacteria | 5934 |
| 43 | Ga0070681_10091247 | 3300005458 | Bacteria | 2997 |
| 44 | Ga0070681_10099552 | 3300005458 | Bacteria | 2853 |
| 45 | Ga0070679_100020866 | 3300005530 | Bacteria | 6391 |
| 46 | Ga0070679_100026016 | 3300005530 | Bacteria | 5743 |
| 47 | Ga0070679_100050484 | 3300005530 | Bacteria | 4144 |
| 48 | Ga0070679_100100921 | 3300005530 | Bacteria | 2872 |
| 49 | Ga0070679_100398642 | 3300005530 | Bacteria | 1322 |
| 50 | Ga0070684_100022719 | 3300005535 | Bacteria | 5235 |
| 51 | Ga0070684_100133733 | 3300005535 | Bacteria | 2238 |
| 52 | Ga0068853_100079732 | 3300005539 | Bacteria | 2863 |
| 53 | Ga0068853_100159247 | 3300005539 | Bacteria | 2036 |
| 54 | Ga0070696_100022913 | 3300005546 | Bacteria | 4247 |
| 55 | Ga0070693_100006909 | 3300005547 | Bacteria | 5519 |
| 56 | Ga0070665_100019248 | 3300005548 | Bacteria | 6849 |
| 57 | Ga0070665_100084679 | 3300005548 | Bacteria | 3176 |
| 58 | Ga0070704_100124816 | 3300005549 | Bacteria | 1984 |
| 59 | Ga0068855_100032721 | 3300005563 | Bacteria | 6208 |
| 60 | Ga0068855_100080550 | 3300005563 | Bacteria | 3775 |
| 61 | Ga0068855_100512511 | 3300005563 | Bacteria | 1302 |
| 62 | Ga0068855_100597241 | 3300005563 | Bacteria | 1191 |
| 63 | Ga0068857_100043275 | 3300005577 | Bacteria | 3995 |
| 64 | Ga0068857_100203508 | 3300005577 | Bacteria | 1805 |
| 65 | Ga0068856_100221996 | 3300005614 | Bacteria | 1905 |
| 66 | Ga0070702_100098481 | 3300005615 | Bacteria | 1789 |
| 67 | Ga0068852_100060965 | 3300005616 | Bacteria | 3277 |
| 68 | Ga0068859_100215041 | 3300005617 | Bacteria | 2009 |
| 69 | Ga0068859_100624239 | 3300005617 | Bacteria | 1170 |
| 70 | Ga0068864_100047954 | 3300005618 | Bacteria | 3671 |
| 71 | Ga0068870_10206891 | 3300005840 | Bacteria | 1193 |
| 72 | Ga0068858_100076376 | 3300005842 | Bacteria | 3111 |
| 73 | Ga0068860_100083500 | 3300005843 | Bacteria | 3038 |
| 74 | Ga0068862_100013789 | 3300005844 | Bacteria | 6698 |
| 75 | Ga0081455_10002931 | 3300005937 | Bacteria | 19999 |
| 76 | Ga0081455_10003276 | 3300005937 | Bacteria | 18740 |
| 77 | Ga0081455_10020346 | 3300005937 | Bacteria | 6253 |
| 78 | Ga0081455_10023516 | 3300005937 | Bacteria | 5731 |
| 79 | Ga0081540_1000136 | 3300005983 | Bacteria | 78663 |
| 80 | Ga0081540_1016291 | 3300005983 | Bacteria | 4658 |
| 81 | Ga0081540_1025790 | 3300005983 | Bacteria | 3372 |
| 82 | Ga0081539_10002021 | 3300005985 | Bacteria | 30604 |
| 83 | Ga0075432_10002788 | 3300006058 | Bacteria | 5863 |
| 84 | Ga0070715_10011164 | 3300006163 | Bacteria | 3226 |
| 85 | Ga0070716_100055318 | 3300006173 | Bacteria | 2270 |
| 86 | Ga0070712_100211912 | 3300006175 | Bacteria | 1528 |
| 87 | Ga0075367_10253436 | 3300006178 | Bacteria | 1104 |
| 88 | Ga0075369_10032020 | 3300006186 | Bacteria | 2223 |
| 89 | Ga0075369_10137732 | 3300006186 | Bacteria | 1112 |
| 90 | Ga0075369_10138388 | 3300006186 | Bacteria | 1109 |
| 91 | Ga0075427_10000097 | 3300006194 | Bacteria | 7254 |
| 92 | Ga0068871_100227755 | 3300006358 | Bacteria | 1617 |
| 93 | Ga0075428_100013088 | 3300006844 | Bacteria | 9224 |
| 94 | Ga0075428_100018039 | 3300006844 | Bacteria | 7799 |
| 95 | Ga0075430_100002416 | 3300006846 | Bacteria | 15551 |
| 96 | Ga0075430_100030969 | 3300006846 | Bacteria | 4543 |
| 97 | Ga0075431_100000251 | 3300006847 | Bacteria | 40790 |
| 98 | Ga0075431_100005932 | 3300006847 | Bacteria | 12086 |
| 99 | Ga0075433_10001944 | 3300006852 | Bacteria | 15534 |
| 100 | Ga0075434_100000735 | 3300006871 | Bacteria | 25720 |
| 101 | Ga0075429_100002109 | 3300006880 | Bacteria | 16601 |
| 102 | Ga0075429_100004142 | 3300006880 | Bacteria | 12408 |
| 103 | Ga0068865_100332874 | 3300006881 | Bacteria | 1225 |
| 104 | Ga0097620_100215045 | 3300006931 | Bacteria | 2009 |
| 105 | Ga0097620_100624291 | 3300006931 | Bacteria | 1170 |
| 106 | Ga0075435_100000696 | 3300007076 | Bacteria | 20869 |
| 107 | Ga0111539_10000051 | 3300009094 | Bacteria | 117607 |
| 108 | Ga0111539_10000930 | 3300009094 | Bacteria | 38345 |
| 109 | Ga0111539_10008602 | 3300009094 | Bacteria | 12963 |
| 110 | Ga0105245_10166542 | 3300009098 | Bacteria | 2095 |
| 111 | Ga0114129_10001487 | 3300009147 | Bacteria | 31741 |
| 112 | Ga0114129_10009304 | 3300009147 | Bacteria | 14014 |
| 113 | Ga0105243_10042049 | 3300009148 | Bacteria | 3576 |
| 114 | Ga0105243_10095271 | 3300009148 | Bacteria | 2460 |
| 115 | Ga0105243_10602706 | 3300009148 | Bacteria | 1058 |
| 116 | Ga0105241_10011285 | 3300009174 | Bacteria | 6550 |
| 117 | Ga0105241_10119811 | 3300009174 | Bacteria | 2118 |
| 118 | Ga0105248_10634072 | 3300009177 | Bacteria | 1206 |
| 119 | Ga0105237_10025096 | 3300009545 | Bacteria | 6098 |
| 120 | Ga0105237_10032441 | 3300009545 | Bacteria | 5288 |
| 121 | Ga0105238_10083721 | 3300009551 | Bacteria | 3179 |
| 122 | Ga0105238_10168775 | 3300009551 | Bacteria | 2164 |
| 123 | Ga0105238_10308818 | 3300009551 | Bacteria | 1566 |
| 124 | Ga0105249_10383326 | 3300009553 | Bacteria | 1432 |
| 125 | Ga0105035_105180 | 3300009988 | Bacteria | 1051 |
| 126 | Ga0105028_103044 | 3300009993 | Bacteria | 1757 |
| 127 | Ga0105239_10061779 | 3300010375 | Bacteria | 4112 |
| 128 | Ga0105239_10161104 | 3300010375 | Bacteria | 2506 |
| 129 | Ga0105246_10034073 | 3300011119 | Bacteria | 3389 |
| 130 | Ga0157373_10075358 | 3300013100 | Bacteria | 2380 |
| 131 | Ga0157373_10106696 | 3300013100 | Bacteria | 1969 |
| 132 | Ga0157371_10283082 | 3300013102 | Bacteria | 1198 |
| 133 | Ga0157369_10186616 | 3300013105 | Bacteria | 2180 |
| 134 | Ga0157369_10196208 | 3300013105 | Bacteria | 2120 |
| 135 | Ga0157369_10615913 | 3300013105 | Bacteria | 1120 |
| 136 | Ga0157374_10003630 | 3300013296 | Bacteria | 12977 |
| 137 | Ga0163162_10069528 | 3300013306 | Bacteria | 3573 |
| 138 | Ga0163162_10540994 | 3300013306 | Bacteria | 1293 |
| 139 | Ga0157372_10158029 | 3300013307 | Bacteria | 2619 |
| 140 | Ga0157375_10045904 | 3300013308 | Bacteria | 4255 |
| 141 | Ga0157380_10017684 | 3300014326 | Bacteria | 5280 |
| 142 | Ga0157380_10020957 | 3300014326 | Bacteria | 4896 |
| 143 | Ga0157380_10125417 | 3300014326 | Bacteria | 2181 |
| 144 | Ga0182008_10098832 | 3300014497 | Bacteria | 1441 |
| 145 | Ga0157379_10142514 | 3300014968 | Bacteria | 2160 |
| 146 | Ga0157376_10107997 | 3300014969 | Bacteria | 2444 |
| 147 | Ga0157376_10398929 | 3300014969 | Bacteria | 1329 |
| 148 | Ga0163161_10234862 | 3300017792 | Bacteria | 1424 |
| 149 | Ga0209673_1001289 | 3300025273 | Bacteria | 25599 |
| 150 | Ga0209675_1000285 | 3300025291 | Bacteria | 47895 |
| 151 | Ga0209564_1000017 | 3300025295 | Bacteria | 594063 |
| 152 | Ga0209564_1000206 | 3300025295 | Bacteria | 135849 |
| 153 | Ga0209256_1000133 | 3300025299 | Bacteria | 160303 |
| 154 | Ga0207426_1011052 | 3300025302 | Bacteria | 3464 |
| 155 | Ga0207642_10084822 | 3300025899 | Bacteria | 1548 |
| 156 | Ga0207647_10035503 | 3300025904 | Bacteria | 3177 |
| 157 | Ga0207647_10046522 | 3300025904 | Bacteria | 2703 |
| 158 | Ga0207647_10070580 | 3300025904 | Bacteria | 2109 |
| 159 | Ga0207685_10105603 | 3300025905 | Bacteria | 1212 |
| 160 | Ga0207699_10066295 | 3300025906 | Bacteria | 2191 |
| 161 | Ga0207705_10027871 | 3300025909 | Bacteria | 4028 |
| 162 | Ga0207705_10079092 | 3300025909 | Bacteria | 2394 |
| 163 | Ga0207705_10158145 | 3300025909 | Bacteria | 1701 |
| 164 | Ga0207707_10051385 | 3300025912 | Bacteria | 3589 |
| 165 | Ga0207707_10055542 | 3300025912 | Bacteria | 3445 |
| 166 | Ga0207707_10058957 | 3300025912 | Bacteria | 3340 |
| 167 | Ga0207695_10112225 | 3300025913 | Bacteria | 2704 |
| 168 | Ga0207671_10018289 | 3300025914 | Bacteria | 5379 |
| 169 | Ga0207693_10022650 | 3300025915 | Bacteria | 4990 |
| 170 | Ga0207693_10029350 | 3300025915 | Bacteria | 4345 |
| 171 | Ga0207660_10037440 | 3300025917 | Bacteria | 3380 |
| 172 | Ga0207660_10038539 | 3300025917 | Bacteria | 3337 |
| 173 | Ga0207660_10163554 | 3300025917 | Bacteria | 1719 |
| 174 | Ga0207657_10003352 | 3300025919 | Bacteria | 17135 |
| 175 | Ga0207657_10069148 | 3300025919 | Bacteria | 2997 |
| 176 | Ga0207657_10071311 | 3300025919 | Bacteria | 2942 |
| 177 | Ga0207657_10138030 | 3300025919 | Bacteria | 1994 |
| 178 | Ga0207652_10012632 | 3300025921 | Bacteria | 6826 |
| 179 | Ga0207652_10045035 | 3300025921 | Bacteria | 3760 |
| 180 | Ga0207652_10082513 | 3300025921 | Bacteria | 2813 |
| 181 | Ga0207652_10117406 | 3300025921 | Bacteria | 2364 |
| 182 | Ga0207681_10144335 | 3300025923 | Bacteria | 1776 |
| 183 | Ga0207681_10177079 | 3300025923 | Bacteria | 1621 |
| 184 | Ga0207694_10057335 | 3300025924 | Bacteria | 3028 |
| 185 | Ga0207694_10215942 | 3300025924 | Bacteria | 1563 |
| 186 | Ga0207659_10054295 | 3300025926 | Bacteria | 2861 |
| 187 | Ga0207644_10060718 | 3300025931 | Bacteria | 2736 |
| 188 | Ga0207690_10018147 | 3300025932 | Bacteria | 4312 |
| 189 | Ga0207690_10201680 | 3300025932 | Bacteria | 1511 |
| 190 | Ga0207709_10119277 | 3300025935 | Bacteria | 1778 |
| 191 | Ga0207669_10016058 | 3300025937 | Bacteria | 3793 |
| 192 | Ga0207704_10321501 | 3300025938 | Bacteria | 1194 |
| 193 | Ga0207665_10010418 | 3300025939 | Bacteria | 6106 |
| 194 | Ga0207665_10051754 | 3300025939 | Bacteria | 2765 |
| 195 | Ga0207691_10187155 | 3300025940 | Bacteria | 1807 |
| 196 | Ga0207711_10463027 | 3300025941 | Unclassified | 1181 |
| 197 | Ga0207661_10041197 | 3300025944 | Bacteria | 3634 |
| 198 | Ga0207667_10054232 | 3300025949 | Bacteria | 4217 |
| 199 | Ga0207667_10211388 | 3300025949 | Bacteria | 1988 |
| 200 | Ga0207651_10108770 | 3300025960 | Bacteria | 2076 |
| 201 | Ga0207712_10253291 | 3300025961 | Bacteria | 1424 |
| 202 | Ga0207640_10088833 | 3300025981 | Bacteria | 2135 |
| 203 | Ga0207640_10180110 | 3300025981 | Bacteria | 1584 |
| 204 | Ga0207639_10007560 | 3300026041 | Bacteria | 7412 |
| 205 | Ga0207639_10162636 | 3300026041 | Bacteria | 1883 |
| 206 | Ga0207678_10000595 | 3300026067 | Bacteria | 33105 |
| 207 | Ga0207678_10083550 | 3300026067 | Bacteria | 2731 |
| 208 | Ga0207702_10402092 | 3300026078 | Bacteria | 1321 |
| 209 | Ga0207648_10196341 | 3300026089 | Bacteria | 1789 |
| 210 | Ga0207676_10045068 | 3300026095 | Bacteria | 3406 |
| 211 | Ga0207674_10083437 | 3300026116 | Bacteria | 3195 |
| 212 | Ga0207674_10333838 | 3300026116 | Bacteria | 1466 |
| 213 | Ga0207428_10000016 | 3300027907 | Bacteria | 327690 |
| 214 | Ga0207428_10000322 | 3300027907 | Bacteria | 62220 |
| 215 | Ga0207428_10036638 | 3300027907 | Bacteria | 3999 |
| 216 | Ga0268266_10070015 | 3300028379 | Bacteria | 3041 |
| 217 | Ga0268265_10020698 | 3300028380 | Bacteria | 4596 |
| 218 | Ga0268264_10065942 | 3300028381 | Bacteria | 3052 |
| 219 | Ga0265314_10063171 | 3300031711 | Bacteria | 2513 |
| 220 | Ga0265342_10000717 | 3300031712 | Bacteria | 34273 |
| 221 | Ga0373936_0263277 | 3300035113 | Unclassified | 772 |
| 222 | Ga0373931_0030338 | 3300035691 | Bacteria | 2783 |
| 223 | Ga0395899_0005148 | 3300037312 | Bacteria | 10171 |
| 224 | Ga0395899_0215959 | 3300037312 | Bacteria | 1330 |
| 225 | Ga0395900_0014938 | 3300037418 | Bacteria | 7913 |
| 226 | Ga0395900_0018084 | 3300037418 | Bacteria | 7193 |
| 227 | Ga0395900_0388312 | 3300037418 | Bacteria | 1362 |
| 228 | Ga0395898_0017181 | 3300037466 | Bacteria | 7390 |
| 229 | Ga0395898_0313929 | 3300037466 | Bacteria | 1495 |
| 230 | Ga0395901_0007302 | 3300038443 | Bacteria | 11152 |
| 231 | Ga0395901_0080115 | 3300038443 | Bacteria | 3409 |
| 232 | Ga0395901_0686228 | 3300038443 | Bacteria | 1023 |
| 233 | Ga0495603_0006242 | 3300046455 | Bacteria | 7125 |
| 234 | Ga0495662_0081371 | 3300046476 | Bacteria | 1575 |
| 235 | Ga0495585_0010445 | 3300046492 | Bacteria | 5522 |
| 236 | Ga0495585_0038850 | 3300046492 | Bacteria | 2678 |
| 237 | Ga0495594_0089049 | 3300046499 | Bacteria | 1728 |
| 238 | Ga0495594_0382935 | 3300046499 | Bacteria | 800 |
| 239 | Ga0495632_0086070 | 3300046519 | Bacteria | 1495 |
| 240 | Ga0495644_0043479 | 3300046523 | Bacteria | 1690 |
| 241 | Ga0495648_0023613 | 3300046524 | Bacteria | 4205 |
| 242 | Ga0495663_0016058 | 3300046525 | Bacteria | 2115 |
| 243 | Ga0495598_0002430 | 3300046537 | Bacteria | 3846 |
| 244 | Ga0495598_0014559 | 3300046537 | Bacteria | 1969 |
| 245 | Ga0495609_0111612 | 3300046538 | Bacteria | 1180 |
| 246 | Ga0495621_0002024 | 3300046539 | Bacteria | 5352 |
| 247 | Ga0495622_0066879 | 3300046557 | Bacteria | 1661 |
| 248 | Ga0495656_0001667 | 3300046615 | Bacteria | 7262 |
| 249 | Ga0495668_0098148 | 3300046616 | Bacteria | 1603 |
| 250 | Ga0495611_0252033 | 3300046648 | Bacteria | 818 |
| 251 | Ga0495625_0007227 | 3300046660 | Bacteria | 9721 |
| 252 | Ga0495659_0001341 | 3300046664 | Bacteria | 8444 |
| 253 | Ga0495659_0062585 | 3300046664 | Bacteria | 1377 |
| 254 | Ga0495661_0087583 | 3300046665 | Bacteria | 1780 |
| 255 | Ga0495669_0028262 | 3300046684 | Bacteria | 2455 |
| 256 | Ga0495670_0001984 | 3300046691 | Bacteria | 10048 |
| 257 | Ga0495670_0025194 | 3300046691 | Bacteria | 2942 |
| 258 | Ga0495672_0023035 | 3300047320 | Bacteria | 4037 |
| 259 | Ga0495677_0098561 | 3300047445 | Bacteria | 1105 |
| 260 | Ga0495677_0118003 | 3300047445 | Bacteria | 1011 |
| 261 | Ga0495681_0090787 | 3300047470 | Bacteria | 1349 |
| 262 | Ga0496100_0229419 | 3300048903 | Bacteria | 1366 |
| 263 | Ga0496100_0293506 | 3300048903 | Bacteria | 1215 |
| 264 | Ga0496101_0016829 | 3300048904 | Bacteria | 4949 |
| 265 | Ga0496101_0363725 | 3300048904 | Bacteria | 1137 |
| 266 | Ga0496102_0115853 | 3300048905 | Bacteria | 2500 |
| 267 | Ga0496103_0095263 | 3300048906 | Bacteria | 1881 |
| 268 | Ga0496104_0015333 | 3300048907 | Bacteria | 6940 |
| 269 | Ga0496105_0056649 | 3300048908 | Bacteria | 3235 |
| 270 | Ga0496106_0009208 | 3300048909 | Bacteria | 7292 |
| 271 | Ga0496106_0108307 | 3300048909 | Bacteria | 2161 |
| 272 | Ga0496107_0100408 | 3300048910 | Bacteria | 2121 |
| 273 | Ga0496108_0438671 | 3300048911 | Unclassified | 1141 |
| 274 | Ga0496109_0045841 | 3300048912 | Bacteria | 3969 |
| 275 | Ga0496110_0102329 | 3300048913 | Bacteria | 2569 |
| 276 | Ga0496112_0003127 | 3300048915 | Bacteria | 13579 |
| 277 | Ga0496115_0058740 | 3300048918 | Bacteria | 3096 |
| 278 | Ga0496115_0136806 | 3300048918 | Bacteria | 2020 |
| 279 | Ga0501031_0079580 | 3300049568 | Bacteria | 2136 |
| 280 | Ga0501031_0081658 | 3300049568 | Bacteria | 2107 |
| 281 | Ga0501031_0119502 | 3300049568 | Bacteria | 1722 |
| 282 | Ga0501031_0371922 | 3300049568 | Bacteria | 925 |
| 283 | Ga0501032_0000088 | 3300049569 | Bacteria | 79913 |
| 284 | Ga0501032_0010187 | 3300049569 | Bacteria | 6784 |
| 285 | Ga0501032_0013734 | 3300049569 | Bacteria | 5747 |
| 286 | Ga0501032_0022595 | 3300049569 | Bacteria | 4359 |
| 287 | Ga0501032_0202238 | 3300049569 | Bacteria | 1296 |
| 288 | Ga0501032_0203270 | 3300049569 | Bacteria | 1293 |
| 289 | Ga0501032_0333220 | 3300049569 | Bacteria | 978 |
| 290 | Ga0501032_0440732 | 3300049569 | Bacteria | 835 |
| 291 | Ga0501033_0012549 | 3300049570 | Bacteria | 6464 |
| 292 | Ga0501033_0021686 | 3300049570 | Bacteria | 4847 |
| 293 | Ga0501033_0052224 | 3300049570 | Bacteria | 3029 |
| 294 | Ga0501033_0059478 | 3300049570 | Bacteria | 2822 |
| 295 | Ga0501034_0001025 | 3300049571 | Bacteria | 40060 |
| 296 | Ga0501034_0009514 | 3300049571 | Bacteria | 10172 |
| 297 | Ga0501034_0023476 | 3300049571 | Bacteria | 6284 |
| 298 | Ga0501034_0032696 | 3300049571 | Bacteria | 5283 |
| 299 | Ga0501034_0088735 | 3300049571 | Bacteria | 3090 |
| 300 | Ga0501034_0125719 | 3300049571 | Unclassified | 2550 |
| 301 | Ga0501034_0134576 | 3300049571 | Bacteria | 2453 |
| 302 | Ga0501034_0177083 | 3300049571 | Bacteria | 2098 |
| 303 | Ga0501034_0217799 | 3300049571 | Bacteria | 1862 |
| 304 | Ga0501034_0310016 | 3300049571 | Bacteria | 1513 |
| 305 | Ga0501034_0390270 | 3300049571 | Bacteria | 1316 |
| 306 | Ga0501034_0464370 | 3300049571 | Bacteria | 1182 |
| 307 | Ga0501036_0001583 | 3300049572 | Bacteria | 17598 |
| 308 | Ga0501036_0002162 | 3300049572 | Bacteria | 15345 |
| 309 | Ga0501036_0009356 | 3300049572 | Bacteria | 8058 |
| 310 | Ga0501036_0034806 | 3300049572 | Bacteria | 4261 |
| 311 | Ga0501036_0168957 | 3300049572 | Bacteria | 1843 |
| 312 | Ga0501036_0365744 | 3300049572 | Bacteria | 1204 |
| 313 | Ga0501036_0366531 | 3300049572 | Bacteria | 1203 |
| 314 | Ga0501037_0011718 | 3300049573 | Bacteria | 6454 |
| 315 | Ga0501037_0066608 | 3300049573 | Bacteria | 2623 |
| 316 | Ga0501037_0069521 | 3300049573 | Bacteria | 2563 |
| 317 | Ga0501037_0086171 | 3300049573 | Bacteria | 2274 |
| 318 | Ga0501037_0127836 | 3300049573 | Bacteria | 1823 |
| 319 | Ga0501037_0386582 | 3300049573 | Bacteria | 961 |
| 320 | Ga0501038_0032935 | 3300049574 | Bacteria | 4566 |
| 321 | Ga0501038_0047080 | 3300049574 | Bacteria | 3736 |
| 322 | Ga0501038_0066828 | 3300049574 | Bacteria | 3060 |
| 323 | Ga0501038_0091090 | 3300049574 | Bacteria | 2555 |
| 324 | Ga0501038_0135475 | 3300049574 | Bacteria | 2018 |
| 325 | Ga0501039_0006642 | 3300049575 | Bacteria | 8791 |
| 326 | Ga0501039_0015979 | 3300049575 | Bacteria | 5747 |
| 327 | Ga0501039_0092276 | 3300049575 | Bacteria | 2360 |
| 328 | Ga0501039_0402516 | 3300049575 | Bacteria | 1075 |
| 329 | Ga0501042_0016185 | 3300049578 | Bacteria | 5116 |
| 330 | Ga0501042_0047003 | 3300049578 | Bacteria | 3077 |
| 331 | Ga0501043_0001947 | 3300049579 | Bacteria | 17672 |
| 332 | Ga0501043_0003962 | 3300049579 | Bacteria | 12137 |
| 333 | Ga0501043_0025661 | 3300049579 | Bacteria | 4623 |
| 334 | Ga0501043_0045010 | 3300049579 | Bacteria | 3471 |
| 335 | Ga0501043_0232101 | 3300049579 | Bacteria | 1425 |
| 336 | Ga0501046_0003677 | 3300049580 | Bacteria | 14051 |
| 337 | Ga0501046_0006834 | 3300049580 | Bacteria | 10064 |
| 338 | Ga0501046_0041616 | 3300049580 | Bacteria | 3665 |
| 339 | Ga0501047_0000314 | 3300049581 | Bacteria | 55906 |
| 340 | Ga0501047_0000347 | 3300049581 | Bacteria | 52509 |
| 341 | Ga0501047_0005674 | 3300049581 | Bacteria | 11746 |
| 342 | Ga0501047_0026175 | 3300049581 | Bacteria | 5611 |
| 343 | Ga0501047_0030752 | 3300049581 | Bacteria | 5175 |
| 344 | Ga0501047_0042681 | 3300049581 | Bacteria | 4382 |
| 345 | Ga0501047_0052194 | 3300049581 | Bacteria | 3951 |
| 346 | Ga0501047_0097247 | 3300049581 | Bacteria | 2822 |
| 347 | Ga0501047_0145932 | 3300049581 | Bacteria | 2243 |
| 348 | Ga0501047_0153146 | 3300049581 | Bacteria | 2180 |
| 349 | Ga0501047_0167681 | 3300049581 | Bacteria | 2066 |
| 350 | Ga0501047_0174020 | 3300049581 | Bacteria | 2021 |
| 351 | Ga0501047_0179446 | 3300049581 | Bacteria | 1984 |
| 352 | Ga0501047_0345157 | 3300049581 | Bacteria | 1326 |
| 353 | Ga0501047_0439786 | 3300049581 | Bacteria | 1134 |
| 354 | Ga0501047_0567621 | 3300049581 | Bacteria | 958 |
| 355 | Ga0501048_0004586 | 3300049582 | Bacteria | 10516 |
| 356 | Ga0501067_0002302 | 3300049583 | Bacteria | 10553 |
| 357 | Ga0501067_0010373 | 3300049583 | Bacteria | 5156 |
| 358 | Ga0501067_0045165 | 3300049583 | Bacteria | 2447 |
| 359 | Ga0501067_0082853 | 3300049583 | Bacteria | 1779 |
| 360 | Ga0501068_0001004 | 3300049584 | Bacteria | 14854 |
| 361 | Ga0501068_0010693 | 3300049584 | Bacteria | 5161 |
| 362 | Ga0501068_0014408 | 3300049584 | Bacteria | 4520 |
| 363 | Ga0501068_0036603 | 3300049584 | Bacteria | 2935 |
| 364 | Ga0501069_0003270 | 3300049585 | Bacteria | 8316 |
| 365 | Ga0501069_0030841 | 3300049585 | Bacteria | 2946 |
| 366 | Ga0501069_0050400 | 3300049585 | Bacteria | 2315 |
| 367 | Ga0501069_0121723 | 3300049585 | Bacteria | 1490 |
| 368 | Ga0501069_0123399 | 3300049585 | Bacteria | 1480 |
| 369 | Ga0501070_0002456 | 3300049586 | Bacteria | 16246 |
| 370 | Ga0501070_0003458 | 3300049586 | Bacteria | 13697 |
| 371 | Ga0501070_0017208 | 3300049586 | Bacteria | 6068 |
| 372 | Ga0501070_0026604 | 3300049586 | Bacteria | 4854 |
| 373 | Ga0501070_0036013 | 3300049586 | Bacteria | 4133 |
| 374 | Ga0501070_0049764 | 3300049586 | Bacteria | 3480 |
| 375 | Ga0501070_0067911 | 3300049586 | Bacteria | 2952 |
| 376 | Ga0501071_0000531 | 3300049587 | Bacteria | 19526 |
| 377 | Ga0501071_0006157 | 3300049587 | Bacteria | 7776 |
| 378 | Ga0501072_0028980 | 3300049588 | Bacteria | 4322 |
| 379 | Ga0501072_0315028 | 3300049588 | Bacteria | 1243 |
| 380 | Ga0501072_0322472 | 3300049588 | Bacteria | 1228 |
| 381 | Ga0501073_0005130 | 3300049589 | Bacteria | 9827 |
| 382 | Ga0501073_0029708 | 3300049589 | Bacteria | 3905 |
| 383 | Ga0501073_0076716 | 3300049589 | Bacteria | 2325 |
| 384 | Ga0501073_0437655 | 3300049589 | Bacteria | 904 |
| 385 | Ga0501074_0008112 | 3300049590 | Bacteria | 7610 |
| 386 | Ga0501074_0015123 | 3300049590 | Bacteria | 5610 |
| 387 | Ga0501074_0020517 | 3300049590 | Bacteria | 4802 |
| 388 | Ga0501074_0032290 | 3300049590 | Bacteria | 3793 |
| 389 | Ga0501075_0085956 | 3300049591 | Bacteria | 2383 |
| 390 | Ga0501076_0011296 | 3300049592 | Bacteria | 6646 |
| 391 | Ga0501079_0001610 | 3300049741 | Bacteria | 16086 |
| 392 | Ga0501080_0000240 | 3300049742 | Bacteria | 41140 |
| 393 | Ga0501080_0024265 | 3300049742 | Bacteria | 5622 |
| 394 | Ga0501080_0025121 | 3300049742 | Bacteria | 5529 |
| 395 | Ga0501080_0039674 | 3300049742 | Bacteria | 4394 |
| 396 | Ga0501080_0068143 | 3300049742 | Bacteria | 3310 |
| 397 | Ga0501080_0744871 | 3300049742 | Bacteria | 862 |
| 398 | Ga0501081_0159565 | 3300049743 | Bacteria | 1624 |
| 399 | Ga0501083_0006193 | 3300049744 | Bacteria | 8487 |
| 400 | Ga0501083_0010177 | 3300049744 | Bacteria | 6628 |
| 401 | Ga0501083_0042951 | 3300049744 | Bacteria | 3063 |
| 402 | Ga0501083_0124845 | 3300049744 | Bacteria | 1688 |
| 403 | Ga0501083_0383573 | 3300049744 | Unclassified | 914 |
| 404 | Ga0501035_0007590 | 3300049822 | Bacteria | 10134 |
| 405 | Ga0501035_0008383 | 3300049822 | Bacteria | 9623 |
| 406 | Ga0501035_0038073 | 3300049822 | Bacteria | 4354 |
| 407 | Ga0501035_0147312 | 3300049822 | Bacteria | 2044 |
| 408 | Ga0501035_0175562 | 3300049822 | Bacteria | 1848 |
| 409 | Ga0501035_0254093 | 3300049822 | Bacteria | 1491 |
| 410 | Ga0501035_0386643 | 3300049822 | Bacteria | 1166 |
| 411 | Ga0501044_0000084 | 3300049823 | Bacteria | 114544 |
| 412 | Ga0501044_0000565 | 3300049823 | Bacteria | 45019 |
| 413 | Ga0501044_0002073 | 3300049823 | Bacteria | 23111 |
| 414 | Ga0501044_0006032 | 3300049823 | Bacteria | 13377 |
| 415 | Ga0501044_0043783 | 3300049823 | Bacteria | 4649 |
| 416 | Ga0501044_0047317 | 3300049823 | Bacteria | 4448 |
| 417 | Ga0501044_0051432 | 3300049823 | Bacteria | 4248 |
| 418 | Ga0501044_0078196 | 3300049823 | Bacteria | 3353 |
| 419 | Ga0501044_0084633 | 3300049823 | Bacteria | 3205 |
| 420 | Ga0501044_0089372 | 3300049823 | Bacteria | 3109 |
| 421 | Ga0501044_0092878 | 3300049823 | Bacteria | 3043 |
| 422 | Ga0501044_0118146 | 3300049823 | Bacteria | 2655 |
| 423 | Ga0501044_0220406 | 3300049823 | Bacteria | 1848 |
| 424 | Ga0501044_0226937 | 3300049823 | Bacteria | 1817 |
| 425 | Ga0501044_0288064 | 3300049823 | Bacteria | 1574 |
| 426 | Ga0501044_0368252 | 3300049823 | Unclassified | 1354 |
| 427 | Ga0501044_0561725 | 3300049823 | Bacteria | 1037 |
| 428 | Ga0501044_0729682 | 3300049823 | Bacteria | 874 |
| 429 | Ga0501045_0007068 | 3300049824 | Bacteria | 7779 |
| 430 | nmdc:mga03n38_91806_c1 | 3300050490 | Bacteria | 1447 |
| 431 | nmdc:mga0yw44_162373_c1 | 3300050492 | Bacteria | 1463 |
| 432 | nmdc:mga0yw44_47932_c1 | 3300050492 | Bacteria | 2574 |
| 433 | nmdc:mga05p37_1239_c1 | 3300050507 | Bacteria | 29626 |
| 434 | nmdc:mga05p37_213_c1 | 3300050507 | Bacteria | 58791 |
| 435 | nmdc:mga09592_3152_c1 | 3300050508 | Bacteria | 13391 |
| 436 | nmdc:mga09592_5003_c1 | 3300050508 | Bacteria | 10744 |
| 437 | nmdc:mga0qj67_15592_c1 | 3300050509 | Bacteria | 5754 |
| 438 | nmdc:mga0qj67_7072_c1 | 3300050509 | Bacteria | 8277 |
| 439 | nmdc:mga06r32_4393_c1 | 3300050510 | Bacteria | 12608 |
| 440 | nmdc:mga06r32_571_c1 | 3300050510 | Bacteria | 32046 |
| 441 | nmdc:mga08y16_26_c1 | 3300050511 | Bacteria | 223965 |
| 442 | nmdc:mga08y16_5337_c1 | 3300050511 | Bacteria | 13447 |
| 443 | nmdc:mga08y16_6730_c1 | 3300050511 | Bacteria | 12051 |
| 444 | nmdc:mga0n895_1733_c1 | 3300050512 | Bacteria | 16489 |
| 445 | nmdc:mga0rr50_1133_c1 | 3300050513 | Bacteria | 14503 |
| 446 | nmdc:mga0a205_1982_c1 | 3300050515 | Bacteria | 17840 |
| 447 | nmdc:mga0a205_334054_c1 | 3300050515 | Bacteria | 1385 |
| 448 | nmdc:mga0sz30_100177_c1 | 3300050516 | Bacteria | 1265 |
| 449 | nmdc:mga0sz30_166930_c1 | 3300050516 | Bacteria | 976 |
| 450 | nmdc:mga0sz30_25000_c1 | 3300050516 | Bacteria | 2441 |
| 451 | Ga0500578_0028212 | 3300053086 | Bacteria | 3607 |
| 452 | Ga0500651_0152448 | 3300053093 | Bacteria | 1387 |
| 453 | Ga0500641_0000482 | 3300053096 | Bacteria | 14541 |
| 454 | Ga0500641_0043876 | 3300053096 | Bacteria | 1816 |
| 455 | Ga0500588_0000536 | 3300053146 | Bacteria | 6137 |
| 456 | Ga0500604_0055819 | 3300053151 | Bacteria | 1229 |
| 457 | Ga0500616_0000888 | 3300053153 | Bacteria | 32969 |
| 458 | Ga0500616_0014213 | 3300053153 | Bacteria | 4582 |
| 459 | Ga0500609_003907 | 3300053731 | Bacteria | 2077 |
| 460 | Ga0501084_0006160 | 3300054114 | Bacteria | 9864 |
| 461 | Ga0501084_0011858 | 3300054114 | Bacteria | 7215 |
| 462 | Ga0501084_0256640 | 3300054114 | Bacteria | 1476 |
| 463 | Ga0501082_0000183 | 3300060353 | Bacteria | 54241 |
| 464 | Ga0501082_0009544 | 3300060353 | Bacteria | 8351 |
| 465 | Ga0501082_0043102 | 3300060353 | Bacteria | 3890 |
| 466 | Ga0501082_0066334 | 3300060353 | Bacteria | 3109 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009098 | Ga0105245_10166542 | Ga0105245_101665422 | 223 |
| 2 | 3300009174 | Ga0105241_10119811 | Ga0105241_101198113 | 223 |
| 3 | 3300010375 | Ga0105239_10061779 | Ga0105239_100617792 | 223 |
| 4 | 3300011119 | Ga0105246_10034073 | Ga0105246_100340733 | 223 |
| 5 | 3300013306 | Ga0163162_10069528 | Ga0163162_100695284 | 223 |
| 6 | 3300014968 | Ga0157379_10142514 | Ga0157379_101425143 | 223 |
| 7 | 3300014969 | Ga0157376_10107997 | Ga0157376_101079972 | 223 |
| 8 | 3300035691 | Ga0373931_0030338 | Ga0373931_0030338_781_1467 | 223 |
| 9 | 3300048903 | Ga0496100_0293506 | Ga0496100_0293506_352_1038 | 223 |
| 10 | 3300048904 | Ga0496101_0363725 | Ga0496101_0363725_435_1121 | 223 |
| 11 | 3300048906 | Ga0496103_0095263 | Ga0496103_0095263_897_1583 | 223 |
| 12 | 3300048907 | Ga0496104_0015333 | Ga0496104_0015333_4564_5250 | 223 |
| 13 | 3300048908 | Ga0496105_0056649 | Ga0496105_0056649_1554_2240 | 223 |
| 14 | 3300048909 | Ga0496106_0108307 | Ga0496106_0108307_189_875 | 223 |
| 15 | 3300048910 | Ga0496107_0100408 | Ga0496107_0100408_357_1043 | 223 |
| 16 | 3300048912 | Ga0496109_0045841 | Ga0496109_0045841_2440_3126 | 223 |
| 17 | 3300048915 | Ga0496112_0003127 | Ga0496112_0003127_446_1132 | 223 |
| 18 | 3300048918 | Ga0496115_0136806 | Ga0496115_0136806_883_1569 | 223 |
| 19 | 3300049586 | Ga0501070_0067911 | Ga0501070_0067911_336_1034 | 226 |
| 20 | 3300049744 | Ga0501083_0124845 | Ga0501083_0124845_623_1321 | 226 |
| 21 | 3300006178 | Ga0075367_10253436 | Ga0075367_102534362 | 227 |
| 22 | 3300026116 | Ga0207674_10333838 | Ga0207674_103338381 | 228 |
| 23 | 3300049581 | Ga0501047_0567621 | Ga0501047_0567621_58_912 | 228 |
| 24 | 3300049822 | Ga0501035_0007590 | Ga0501035_0007590_3878_4732 | 228 |
| 25 | 3300049822 | Ga0501035_0147312 | Ga0501035_0147312_104_961 | 228 |
| 26 | 3300049823 | Ga0501044_0092878 | Ga0501044_0092878_1929_2786 | 228 |
| 27 | 3300005937 | Ga0081455_10003276 | Ga0081455_1000327619 | 229 |
| 28 | 3300025302 | Ga0207426_1011052 | Ga0207426_10110524 | 229 |
| 29 | 3300046557 | Ga0495622_0066879 | Ga0495622_0066879_29_730 | 230 |
| 30 | 3300047445 | Ga0495677_0118003 | Ga0495677_0118003_90_878 | 230 |
| 31 | iso_pu_bacteria | 2908756301 | 2908762687 | 230 |
| 32 | 3300049571 | Ga0501034_0217799 | Ga0501034_0217799_704_1495 | 232 |
| 33 | 3300049580 | Ga0501046_0003677 | Ga0501046_0003677_6845_7849 | 232 |
| 34 | 3300049581 | Ga0501047_0026175 | Ga0501047_0026175_2582_3367 | 232 |
| 35 | 3300049581 | Ga0501047_0174020 | Ga0501047_0174020_1086_1877 | 232 |
| 36 | 3300049823 | Ga0501044_0043783 | Ga0501044_0043783_2249_3040 | 232 |
| 37 | 3300005563 | Ga0068855_100597241 | Ga0068855_1005972412 | 233 |
| 38 | 3300046455 | Ga0495603_0006242 | Ga0495603_0006242_3371_4084 | 234 |
| 39 | 3300046492 | Ga0495585_0010445 | Ga0495585_0010445_1821_2534 | 234 |
| 40 | 3300046499 | Ga0495594_0382935 | Ga0495594_0382935_59_772 | 234 |
| 41 | 3300046519 | Ga0495632_0086070 | Ga0495632_0086070_626_1339 | 234 |
| 42 | 3300046523 | Ga0495644_0043479 | Ga0495644_0043479_847_1560 | 234 |
| 43 | 3300046525 | Ga0495663_0016058 | Ga0495663_0016058_1050_1763 | 234 |
| 44 | 3300046537 | Ga0495598_0002430 | Ga0495598_0002430_28_741 | 234 |
| 45 | 3300046539 | Ga0495621_0002024 | Ga0495621_0002024_1473_2186 | 234 |
| 46 | 3300046615 | Ga0495656_0001667 | Ga0495656_0001667_3633_4346 | 234 |
| 47 | 3300046616 | Ga0495668_0098148 | Ga0495668_0098148_426_1139 | 234 |
| 48 | 3300046648 | Ga0495611_0252033 | Ga0495611_0252033_59_772 | 234 |
| 49 | 3300046664 | Ga0495659_0062585 | Ga0495659_0062585_322_1035 | 234 |
| 50 | 3300046665 | Ga0495661_0087583 | Ga0495661_0087583_101_814 | 234 |
| 51 | 3300046684 | Ga0495669_0028262 | Ga0495669_0028262_422_1135 | 234 |
| 52 | 3300046691 | Ga0495670_0025194 | Ga0495670_0025194_1808_2521 | 234 |
| 53 | 3300047445 | Ga0495677_0098561 | Ga0495677_0098561_59_772 | 234 |
| 54 | 3300047470 | Ga0495681_0090787 | Ga0495681_0090787_316_1029 | 234 |
| 55 | 3300014326 | Ga0157380_10125417 | Ga0157380_101254172 | 235 |
| 56 | 3300035113 | Ga0373936_0263277 | Ga0373936_0263277_37_744 | 235 |
| 57 | 3300049574 | Ga0501038_0091090 | Ga0501038_0091090_68_889 | 236 |
| 58 | 3300060353 | Ga0501082_0066334 | Ga0501082_0066334_36_821 | 237 |
| 59 | 3300049569 | Ga0501032_0000088 | Ga0501032_0000088_73913_74713 | 239 |
| 60 | 3300049569 | Ga0501032_0203270 | Ga0501032_0203270_457_1278 | 239 |
| 61 | 3300049570 | Ga0501033_0059478 | Ga0501033_0059478_582_1403 | 239 |
| 62 | 3300049571 | Ga0501034_0001025 | Ga0501034_0001025_36147_36923 | 240 |
| 63 | 3300049571 | Ga0501034_0310016 | Ga0501034_0310016_750_1475 | 240 |
| 64 | 3300049572 | Ga0501036_0001583 | Ga0501036_0001583_13935_14711 | 240 |
| 65 | 3300049573 | Ga0501037_0386582 | Ga0501037_0386582_42_767 | 240 |
| 66 | 3300049579 | Ga0501043_0001947 | Ga0501043_0001947_14291_15067 | 240 |
| 67 | 3300049581 | Ga0501047_0000314 | Ga0501047_0000314_51908_52684 | 240 |
| 68 | 3300049586 | Ga0501070_0003458 | Ga0501070_0003458_10430_11206 | 240 |
| 69 | 3300049590 | Ga0501074_0032290 | Ga0501074_0032290_771_1547 | 240 |
| 70 | 3300049742 | Ga0501080_0000240 | Ga0501080_0000240_3199_3975 | 240 |
| 71 | 3300049744 | Ga0501083_0006193 | Ga0501083_0006193_5260_6036 | 240 |
| 72 | 3300049823 | Ga0501044_0000565 | Ga0501044_0000565_40437_41213 | 240 |
| 73 | 3300049823 | Ga0501044_0084633 | Ga0501044_0084633_37_762 | 240 |
| 74 | 3300013105 | Ga0157369_10196208 | Ga0157369_101962082 | 241 |
| 75 | 3300049586 | Ga0501070_0026604 | Ga0501070_0026604_754_1536 | 242 |
| 76 | 3300060353 | Ga0501082_0009544 | Ga0501082_0009544_1620_2402 | 242 |
| 77 | 3300025981 | Ga0207640_10088833 | Ga0207640_100888332 | 244 |
| 78 | 3300049569 | Ga0501032_0013734 | Ga0501032_0013734_3424_4224 | 244 |
| 79 | 3300049570 | Ga0501033_0021686 | Ga0501033_0021686_107_907 | 244 |
| 80 | 3300049572 | Ga0501036_0009356 | Ga0501036_0009356_4000_4800 | 244 |
| 81 | 3300049574 | Ga0501038_0032935 | Ga0501038_0032935_2709_3509 | 244 |
| 82 | 3300049575 | Ga0501039_0015979 | Ga0501039_0015979_1652_2452 | 244 |
| 83 | 3300049578 | Ga0501042_0047003 | Ga0501042_0047003_1639_2439 | 244 |
| 84 | 3300049579 | Ga0501043_0003962 | Ga0501043_0003962_5058_5858 | 244 |
| 85 | 3300049580 | Ga0501046_0006834 | Ga0501046_0006834_5265_6065 | 244 |
| 86 | 3300049581 | Ga0501047_0005674 | Ga0501047_0005674_3815_4615 | 244 |
| 87 | 3300049583 | Ga0501067_0002302 | Ga0501067_0002302_5866_6666 | 244 |
| 88 | 3300049584 | Ga0501068_0036603 | Ga0501068_0036603_107_907 | 244 |
| 89 | 3300049585 | Ga0501069_0121723 | Ga0501069_0121723_235_1035 | 244 |
| 90 | 3300049586 | Ga0501070_0002456 | Ga0501070_0002456_9613_10413 | 244 |
| 91 | 3300049587 | Ga0501071_0000531 | Ga0501071_0000531_15384_16184 | 244 |
| 92 | 3300049589 | Ga0501073_0029708 | Ga0501073_0029708_2999_3799 | 244 |
| 93 | 3300049590 | Ga0501074_0008112 | Ga0501074_0008112_3995_4795 | 244 |
| 94 | 3300049591 | Ga0501075_0085956 | Ga0501075_0085956_429_1229 | 244 |
| 95 | 3300049592 | Ga0501076_0011296 | Ga0501076_0011296_2377_3177 | 244 |
| 96 | 3300049741 | Ga0501079_0001610 | Ga0501079_0001610_5650_6450 | 244 |
| 97 | 3300049742 | Ga0501080_0025121 | Ga0501080_0025121_4086_4886 | 244 |
| 98 | 3300049743 | Ga0501081_0159565 | Ga0501081_0159565_447_1247 | 244 |
| 99 | 3300049744 | Ga0501083_0042951 | Ga0501083_0042951_107_907 | 244 |
| 100 | 3300049822 | Ga0501035_0008383 | Ga0501035_0008383_3687_4487 | 244 |
| 101 | 3300049823 | Ga0501044_0006032 | Ga0501044_0006032_11520_12320 | 244 |
| 102 | 3300054114 | Ga0501084_0006160 | Ga0501084_0006160_7413_8213 | 244 |
| 103 | 3300048918 | Ga0496115_0058740 | Ga0496115_0058740_2344_3084 | 245 |
| 104 | 3300014497 | Ga0182008_10098832 | Ga0182008_100988322 | 246 |
| 105 | 3300049571 | Ga0501034_0088735 | Ga0501034_0088735_694_1446 | 246 |
| 106 | 3300049742 | Ga0501080_0744871 | Ga0501080_0744871_17_757 | 246 |
| 107 | 3300005434 | Ga0070709_10130368 | Ga0070709_101303682 | 247 |
| 108 | 3300006175 | Ga0070712_100211912 | Ga0070712_1002119122 | 247 |
| 109 | 3300025905 | Ga0207685_10105603 | Ga0207685_101056032 | 247 |
| 110 | 3300025906 | Ga0207699_10066295 | Ga0207699_100662952 | 247 |
| 111 | 3300025915 | Ga0207693_10022650 | Ga0207693_100226504 | 247 |
| 112 | 3300025939 | Ga0207665_10051754 | Ga0207665_100517542 | 247 |
| 113 | 3300005983 | Ga0081540_1000136 | Ga0081540_100013617 | 248 |
| 114 | 3300037312 | Ga0395899_0215959 | Ga0395899_0215959_301_1110 | 248 |
| 115 | 3300037418 | Ga0395900_0388312 | Ga0395900_0388312_423_1232 | 248 |
| 116 | 3300049581 | Ga0501047_0000347 | Ga0501047_0000347_30817_31599 | 248 |
| 117 | 3300049823 | Ga0501044_0118146 | Ga0501044_0118146_943_1725 | 248 |
| 118 | 3300005436 | Ga0070713_100318468 | Ga0070713_1003184681 | 249 |
| 119 | 3300006163 | Ga0070715_10011164 | Ga0070715_100111641 | 249 |
| 120 | 3300006173 | Ga0070716_100055318 | Ga0070716_1000553183 | 249 |
| 121 | 3300025939 | Ga0207665_10010418 | Ga0207665_100104183 | 249 |
| 122 | 3300049572 | Ga0501036_0168957 | Ga0501036_0168957_631_1452 | 250 |
| 123 | 3300049573 | Ga0501037_0086171 | Ga0501037_0086171_77_850 | 250 |
| 124 | 3300049822 | Ga0501035_0175562 | Ga0501035_0175562_704_1525 | 250 |
| 125 | 3300053153 | Ga0500616_0014213 | Ga0500616_0014213_982_1767 | 250 |
| 126 | 3300009094 | Ga0111539_10000051 | Ga0111539_1000005134 | 253 |
| 127 | 3300046476 | Ga0495662_0081371 | Ga0495662_0081371_69_854 | 253 |
| 128 | 3300046499 | Ga0495594_0089049 | Ga0495594_0089049_627_1412 | 253 |
| 129 | 3300046524 | Ga0495648_0023613 | Ga0495648_0023613_2914_3702 | 253 |
| 130 | 3300050511 | nmdc:mga08y16_26_c1 | nmdc:mga08y16_26_c1_204184_204948 | 253 |
| 131 | 3300050515 | nmdc:mga0a205_334054_c1 | nmdc:mga0a205_334054_c1_10_774 | 253 |
| 132 | 3300005434 | Ga0070709_10432242 | Ga0070709_104322422 | 254 |
| 133 | 3300005437 | Ga0070710_10008797 | Ga0070710_100087976 | 254 |
| 134 | 3300025915 | Ga0207693_10029350 | Ga0207693_100293502 | 254 |
| 135 | 3300049571 | Ga0501034_0390270 | Ga0501034_0390270_321_1211 | 254 |
| 136 | 3300009148 | Ga0105243_10042049 | Ga0105243_100420495 | 255 |
| 137 | 3300009553 | Ga0105249_10383326 | Ga0105249_103833262 | 255 |
| 138 | 3300014326 | Ga0157380_10017684 | Ga0157380_100176843 | 255 |
| 139 | 3300025935 | Ga0207709_10119277 | Ga0207709_101192771 | 255 |
| 140 | 3300025961 | Ga0207712_10253291 | Ga0207712_102532912 | 255 |
| 141 | iso_pu_bacteria | 2508501122 | 2509108763 | 255 |
| 142 | iso_pu_bacteria | 2513237098 | 2513674301 | 256 |
| 143 | iso_pu_bacteria | 2791355123 | 2792747689 | 256 |
| 144 | iso_pu_bacteria | 2935684952 | 2935694071 | 256 |
| 145 | iso_pu_bacteria | 2935713505 | 2935722610 | 256 |
| 146 | iso_pu_bacteria | 2935722832 | 2935731959 | 256 |
| 147 | iso_pu_bacteria | 2935732158 | 2935741288 | 256 |
| 148 | iso_pu_bacteria | 2935741537 | 2935750663 | 256 |
| 149 | iso_pu_bacteria | 2935750917 | 2935760138 | 256 |
| 150 | iso_pu_bacteria | 2940556831 | 2940566003 | 256 |
| 151 | iso_pu_bacteria | 8006933436 | 8006942463 | 256 |
| 152 | iso_pu_bacteria | 8006973647 | 8006982190 | 256 |
| 153 | iso_pu_bacteria | 8056681323 | 8056685931 | 256 |
| 154 | iso_pu_bacteria | 2643221733 | 2644728983 | 257 |
| 155 | iso_pu_bacteria | 2909042592 | 2909046161 | 258 |
| 156 | 3300005340 | Ga0070689_100239787 | Ga0070689_1002397872 | 259 |
| 157 | 3300005353 | Ga0070669_100132504 | Ga0070669_1001325042 | 259 |
| 158 | 3300005441 | Ga0070700_100043320 | Ga0070700_1000433202 | 259 |
| 159 | 3300005617 | Ga0068859_100215041 | Ga0068859_1002150412 | 259 |
| 160 | 3300005840 | Ga0068870_10206891 | Ga0068870_102068913 | 259 |
| 161 | 3300006931 | Ga0097620_100215045 | Ga0097620_1002150452 | 259 |
| 162 | 3300009177 | Ga0105248_10634072 | Ga0105248_106340723 | 259 |
| 163 | 3300009988 | Ga0105035_105180 | Ga0105035_1051801 | 259 |
| 164 | 3300025923 | Ga0207681_10177079 | Ga0207681_101770792 | 259 |
| 165 | 3300025926 | Ga0207659_10054295 | Ga0207659_100542951 | 259 |
| 166 | 3300049581 | Ga0501047_0179446 | Ga0501047_0179446_292_1074 | 259 |
| 167 | 3300049822 | Ga0501035_0254093 | Ga0501035_0254093_469_1266 | 259 |
| 168 | 3300049823 | Ga0501044_0000084 | Ga0501044_0000084_73250_74032 | 259 |
| 169 | 3300049823 | Ga0501044_0226937 | Ga0501044_0226937_1017_1802 | 259 |
| 170 | iso_pu_bacteria | 2903768456 | 2903769985 | 259 |
| 171 | 3300002067 | JGI24735J21928_10000166 | JGI24735J21928_1000016612 | 260 |
| 172 | 3300003203 | JGI25406J46586_10020594 | JGI25406J46586_100205941 | 260 |
| 173 | 3300003320 | rootH2_10037747 | rootH2_100377474 | 260 |
| 174 | 3300003771 | Ga0055526_1001740 | Ga0055526_10017405 | 260 |
| 175 | 3300003775 | Ga0055524_1000278 | Ga0055524_10002786 | 260 |
| 176 | 3300003790 | Ga0055528_1011628 | Ga0055528_10116282 | 260 |
| 177 | 3300003911 | JGI25405J52794_10006850 | JGI25405J52794_100068503 | 260 |
| 178 | 3300005327 | Ga0070658_10014346 | Ga0070658_100143464 | 260 |
| 179 | 3300005327 | Ga0070658_10060208 | Ga0070658_100602082 | 260 |
| 180 | 3300005329 | Ga0070683_100003600 | Ga0070683_10000360017 | 260 |
| 181 | 3300005329 | Ga0070683_100249730 | Ga0070683_1002497303 | 260 |
| 182 | 3300005330 | Ga0070690_100340433 | Ga0070690_1003404331 | 260 |
| 183 | 3300005336 | Ga0070680_100003772 | Ga0070680_1000037727 | 260 |
| 184 | 3300005336 | Ga0070680_100016951 | Ga0070680_1000169516 | 260 |
| 185 | 3300005336 | Ga0070680_100091525 | Ga0070680_1000915252 | 260 |
| 186 | 3300005336 | Ga0070680_100105360 | Ga0070680_1001053603 | 260 |
| 187 | 3300005336 | Ga0070680_100352196 | Ga0070680_1003521963 | 260 |
| 188 | 3300005339 | Ga0070660_100059083 | Ga0070660_1000590833 | 260 |
| 189 | 3300005339 | Ga0070660_100120430 | Ga0070660_1001204302 | 260 |
| 190 | 3300005341 | Ga0070691_10015217 | Ga0070691_100152172 | 260 |
| 191 | 3300005353 | Ga0070669_100059993 | Ga0070669_1000599932 | 260 |
| 192 | 3300005355 | Ga0070671_100084899 | Ga0070671_1000848991 | 260 |
| 193 | 3300005356 | Ga0070674_100005086 | Ga0070674_1000050863 | 260 |
| 194 | 3300005356 | Ga0070674_100006661 | Ga0070674_1000066612 | 260 |
| 195 | 3300005364 | Ga0070673_100320033 | Ga0070673_1003200332 | 260 |
| 196 | 3300005366 | Ga0070659_100046904 | Ga0070659_1000469043 | 260 |
| 197 | 3300005434 | Ga0070709_10537841 | Ga0070709_105378411 | 260 |
| 198 | 3300005441 | Ga0070700_100025537 | Ga0070700_1000255375 | 260 |
| 199 | 3300005444 | Ga0070694_100093472 | Ga0070694_1000934722 | 260 |
| 200 | 3300005444 | Ga0070694_100414366 | Ga0070694_1004143661 | 260 |
| 201 | 3300005455 | Ga0070663_100013179 | Ga0070663_1000131795 | 260 |
| 202 | 3300005455 | Ga0070663_100192632 | Ga0070663_1001926323 | 260 |
| 203 | 3300005458 | Ga0070681_10010245 | Ga0070681_100102456 | 260 |
| 204 | 3300005458 | Ga0070681_10017960 | Ga0070681_100179608 | 260 |
| 205 | 3300005458 | Ga0070681_10025609 | Ga0070681_100256096 | 260 |
| 206 | 3300005458 | Ga0070681_10091247 | Ga0070681_100912473 | 260 |
| 207 | 3300005458 | Ga0070681_10099552 | Ga0070681_100995522 | 260 |
| 208 | 3300005530 | Ga0070679_100020866 | Ga0070679_1000208666 | 260 |
| 209 | 3300005530 | Ga0070679_100026016 | Ga0070679_1000260166 | 260 |
| 210 | 3300005530 | Ga0070679_100050484 | Ga0070679_1000504841 | 260 |
| 211 | 3300005530 | Ga0070679_100100921 | Ga0070679_1001009214 | 260 |
| 212 | 3300005530 | Ga0070679_100398642 | Ga0070679_1003986422 | 260 |
| 213 | 3300005535 | Ga0070684_100022719 | Ga0070684_1000227196 | 260 |
| 214 | 3300005535 | Ga0070684_100133733 | Ga0070684_1001337333 | 260 |
| 215 | 3300005539 | Ga0068853_100079732 | Ga0068853_1000797322 | 260 |
| 216 | 3300005539 | Ga0068853_100159247 | Ga0068853_1001592472 | 260 |
| 217 | 3300005546 | Ga0070696_100022913 | Ga0070696_1000229135 | 260 |
| 218 | 3300005547 | Ga0070693_100006909 | Ga0070693_1000069092 | 260 |
| 219 | 3300005548 | Ga0070665_100019248 | Ga0070665_1000192485 | 260 |
| 220 | 3300005548 | Ga0070665_100084679 | Ga0070665_1000846792 | 260 |
| 221 | 3300005549 | Ga0070704_100124816 | Ga0070704_1001248162 | 260 |
| 222 | 3300005563 | Ga0068855_100032721 | Ga0068855_1000327218 | 260 |
| 223 | 3300005563 | Ga0068855_100080550 | Ga0068855_1000805502 | 260 |
| 224 | 3300005563 | Ga0068855_100512511 | Ga0068855_1005125112 | 260 |
| 225 | 3300005577 | Ga0068857_100043275 | Ga0068857_1000432753 | 260 |
| 226 | 3300005577 | Ga0068857_100203508 | Ga0068857_1002035084 | 260 |
| 227 | 3300005614 | Ga0068856_100221996 | Ga0068856_1002219963 | 260 |
| 228 | 3300005615 | Ga0070702_100098481 | Ga0070702_1000984812 | 260 |
| 229 | 3300005616 | Ga0068852_100060965 | Ga0068852_1000609653 | 260 |
| 230 | 3300005617 | Ga0068859_100624239 | Ga0068859_1006242391 | 260 |
| 231 | 3300005618 | Ga0068864_100047954 | Ga0068864_1000479543 | 260 |
| 232 | 3300005842 | Ga0068858_100076376 | Ga0068858_1000763764 | 260 |
| 233 | 3300005843 | Ga0068860_100083500 | Ga0068860_1000835005 | 260 |
| 234 | 3300005844 | Ga0068862_100013789 | Ga0068862_1000137892 | 260 |
| 235 | 3300005937 | Ga0081455_10002931 | Ga0081455_1000293110 | 260 |
| 236 | 3300005937 | Ga0081455_10020346 | Ga0081455_100203463 | 260 |
| 237 | 3300005937 | Ga0081455_10023516 | Ga0081455_100235165 | 260 |
| 238 | 3300005983 | Ga0081540_1016291 | Ga0081540_10162916 | 260 |
| 239 | 3300005983 | Ga0081540_1025790 | Ga0081540_10257902 | 260 |
| 240 | 3300005985 | Ga0081539_10002021 | Ga0081539_1000202123 | 260 |
| 241 | 3300006058 | Ga0075432_10002788 | Ga0075432_100027882 | 260 |
| 242 | 3300006186 | Ga0075369_10032020 | Ga0075369_100320204 | 260 |
| 243 | 3300006186 | Ga0075369_10137732 | Ga0075369_101377322 | 260 |
| 244 | 3300006186 | Ga0075369_10138388 | Ga0075369_101383882 | 260 |
| 245 | 3300006194 | Ga0075427_10000097 | Ga0075427_100000978 | 260 |
| 246 | 3300006358 | Ga0068871_100227755 | Ga0068871_1002277552 | 260 |
| 247 | 3300006844 | Ga0075428_100013088 | Ga0075428_1000130883 | 260 |
| 248 | 3300006844 | Ga0075428_100018039 | Ga0075428_1000180393 | 260 |
| 249 | 3300006846 | Ga0075430_100002416 | Ga0075430_1000024168 | 260 |
| 250 | 3300006846 | Ga0075430_100030969 | Ga0075430_1000309693 | 260 |
| 251 | 3300006847 | Ga0075431_100000251 | Ga0075431_1000002516 | 260 |
| 252 | 3300006847 | Ga0075431_100005932 | Ga0075431_1000059323 | 260 |
| 253 | 3300006852 | Ga0075433_10001944 | Ga0075433_1000194411 | 260 |
| 254 | 3300006871 | Ga0075434_100000735 | Ga0075434_1000007357 | 260 |
| 255 | 3300006880 | Ga0075429_100002109 | Ga0075429_10000210910 | 260 |
| 256 | 3300006880 | Ga0075429_100004142 | Ga0075429_1000041429 | 260 |
| 257 | 3300006881 | Ga0068865_100332874 | Ga0068865_1003328742 | 260 |
| 258 | 3300006931 | Ga0097620_100624291 | Ga0097620_1006242911 | 260 |
| 259 | 3300007076 | Ga0075435_100000696 | Ga0075435_1000006967 | 260 |
| 260 | 3300009094 | Ga0111539_10000930 | Ga0111539_1000093020 | 260 |
| 261 | 3300009094 | Ga0111539_10008602 | Ga0111539_1000860210 | 260 |
| 262 | 3300009147 | Ga0114129_10001487 | Ga0114129_1000148710 | 260 |
| 263 | 3300009147 | Ga0114129_10009304 | Ga0114129_1000930411 | 260 |
| 264 | 3300009148 | Ga0105243_10095271 | Ga0105243_100952712 | 260 |
| 265 | 3300009148 | Ga0105243_10602706 | Ga0105243_106027061 | 260 |
| 266 | 3300009174 | Ga0105241_10011285 | Ga0105241_100112855 | 260 |
| 267 | 3300009545 | Ga0105237_10025096 | Ga0105237_100250968 | 260 |
| 268 | 3300009545 | Ga0105237_10032441 | Ga0105237_100324413 | 260 |
| 269 | 3300009551 | Ga0105238_10083721 | Ga0105238_100837211 | 260 |
| 270 | 3300009551 | Ga0105238_10168775 | Ga0105238_101687752 | 260 |
| 271 | 3300009551 | Ga0105238_10308818 | Ga0105238_103088184 | 260 |
| 272 | 3300009993 | Ga0105028_103044 | Ga0105028_1030442 | 260 |
| 273 | 3300010375 | Ga0105239_10161104 | Ga0105239_101611042 | 260 |
| 274 | 3300013100 | Ga0157373_10075358 | Ga0157373_100753582 | 260 |
| 275 | 3300013100 | Ga0157373_10106696 | Ga0157373_101066961 | 260 |
| 276 | 3300013102 | Ga0157371_10283082 | Ga0157371_102830822 | 260 |
| 277 | 3300013105 | Ga0157369_10186616 | Ga0157369_101866162 | 260 |
| 278 | 3300013105 | Ga0157369_10615913 | Ga0157369_106159132 | 260 |
| 279 | 3300013296 | Ga0157374_10003630 | Ga0157374_1000363016 | 260 |
| 280 | 3300013306 | Ga0163162_10540994 | Ga0163162_105409942 | 260 |
| 281 | 3300013307 | Ga0157372_10158029 | Ga0157372_101580292 | 260 |
| 282 | 3300013308 | Ga0157375_10045904 | Ga0157375_100459043 | 260 |
| 283 | 3300014326 | Ga0157380_10020957 | Ga0157380_100209575 | 260 |
| 284 | 3300014969 | Ga0157376_10398929 | Ga0157376_103989292 | 260 |
| 285 | 3300017792 | Ga0163161_10234862 | Ga0163161_102348621 | 260 |
| 286 | 3300025273 | Ga0209673_1001289 | Ga0209673_10012892 | 260 |
| 287 | 3300025291 | Ga0209675_1000285 | Ga0209675_10002855 | 260 |
| 288 | 3300025295 | Ga0209564_1000017 | Ga0209564_1000017398 | 260 |
| 289 | 3300025295 | Ga0209564_1000206 | Ga0209564_100020687 | 260 |
| 290 | 3300025299 | Ga0209256_1000133 | Ga0209256_1000133110 | 260 |
| 291 | 3300025899 | Ga0207642_10084822 | Ga0207642_100848222 | 260 |
| 292 | 3300025904 | Ga0207647_10035503 | Ga0207647_100355036 | 260 |
| 293 | 3300025904 | Ga0207647_10046522 | Ga0207647_100465222 | 260 |
| 294 | 3300025904 | Ga0207647_10070580 | Ga0207647_100705804 | 260 |
| 295 | 3300025909 | Ga0207705_10027871 | Ga0207705_100278715 | 260 |
| 296 | 3300025909 | Ga0207705_10079092 | Ga0207705_100790922 | 260 |
| 297 | 3300025909 | Ga0207705_10158145 | Ga0207705_101581453 | 260 |
| 298 | 3300025912 | Ga0207707_10051385 | Ga0207707_100513855 | 260 |
| 299 | 3300025912 | Ga0207707_10055542 | Ga0207707_100555425 | 260 |
| 300 | 3300025912 | Ga0207707_10058957 | Ga0207707_100589575 | 260 |
| 301 | 3300025913 | Ga0207695_10112225 | Ga0207695_101122252 | 260 |
| 302 | 3300025914 | Ga0207671_10018289 | Ga0207671_100182895 | 260 |
| 303 | 3300025917 | Ga0207660_10037440 | Ga0207660_100374406 | 260 |
| 304 | 3300025917 | Ga0207660_10038539 | Ga0207660_100385393 | 260 |
| 305 | 3300025917 | Ga0207660_10163554 | Ga0207660_101635543 | 260 |
| 306 | 3300025919 | Ga0207657_10003352 | Ga0207657_100033528 | 260 |
| 307 | 3300025919 | Ga0207657_10069148 | Ga0207657_100691482 | 260 |
| 308 | 3300025919 | Ga0207657_10071311 | Ga0207657_100713113 | 260 |
| 309 | 3300025919 | Ga0207657_10138030 | Ga0207657_101380303 | 260 |
| 310 | 3300025921 | Ga0207652_10012632 | Ga0207652_100126327 | 260 |
| 311 | 3300025921 | Ga0207652_10045035 | Ga0207652_100450355 | 260 |
| 312 | 3300025921 | Ga0207652_10082513 | Ga0207652_100825132 | 260 |
| 313 | 3300025921 | Ga0207652_10117406 | Ga0207652_101174063 | 260 |
| 314 | 3300025923 | Ga0207681_10144335 | Ga0207681_101443353 | 260 |
| 315 | 3300025924 | Ga0207694_10057335 | Ga0207694_100573352 | 260 |
| 316 | 3300025924 | Ga0207694_10215942 | Ga0207694_102159423 | 260 |
| 317 | 3300025931 | Ga0207644_10060718 | Ga0207644_100607181 | 260 |
| 318 | 3300025932 | Ga0207690_10018147 | Ga0207690_100181476 | 260 |
| 319 | 3300025932 | Ga0207690_10201680 | Ga0207690_102016801 | 260 |
| 320 | 3300025937 | Ga0207669_10016058 | Ga0207669_100160582 | 260 |
| 321 | 3300025938 | Ga0207704_10321501 | Ga0207704_103215011 | 260 |
| 322 | 3300025940 | Ga0207691_10187155 | Ga0207691_101871552 | 260 |
| 323 | 3300025941 | Ga0207711_10463027 | Ga0207711_104630272 | 260 |
| 324 | 3300025944 | Ga0207661_10041197 | Ga0207661_100411975 | 260 |
| 325 | 3300025949 | Ga0207667_10054232 | Ga0207667_100542322 | 260 |
| 326 | 3300025949 | Ga0207667_10211388 | Ga0207667_102113884 | 260 |
| 327 | 3300025960 | Ga0207651_10108770 | Ga0207651_101087702 | 260 |
| 328 | 3300025981 | Ga0207640_10180110 | Ga0207640_101801102 | 260 |
| 329 | 3300026041 | Ga0207639_10007560 | Ga0207639_100075607 | 260 |
| 330 | 3300026041 | Ga0207639_10162636 | Ga0207639_101626363 | 260 |
| 331 | 3300026067 | Ga0207678_10000595 | Ga0207678_1000059511 | 260 |
| 332 | 3300026067 | Ga0207678_10083550 | Ga0207678_100835503 | 260 |
| 333 | 3300026078 | Ga0207702_10402092 | Ga0207702_104020923 | 260 |
| 334 | 3300026089 | Ga0207648_10196341 | Ga0207648_101963412 | 260 |
| 335 | 3300026095 | Ga0207676_10045068 | Ga0207676_100450683 | 260 |
| 336 | 3300026116 | Ga0207674_10083437 | Ga0207674_100834373 | 260 |
| 337 | 3300027907 | Ga0207428_10000016 | Ga0207428_1000001619 | 260 |
| 338 | 3300027907 | Ga0207428_10000322 | Ga0207428_1000032234 | 260 |
| 339 | 3300027907 | Ga0207428_10036638 | Ga0207428_100366382 | 260 |
| 340 | 3300028379 | Ga0268266_10070015 | Ga0268266_100700152 | 260 |
| 341 | 3300028380 | Ga0268265_10020698 | Ga0268265_100206982 | 260 |
| 342 | 3300028381 | Ga0268264_10065942 | Ga0268264_100659422 | 260 |
| 343 | 3300031711 | Ga0265314_10063171 | Ga0265314_100631715 | 260 |
| 344 | 3300031712 | Ga0265342_10000717 | Ga0265342_1000071736 | 260 |
| 345 | 3300037312 | Ga0395899_0005148 | Ga0395899_0005148_3267_4067 | 260 |
| 346 | 3300037418 | Ga0395900_0014938 | Ga0395900_0014938_2407_3261 | 260 |
| 347 | 3300037418 | Ga0395900_0018084 | Ga0395900_0018084_3923_4723 | 260 |
| 348 | 3300037466 | Ga0395898_0017181 | Ga0395898_0017181_563_1417 | 260 |
| 349 | 3300037466 | Ga0395898_0313929 | Ga0395898_0313929_240_1040 | 260 |
| 350 | 3300038443 | Ga0395901_0007302 | Ga0395901_0007302_6189_6989 | 260 |
| 351 | 3300038443 | Ga0395901_0080115 | Ga0395901_0080115_594_1448 | 260 |
| 352 | 3300038443 | Ga0395901_0686228 | Ga0395901_0686228_165_950 | 260 |
| 353 | 3300046492 | Ga0495585_0038850 | Ga0495585_0038850_994_1779 | 260 |
| 354 | 3300046537 | Ga0495598_0014559 | Ga0495598_0014559_1158_1943 | 260 |
| 355 | 3300046538 | Ga0495609_0111612 | Ga0495609_0111612_246_1031 | 260 |
| 356 | 3300046660 | Ga0495625_0007227 | Ga0495625_0007227_5632_6444 | 260 |
| 357 | 3300046664 | Ga0495659_0001341 | Ga0495659_0001341_5399_6184 | 260 |
| 358 | 3300046691 | Ga0495670_0001984 | Ga0495670_0001984_6406_7191 | 260 |
| 359 | 3300047320 | Ga0495672_0023035 | Ga0495672_0023035_1218_2024 | 260 |
| 360 | 3300048903 | Ga0496100_0229419 | Ga0496100_0229419_48_833 | 260 |
| 361 | 3300048904 | Ga0496101_0016829 | Ga0496101_0016829_2601_3386 | 260 |
| 362 | 3300048905 | Ga0496102_0115853 | Ga0496102_0115853_1130_1915 | 260 |
| 363 | 3300048909 | Ga0496106_0009208 | Ga0496106_0009208_4970_5755 | 260 |
| 364 | 3300048911 | Ga0496108_0438671 | Ga0496108_0438671_63_848 | 260 |
| 365 | 3300048913 | Ga0496110_0102329 | Ga0496110_0102329_652_1452 | 260 |
| 366 | 3300049568 | Ga0501031_0079580 | Ga0501031_0079580_1135_1920 | 260 |
| 367 | 3300049568 | Ga0501031_0081658 | Ga0501031_0081658_77_862 | 260 |
| 368 | 3300049568 | Ga0501031_0119502 | Ga0501031_0119502_740_1549 | 260 |
| 369 | 3300049568 | Ga0501031_0371922 | Ga0501031_0371922_128_910 | 260 |
| 370 | 3300049569 | Ga0501032_0010187 | Ga0501032_0010187_3551_4336 | 260 |
| 371 | 3300049569 | Ga0501032_0022595 | Ga0501032_0022595_601_1404 | 260 |
| 372 | 3300049569 | Ga0501032_0202238 | Ga0501032_0202238_439_1224 | 260 |
| 373 | 3300049569 | Ga0501032_0333220 | Ga0501032_0333220_109_912 | 260 |
| 374 | 3300049569 | Ga0501032_0440732 | Ga0501032_0440732_29_823 | 260 |
| 375 | 3300049570 | Ga0501033_0012549 | Ga0501033_0012549_2669_3472 | 260 |
| 376 | 3300049570 | Ga0501033_0052224 | Ga0501033_0052224_1978_2763 | 260 |
| 377 | 3300049571 | Ga0501034_0009514 | Ga0501034_0009514_2961_3746 | 260 |
| 378 | 3300049571 | Ga0501034_0023476 | Ga0501034_0023476_5314_6099 | 260 |
| 379 | 3300049571 | Ga0501034_0032696 | Ga0501034_0032696_2950_3732 | 260 |
| 380 | 3300049571 | Ga0501034_0125719 | Ga0501034_0125719_1570_2433 | 260 |
| 381 | 3300049571 | Ga0501034_0134576 | Ga0501034_0134576_255_1058 | 260 |
| 382 | 3300049571 | Ga0501034_0177083 | Ga0501034_0177083_519_1322 | 260 |
| 383 | 3300049571 | Ga0501034_0464370 | Ga0501034_0464370_367_1152 | 260 |
| 384 | 3300049572 | Ga0501036_0002162 | Ga0501036_0002162_1990_2775 | 260 |
| 385 | 3300049572 | Ga0501036_0034806 | Ga0501036_0034806_2489_3274 | 260 |
| 386 | 3300049572 | Ga0501036_0365744 | Ga0501036_0365744_344_1147 | 260 |
| 387 | 3300049572 | Ga0501036_0366531 | Ga0501036_0366531_228_1013 | 260 |
| 388 | 3300049573 | Ga0501037_0011718 | Ga0501037_0011718_2654_3439 | 260 |
| 389 | 3300049573 | Ga0501037_0066608 | Ga0501037_0066608_1240_2025 | 260 |
| 390 | 3300049573 | Ga0501037_0069521 | Ga0501037_0069521_51_836 | 260 |
| 391 | 3300049573 | Ga0501037_0127836 | Ga0501037_0127836_593_1396 | 260 |
| 392 | 3300049574 | Ga0501038_0047080 | Ga0501038_0047080_1560_2345 | 260 |
| 393 | 3300049574 | Ga0501038_0066828 | Ga0501038_0066828_684_1487 | 260 |
| 394 | 3300049574 | Ga0501038_0135475 | Ga0501038_0135475_221_1006 | 260 |
| 395 | 3300049575 | Ga0501039_0006642 | Ga0501039_0006642_1990_2775 | 260 |
| 396 | 3300049575 | Ga0501039_0092276 | Ga0501039_0092276_611_1414 | 260 |
| 397 | 3300049575 | Ga0501039_0402516 | Ga0501039_0402516_243_1055 | 260 |
| 398 | 3300049578 | Ga0501042_0016185 | Ga0501042_0016185_87_872 | 260 |
| 399 | 3300049579 | Ga0501043_0025661 | Ga0501043_0025661_1702_2487 | 260 |
| 400 | 3300049579 | Ga0501043_0045010 | Ga0501043_0045010_41_826 | 260 |
| 401 | 3300049579 | Ga0501043_0232101 | Ga0501043_0232101_271_1089 | 260 |
| 402 | 3300049580 | Ga0501046_0041616 | Ga0501046_0041616_1031_1816 | 260 |
| 403 | 3300049581 | Ga0501047_0030752 | Ga0501047_0030752_1698_2483 | 260 |
| 404 | 3300049581 | Ga0501047_0042681 | Ga0501047_0042681_908_1699 | 260 |
| 405 | 3300049581 | Ga0501047_0052194 | Ga0501047_0052194_2128_2913 | 260 |
| 406 | 3300049581 | Ga0501047_0097247 | Ga0501047_0097247_1156_1956 | 260 |
| 407 | 3300049581 | Ga0501047_0145932 | Ga0501047_0145932_933_1736 | 260 |
| 408 | 3300049581 | Ga0501047_0153146 | Ga0501047_0153146_801_1619 | 260 |
| 409 | 3300049581 | Ga0501047_0167681 | Ga0501047_0167681_851_1636 | 260 |
| 410 | 3300049581 | Ga0501047_0345157 | Ga0501047_0345157_244_1062 | 260 |
| 411 | 3300049581 | Ga0501047_0439786 | Ga0501047_0439786_153_944 | 260 |
| 412 | 3300049582 | Ga0501048_0004586 | Ga0501048_0004586_4115_4900 | 260 |
| 413 | 3300049583 | Ga0501067_0010373 | Ga0501067_0010373_2872_3657 | 260 |
| 414 | 3300049583 | Ga0501067_0045165 | Ga0501067_0045165_1200_1985 | 260 |
| 415 | 3300049583 | Ga0501067_0082853 | Ga0501067_0082853_853_1653 | 260 |
| 416 | 3300049584 | Ga0501068_0001004 | Ga0501068_0001004_1676_2476 | 260 |
| 417 | 3300049584 | Ga0501068_0010693 | Ga0501068_0010693_2431_3216 | 260 |
| 418 | 3300049584 | Ga0501068_0014408 | Ga0501068_0014408_2622_3422 | 260 |
| 419 | 3300049585 | Ga0501069_0003270 | Ga0501069_0003270_2564_3349 | 260 |
| 420 | 3300049585 | Ga0501069_0030841 | Ga0501069_0030841_552_1349 | 260 |
| 421 | 3300049585 | Ga0501069_0050400 | Ga0501069_0050400_1112_1918 | 260 |
| 422 | 3300049585 | Ga0501069_0123399 | Ga0501069_0123399_269_1069 | 260 |
| 423 | 3300049586 | Ga0501070_0017208 | Ga0501070_0017208_2835_3620 | 260 |
| 424 | 3300049586 | Ga0501070_0036013 | Ga0501070_0036013_293_1111 | 260 |
| 425 | 3300049586 | Ga0501070_0049764 | Ga0501070_0049764_1198_1998 | 260 |
| 426 | 3300049587 | Ga0501071_0006157 | Ga0501071_0006157_122_907 | 260 |
| 427 | 3300049588 | Ga0501072_0028980 | Ga0501072_0028980_1169_1951 | 260 |
| 428 | 3300049588 | Ga0501072_0315028 | Ga0501072_0315028_429_1229 | 260 |
| 429 | 3300049588 | Ga0501072_0322472 | Ga0501072_0322472_250_1044 | 260 |
| 430 | 3300049589 | Ga0501073_0005130 | Ga0501073_0005130_1977_2762 | 260 |
| 431 | 3300049589 | Ga0501073_0076716 | Ga0501073_0076716_1202_1987 | 260 |
| 432 | 3300049589 | Ga0501073_0437655 | Ga0501073_0437655_17_817 | 260 |
| 433 | 3300049590 | Ga0501074_0015123 | Ga0501074_0015123_1978_2763 | 260 |
| 434 | 3300049590 | Ga0501074_0020517 | Ga0501074_0020517_1188_1988 | 260 |
| 435 | 3300049742 | Ga0501080_0024265 | Ga0501080_0024265_1990_2775 | 260 |
| 436 | 3300049742 | Ga0501080_0039674 | Ga0501080_0039674_330_1130 | 260 |
| 437 | 3300049742 | Ga0501080_0068143 | Ga0501080_0068143_41_826 | 260 |
| 438 | 3300049744 | Ga0501083_0010177 | Ga0501083_0010177_1442_2227 | 260 |
| 439 | 3300049744 | Ga0501083_0383573 | Ga0501083_0383573_64_867 | 260 |
| 440 | 3300049822 | Ga0501035_0038073 | Ga0501035_0038073_267_1052 | 260 |
| 441 | 3300049822 | Ga0501035_0386643 | Ga0501035_0386643_233_1027 | 260 |
| 442 | 3300049823 | Ga0501044_0002073 | Ga0501044_0002073_14645_15430 | 260 |
| 443 | 3300049823 | Ga0501044_0047317 | Ga0501044_0047317_1039_1824 | 260 |
| 444 | 3300049823 | Ga0501044_0051432 | Ga0501044_0051432_319_1104 | 260 |
| 445 | 3300049823 | Ga0501044_0078196 | Ga0501044_0078196_2513_3331 | 260 |
| 446 | 3300049823 | Ga0501044_0089372 | Ga0501044_0089372_1287_2150 | 260 |
| 447 | 3300049823 | Ga0501044_0220406 | Ga0501044_0220406_488_1273 | 260 |
| 448 | 3300049823 | Ga0501044_0288064 | Ga0501044_0288064_577_1380 | 260 |
| 449 | 3300049823 | Ga0501044_0368252 | Ga0501044_0368252_533_1318 | 260 |
| 450 | 3300049823 | Ga0501044_0561725 | Ga0501044_0561725_75_860 | 260 |
| 451 | 3300049823 | Ga0501044_0729682 | Ga0501044_0729682_47_832 | 260 |
| 452 | 3300049824 | Ga0501045_0007068 | Ga0501045_0007068_5711_6496 | 260 |
| 453 | 3300050490 | nmdc:mga03n38_91806_c1 | nmdc:mga03n38_91806_c1_286_1080 | 260 |
| 454 | 3300050492 | nmdc:mga0yw44_162373_c1 | nmdc:mga0yw44_162373_c1_416_1204 | 260 |
| 455 | 3300050492 | nmdc:mga0yw44_47932_c1 | nmdc:mga0yw44_47932_c1_1247_2035 | 260 |
| 456 | 3300050507 | nmdc:mga05p37_1239_c1 | nmdc:mga05p37_1239_c1_24524_25309 | 260 |
| 457 | 3300050507 | nmdc:mga05p37_213_c1 | nmdc:mga05p37_213_c1_8435_9220 | 260 |
| 458 | 3300050508 | nmdc:mga09592_3152_c1 | nmdc:mga09592_3152_c1_9256_10041 | 260 |
| 459 | 3300050508 | nmdc:mga09592_5003_c1 | nmdc:mga09592_5003_c1_5514_6299 | 260 |
| 460 | 3300050509 | nmdc:mga0qj67_15592_c1 | nmdc:mga0qj67_15592_c1_4631_5416 | 260 |
| 461 | 3300050509 | nmdc:mga0qj67_7072_c1 | nmdc:mga0qj67_7072_c1_125_910 | 260 |
| 462 | 3300050510 | nmdc:mga06r32_4393_c1 | nmdc:mga06r32_4393_c1_2309_3094 | 260 |
| 463 | 3300050510 | nmdc:mga06r32_571_c1 | nmdc:mga06r32_571_c1_21202_21987 | 260 |
| 464 | 3300050511 | nmdc:mga08y16_5337_c1 | nmdc:mga08y16_5337_c1_2854_3639 | 260 |
| 465 | 3300050511 | nmdc:mga08y16_6730_c1 | nmdc:mga08y16_6730_c1_3900_4685 | 260 |
| 466 | 3300050512 | nmdc:mga0n895_1733_c1 | nmdc:mga0n895_1733_c1_11805_12590 | 260 |
| 467 | 3300050513 | nmdc:mga0rr50_1133_c1 | nmdc:mga0rr50_1133_c1_12637_13422 | 260 |
| 468 | 3300050515 | nmdc:mga0a205_1982_c1 | nmdc:mga0a205_1982_c1_7578_8363 | 260 |
| 469 | 3300050516 | nmdc:mga0sz30_100177_c1 | nmdc:mga0sz30_100177_c1_231_1016 | 260 |
| 470 | 3300050516 | nmdc:mga0sz30_166930_c1 | nmdc:mga0sz30_166930_c1_133_918 | 260 |
| 471 | 3300050516 | nmdc:mga0sz30_25000_c1 | nmdc:mga0sz30_25000_c1_345_1133 | 260 |
| 472 | 3300053086 | Ga0500578_0028212 | Ga0500578_0028212_674_1468 | 260 |
| 473 | 3300053093 | Ga0500651_0152448 | Ga0500651_0152448_425_1219 | 260 |
| 474 | 3300053096 | Ga0500641_0000482 | Ga0500641_0000482_7271_8059 | 260 |
| 475 | 3300053096 | Ga0500641_0043876 | Ga0500641_0043876_322_1116 | 260 |
| 476 | 3300053146 | Ga0500588_0000536 | Ga0500588_0000536_225_1019 | 260 |
| 477 | 3300053151 | Ga0500604_0055819 | Ga0500604_0055819_89_901 | 260 |
| 478 | 3300053153 | Ga0500616_0000888 | Ga0500616_0000888_13683_14477 | 260 |
| 479 | 3300053731 | Ga0500609_003907 | Ga0500609_003907_905_1699 | 260 |
| 480 | 3300054114 | Ga0501084_0011858 | Ga0501084_0011858_6062_6847 | 260 |
| 481 | 3300054114 | Ga0501084_0256640 | Ga0501084_0256640_29_811 | 260 |
| 482 | 3300060353 | Ga0501082_0000183 | Ga0501082_0000183_40368_41153 | 260 |
| 483 | 3300060353 | Ga0501082_0043102 | Ga0501082_0043102_804_1589 | 260 |
| 484 | iso_pu_bacteria | 2643221651 | 2644288962 | 260 |
| 485 | iso_pu_bacteria | 2938014810 | 2938017800 | 260 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6d9z-assembly1.cif.gz_B | structure of cysz, a sulfate permease from pseudomonas denitrificans | 0.5111 | 29 | 257 |
| 6d9z-assembly1.cif.gz_B | structure of cysz, a sulfate permease from pseudomonas denitrificans | 0.4973 | 29 | 257 |
| 7wwb-assembly1.cif.gz_B | choline transporter-like protein 1 | 0.459 | 43 | 259 |
| 5vox-assembly1.cif.gz_W | yeast v-atpase in complex with legionella pneumophila effector sidk (rotational state 1) | 0.4319 | 72 | 224 |
| 5vox-assembly1.cif.gz_W | yeast v-atpase in complex with legionella pneumophila effector sidk (rotational state 1) | 0.4114 | 72 | 224 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_I1KMF2_37_348_1.20.1070.10 | Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins | 0.4858 | 26 | 259 | 1.20.1070.10 |
| af_I1KMF2_37_348_1.20.1070.10 | Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins | 0.4443 | 26 | 259 | 1.20.1070.10 |
| af_P34651_608_792_1.20.120.1900 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Gamma-tubulin complex, C-terminal domain | 0.3477 | 75 | 219 | 1.20.120.1900 |
| af_O94344_10_254_1.50.40.10 | Mainly Alpha;Alpha/alpha barrel;Mitochondrial carrier fold;Mitochondrial carrier domain | 0.3405 | 15 | 256 | 1.50.40.10 |
| af_Q9LV18_10_217_1.20.58.390 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Neurotransmitter-gated ion-channel transmembrane domain | 0.3389 | 25 | 221 | 1.20.58.390 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A5C7LXK7-F1-model_v4 | deleted | 0.9847 | 1 | 260 |
|
| AF-A0A1H3NZQ1-F1-model_v4 | Uncharacterized membrane protein | 0.9731 | 2 | 260 |
GO:0016020
|
| AF-A0A3B8XPI4-F1-model_v4 | DUF2189 domain-containing protein | 0.9728 | 21 | 258 |
GO:0016020
|
| AF-A0A2H5F658-F1-model_v4 | DUF2189 domain-containing protein | 0.972 | 18 | 260 |
GO:0016020
|
| AF-A0A3M0ZZ04-F1-model_v4 | DUF2189 domain-containing protein | 0.971 | 21 | 258 |
GO:0016020
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar