F453166

General Info

Members Datasets Scaffolds Average Seq Length
485 278 970 138

Family's Representative Sequence

Representative Sequence 3300048915|Ga0496112_0065409|Ga0496112_0065409_2985_3464
Length 159
Sequence MRIRILRARRDPEDTMPKVEITRLGAGDVEKVIAAADLFDRQPKRDATARFLAEPGHHLLIAYDGSTPIGFVSGIETVHPDKGAEMFLYELGVAEAHRRRGVGRALVERLAGIARSLDCYGMWVATDDANTAALATYEAAGATRDDQPAVILTWSFRER

Samples

Sample ID Description Type Environment
1 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
59 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
62 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
73 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
89 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
97 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
101 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
102 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
150 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
151 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
152 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
153 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
154 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
155 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
156 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
157 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
158 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
159 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
160 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
161 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
162 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
163 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
164 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
165 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
166 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
167 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
168 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
169 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
170 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
171 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
172 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
173 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
174 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
175 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
176 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
177 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
178 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
179 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
180 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
181 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
182 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
183 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
184 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
185 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
186 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
187 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
188 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
189 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
190 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
191 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
192 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
193 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
194 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
195 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
196 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
197 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
198 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
199 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
200 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
201 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
202 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
203 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
204 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
205 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
206 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
207 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
208 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
209 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
210 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
211 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
212 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
213 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
214 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
215 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
216 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
217 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
218 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
219 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
220 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
221 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
222 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
223 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
224 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
225 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
226 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
227 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
228 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
229 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
230 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
231 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
232 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
233 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
234 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
235 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
236 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
237 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
238 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
239 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
240 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
241 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
242 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
243 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
244 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
245 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
246 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
247 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
248 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
249 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
250 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
251 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
252 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
253 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
254 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
255 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
258 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
259 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
260 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
261 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
262 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
263 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
264 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
265 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
266 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
267 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
268 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
269 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
270 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
271 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
272 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
273 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
274 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
275 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
276 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
277 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
278 2643221631 Kitasatospora sp. Root107 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.59
Metatranscriptomes 0.21
Isolates 0.21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.41
Nodule 0
Rhizoplane 10.93
Rhizosphere 87.63
Stem 0
Stem Tuber 0
Unclassified 1.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496112_0065409 3300048915 Bacteria 3588
2 JGI25407J50210_10001718 3300003373 Bacteria 5025
3 JGI25407J50210_10160851 3300003373 Bacteria 553
4 Ga0065715_10452157 3300005293 Unclassified 825
5 Ga0070676_10080651 3300005328 Bacteria 1973
6 Ga0070676_10606570 3300005328 Bacteria 790
7 Ga0070683_100001475 3300005329 Bacteria 18118
8 Ga0070683_100619559 3300005329 Bacteria 1036
9 Ga0070690_100165862 3300005330 Bacteria 1517
10 Ga0070670_100165372 3300005331 Bacteria 1918
11 Ga0068869_100061108 3300005334 Bacteria 2762
12 Ga0070682_100013190 3300005337 Bacteria 4749
13 Ga0068868_100006166 3300005338 Bacteria 8478
14 Ga0068868_100483606 3300005338 Bacteria 1082
15 Ga0068868_101026348 3300005338 Bacteria 756
16 Ga0070660_100018639 3300005339 Bacteria 5074
17 Ga0070689_100813586 3300005340 Bacteria 822
18 Ga0070691_10036697 3300005341 Bacteria 2311
19 Ga0070661_100501205 3300005344 Bacteria 972
20 Ga0070661_101007463 3300005344 Bacteria 691
21 Ga0070692_10242155 3300005345 Bacteria 1076
22 Ga0070675_100163857 3300005354 Bacteria 1914
23 Ga0070674_100139663 3300005356 Bacteria 1817
24 Ga0070673_100365211 3300005364 Bacteria 1284
25 Ga0070673_100442123 3300005364 Bacteria 1169
26 Ga0070673_101186148 3300005364 Bacteria 715
27 Ga0070659_100394584 3300005366 Bacteria 1167
28 Ga0070659_100440678 3300005366 Bacteria 1104
29 Ga0070709_10243354 3300005434 Bacteria 1293
30 Ga0070714_100080859 3300005435 Bacteria 2828
31 Ga0070714_100798814 3300005435 Bacteria 914
32 Ga0070714_101939725 3300005435 Bacteria 575
33 Ga0070710_10000261 3300005437 Bacteria 25090
34 Ga0070701_10318175 3300005438 Bacteria 962
35 Ga0070711_101523944 3300005439 Bacteria 583
36 Ga0070700_100010804 3300005441 Bacteria 5047
37 Ga0070700_101378193 3300005441 Bacteria 595
38 Ga0070708_100307098 3300005445 Bacteria 1494
39 Ga0070663_101871519 3300005455 Bacteria 539
40 Ga0070678_100155492 3300005456 Bacteria 1847
41 Ga0070678_100690004 3300005456 Bacteria 919
42 Ga0070662_100477170 3300005457 Bacteria 1038
43 Ga0070681_10093352 3300005458 Bacteria 2958
44 Ga0068867_100136579 3300005459 Bacteria 1912
45 Ga0068867_100200616 3300005459 Bacteria 1597
46 Ga0068867_100779560 3300005459 Bacteria 851
47 Ga0070706_100002627 3300005467 Bacteria 18004
48 Ga0070706_100484454 3300005467 Bacteria 1151
49 Ga0070699_100000246 3300005518 Bacteria 53347
50 Ga0070699_100539422 3300005518 Bacteria 1061
51 Ga0070679_100375678 3300005530 Bacteria 1368
52 Ga0070679_100444177 3300005530 Bacteria 1242
53 Ga0070684_100082606 3300005535 Bacteria 2845
54 Ga0070684_100634721 3300005535 Bacteria 994
55 Ga0070684_101034773 3300005535 Bacteria 771
56 Ga0070697_100815883 3300005536 Bacteria 826
57 Ga0070686_100350444 3300005544 Bacteria 1109
58 Ga0070695_100066070 3300005545 Bacteria 2357
59 Ga0070695_100067445 3300005545 Bacteria 2333
60 Ga0070695_100104853 3300005545 Bacteria 1910
61 Ga0070696_100247913 3300005546 Bacteria 1346
62 Ga0070696_100288563 3300005546 Bacteria 1253
63 Ga0070693_100191412 3300005547 Bacteria 1323
64 Ga0070693_100377931 3300005547 Bacteria 976
65 Ga0070665_100058713 3300005548 Bacteria 3856
66 Ga0070665_101359224 3300005548 Bacteria 720
67 Ga0070704_100173643 3300005549 Bacteria 1717
68 Ga0070704_100743028 3300005549 Bacteria 873
69 Ga0070704_101125120 3300005549 Bacteria 714
70 Ga0068855_100036302 3300005563 Bacteria 5867
71 Ga0070664_100029746 3300005564 Bacteria 4555
72 Ga0068857_100002311 3300005577 Bacteria 15480
73 Ga0068854_100059850 3300005578 Bacteria 2754
74 Ga0068854_100796848 3300005578 Bacteria 823
75 Ga0068854_101167346 3300005578 Bacteria 689
76 Ga0068856_100008287 3300005614 Bacteria 10131
77 Ga0068856_100016391 3300005614 Bacteria 7168
78 Ga0068856_100194818 3300005614 Bacteria 2040
79 Ga0070702_100296218 3300005615 Bacteria 1117
80 Ga0068852_100077756 3300005616 Bacteria 2934
81 Ga0068852_102801320 3300005616 Bacteria 506
82 Ga0068859_100111565 3300005617 Bacteria 2797
83 Ga0068859_100522713 3300005617 Bacteria 1282
84 Ga0068859_101673988 3300005617 Bacteria 703
85 Ga0068864_100302559 3300005618 Bacteria 1498
86 Ga0068864_100439531 3300005618 Bacteria 1246
87 Ga0068866_10169980 3300005718 Bacteria 1279
88 Ga0068866_10195665 3300005718 Bacteria 1204
89 Ga0068866_10300704 3300005718 Bacteria 1002
90 Ga0068861_100304202 3300005719 Bacteria 1382
91 Ga0068861_101034556 3300005719 Bacteria 786
92 Ga0068870_10358447 3300005840 Bacteria 938
93 Ga0068858_100051434 3300005842 Bacteria 3811
94 Ga0068860_100341747 3300005843 Bacteria 1472
95 Ga0068862_100257408 3300005844 Bacteria 1592
96 Ga0081455_10018291 3300005937 Bacteria 6682
97 Ga0081538_10000678 3300005981 Bacteria 37442
98 Ga0081538_10033746 3300005981 Bacteria 3399
99 Ga0081538_10037695 3300005981 Bacteria 3130
100 Ga0070717_10575927 3300006028 Bacteria 1020
101 Ga0070716_100525254 3300006173 Bacteria 878
102 Ga0070716_101223357 3300006173 Bacteria 604
103 Ga0070712_100602797 3300006175 Bacteria 930
104 Ga0097621_100148666 3300006237 Bacteria 2008
105 Ga0068871_100752795 3300006358 Bacteria 895
106 Ga0075428_100000495 3300006844 Bacteria 39882
107 Ga0075430_100139474 3300006846 Bacteria 2019
108 Ga0075430_100462752 3300006846 Bacteria 1047
109 Ga0075431_100052327 3300006847 Bacteria 4211
110 Ga0075434_100007093 3300006871 Bacteria 10349
111 Ga0075436_100053655 3300006914 Bacteria 2783
112 Ga0075436_100179791 3300006914 Bacteria 1495
113 Ga0097620_100111558 3300006931 Bacteria 2797
114 Ga0097620_100522687 3300006931 Bacteria 1282
115 Ga0097620_101673824 3300006931 Bacteria 703
116 Ga0075435_100040735 3300007076 Bacteria 3711
117 Ga0075435_100071450 3300007076 Bacteria 2834
118 Ga0075435_101544036 3300007076 Bacteria 582
119 Ga0099794_10050320 3300007265 Bacteria 2004
120 Ga0099794_10249992 3300007265 Unclassified 914
121 Ga0099794_10317621 3300007265 Bacteria 808
122 Ga0105250_10396665 3300009092 Bacteria 611
123 Ga0105240_10273833 3300009093 Bacteria 1942
124 Ga0105245_10033849 3300009098 Bacteria 4528
125 Ga0105245_10245681 3300009098 Bacteria 1737
126 Ga0105245_10487601 3300009098 Bacteria 1247
127 Ga0105245_10492660 3300009098 Bacteria 1240
128 Ga0105245_10681575 3300009098 Unclassified 1060
129 Ga0105245_11113070 3300009098 Bacteria 836
130 Ga0105245_11294908 3300009098 Bacteria 778
131 Ga0105247_10195967 3300009101 Bacteria 1355
132 Ga0114129_10000363 3300009147 Bacteria 52419
133 Ga0114129_10158715 3300009147 Bacteria 3092
134 Ga0114129_10746817 3300009147 Bacteria 1253
135 Ga0105243_10032559 3300009148 Bacteria 4029
136 Ga0105243_10134084 3300009148 Bacteria 2105
137 Ga0105243_10321822 3300009148 Bacteria 1409
138 Ga0105243_10485322 3300009148 Bacteria 1167
139 Ga0105241_10257564 3300009174 Bacteria 1482
140 Ga0105241_10515836 3300009174 Bacteria 1068
141 Ga0105242_10177219 3300009176 Bacteria 1878
142 Ga0105242_10701304 3300009176 Bacteria 990
143 Ga0105242_10946098 3300009176 Unclassified 865
144 Ga0105248_10461468 3300009177 Bacteria 1432
145 Ga0105237_10020014 3300009545 Bacteria 6909
146 Ga0105238_10062363 3300009551 Bacteria 3729
147 Ga0105249_10145286 3300009553 Bacteria 2278
148 Ga0105249_10667697 3300009553 Bacteria 1098
149 Ga0105249_10693144 3300009553 Bacteria 1078
150 Ga0105249_11308399 3300009553 Bacteria 796
151 Ga0099796_10128505 3300010159 Bacteria 980
152 Ga0105239_10473643 3300010375 Bacteria 1422
153 Ga0105239_10544114 3300010375 Bacteria 1322
154 Ga0105239_10590779 3300010375 Bacteria 1266
155 Ga0105239_11265373 3300010375 Bacteria 851
156 Ga0105239_12481531 3300010375 Bacteria 604
157 Ga0105246_10002414 3300011119 Bacteria 11270
158 Ga0105246_10170181 3300011119 Bacteria 1668
159 Ga0157371_10672936 3300013102 Bacteria 773
160 Ga0157369_10294946 3300013105 Bacteria 1688
161 Ga0157369_10310055 3300013105 Bacteria 1641
162 Ga0157374_10045276 3300013296 Bacteria 4072
163 Ga0157378_10447994 3300013297 Bacteria 1281
164 Ga0157378_10500036 3300013297 Bacteria 1214
165 Ga0163162_10468766 3300013306 Bacteria 1391
166 Ga0163162_11650026 3300013306 Bacteria 732
167 Ga0163162_11798301 3300013306 Bacteria 700
168 Ga0163162_12669094 3300013306 Bacteria 575
169 Ga0157372_12245686 3300013307 Bacteria 627
170 Ga0157375_10009036 3300013308 Bacteria 8725
171 Ga0157375_10061149 3300013308 Bacteria 3739
172 Ga0163163_10233131 3300014325 Bacteria 1890
173 Ga0163163_10554813 3300014325 Bacteria 1211
174 Ga0157380_10087905 3300014326 Bacteria 2556
175 Ga0157380_10722298 3300014326 Bacteria 1004
176 Ga0157380_11387744 3300014326 Bacteria 753
177 Ga0157377_10014343 3300014745 Bacteria 4030
178 Ga0157377_11729450 3300014745 Bacteria 505
179 Ga0157379_10044377 3300014968 Bacteria 3969
180 Ga0157376_10155891 3300014969 Bacteria 2065
181 Ga0163161_11667842 3300017792 Bacteria 564
182 Ga0213876_10051662 3300021384 Bacteria 2172
183 Ga0207692_10000314 3300025898 Bacteria 16829
184 Ga0207692_10014420 3300025898 Bacteria 3453
185 Ga0207642_10146217 3300025899 Bacteria 1252
186 Ga0207710_10015958 3300025900 Bacteria 3176
187 Ga0207688_10000608 3300025901 Bacteria 17635
188 Ga0207688_10077675 3300025901 Bacteria 1892
189 Ga0207688_10335640 3300025901 Bacteria 929
190 Ga0207699_10120761 3300025906 Bacteria 1694
191 Ga0207699_10496226 3300025906 Bacteria 881
192 Ga0207645_10250036 3300025907 Bacteria 1173
193 Ga0207645_10283387 3300025907 Bacteria 1101
194 Ga0207684_10002331 3300025910 Bacteria 19242
195 Ga0207654_10045049 3300025911 Bacteria 2509
196 Ga0207695_10329234 3300025913 Bacteria 1416
197 Ga0207671_10088849 3300025914 Bacteria 2325
198 Ga0207693_10518184 3300025915 Bacteria 930
199 Ga0207663_11210490 3300025916 Bacteria 608
200 Ga0207663_11598479 3300025916 Bacteria 525
201 Ga0207662_10212023 3300025918 Bacteria 1258
202 Ga0207657_10004577 3300025919 Bacteria 14619
203 Ga0207657_11334393 3300025919 Bacteria 541
204 Ga0207649_10405603 3300025920 Bacteria 1021
205 Ga0207649_10866943 3300025920 Bacteria 707
206 Ga0207652_10502028 3300025921 Bacteria 1092
207 Ga0207652_10948159 3300025921 Bacteria 758
208 Ga0207694_10004064 3300025924 Bacteria 11502
209 Ga0207650_10102522 3300025925 Bacteria 2205
210 Ga0207687_10001872 3300025927 Bacteria 14481
211 Ga0207687_10034049 3300025927 Bacteria 3457
212 Ga0207687_10275653 3300025927 Bacteria 1346
213 Ga0207690_10019328 3300025932 Bacteria 4193
214 Ga0207706_10475195 3300025933 Bacteria 1080
215 Ga0207686_11312934 3300025934 Bacteria 594
216 Ga0207709_10145445 3300025935 Bacteria 1635
217 Ga0207709_10176346 3300025935 Bacteria 1505
218 Ga0207709_10291373 3300025935 Bacteria 1210
219 Ga0207669_10093772 3300025937 Bacteria 1963
220 Ga0207669_10500705 3300025937 Bacteria 972
221 Ga0207669_11108556 3300025937 Bacteria 668
222 Ga0207665_10531948 3300025939 Bacteria 911
223 Ga0207665_10964643 3300025939 Bacteria 678
224 Ga0207691_10089006 3300025940 Bacteria 2769
225 Ga0207691_10120551 3300025940 Bacteria 2325
226 Ga0207689_10074107 3300025942 Bacteria 2797
227 Ga0207689_10145980 3300025942 Bacteria 1949
228 Ga0207689_11829322 3300025942 Bacteria 501
229 Ga0207661_10004084 3300025944 Bacteria 10196
230 Ga0207661_10082327 3300025944 Bacteria 2661
231 Ga0207661_10524031 3300025944 Bacteria 1084
232 Ga0207679_10044738 3300025945 Bacteria 3197
233 Ga0207679_10271116 3300025945 Bacteria 1451
234 Ga0207667_10007980 3300025949 Bacteria 12627
235 Ga0207651_10101990 3300025960 Bacteria 2132
236 Ga0207651_10574056 3300025960 Bacteria 983
237 Ga0207651_10649483 3300025960 Bacteria 926
238 Ga0207712_10377033 3300025961 Bacteria 1186
239 Ga0207712_10550742 3300025961 Bacteria 992
240 Ga0207668_10371691 3300025972 Bacteria 1201
241 Ga0207668_10724566 3300025972 Bacteria 876
242 Ga0207668_11299364 3300025972 Bacteria 655
243 Ga0207640_10128112 3300025981 Bacteria 1830
244 Ga0207640_10156623 3300025981 Bacteria 1680
245 Ga0207677_10008051 3300026023 Bacteria 5869
246 Ga0207677_10187495 3300026023 Bacteria 1633
247 Ga0207703_10036068 3300026035 Bacteria 3933
248 Ga0207678_10351469 3300026067 Bacteria 1271
249 Ga0207678_10737447 3300026067 Bacteria 868
250 Ga0207678_11293737 3300026067 Bacteria 645
251 Ga0207708_10020962 3300026075 Bacteria 4931
252 Ga0207708_10022958 3300026075 Bacteria 4712
253 Ga0207708_10061189 3300026075 Bacteria 2874
254 Ga0207702_10021508 3300026078 Bacteria 5341
255 Ga0207702_10166465 3300026078 Bacteria 2017
256 Ga0207702_10922491 3300026078 Bacteria 866
257 Ga0207648_10035385 3300026089 Bacteria 4399
258 Ga0207648_10291076 3300026089 Bacteria 1462
259 Ga0207648_10623968 3300026089 Bacteria 995
260 Ga0207676_10283633 3300026095 Bacteria 1505
261 Ga0207674_10008051 3300026116 Bacteria 12219
262 Ga0207675_100107689 3300026118 Bacteria 2628
263 Ga0207675_100159644 3300026118 Bacteria 2150
264 Ga0207683_10007857 3300026121 Bacteria 9127
265 Ga0207698_10048644 3300026142 Bacteria 3221
266 Ga0207698_11895737 3300026142 Bacteria 611
267 Ga0268266_10063425 3300028379 Bacteria 3190
268 Ga0268264_10331924 3300028381 Bacteria 1441
269 Ga0307517_10382887 3300028786 Bacteria 751
270 Ga0265338_10011023 3300028800 Bacteria 10495
271 Ga0265338_10026869 3300028800 Bacteria 5792
272 Ga0316177_1105704 3300030731 Bacteria 1099
273 Ga0314311_1183243 3300030733 Bacteria 10548
274 Ga0316181_1206026 3300030744 Bacteria 759
275 Ga0265760_10247244 3300031090 Bacteria 616
276 Ga0265332_10184322 3300031238 Bacteria 869
277 Ga0307509_10266176 3300031507 Bacteria 1485
278 Ga0307413_10036782 3300031824 Bacteria 2822
279 Ga0307410_10103959 3300031852 Bacteria 2041
280 Ga0307412_10338315 3300031911 Bacteria 1204
281 Ga0307409_100372991 3300031995 Bacteria 1354
282 Ga0307409_100671428 3300031995 Bacteria 1032
283 Ga0307416_100008828 3300032002 Bacteria 6539
284 Ga0307414_10493837 3300032004 Bacteria 1082
285 Ga0307415_100003992 3300032126 Bacteria 7599
286 Ga0307415_100070552 3300032126 Bacteria 2454
287 Ga0373926_0001649 3300035083 Bacteria 6900
288 Ga0373926_0048157 3300035083 Bacteria 1532
289 Ga0373944_0022548 3300035089 Bacteria 1830
290 Ga0373936_0163733 3300035113 Bacteria 970
291 Ga0373945_0006296 3300035116 Bacteria 3821
292 Ga0373957_0440078 3300035120 Bacteria 564
293 Ga0373943_0006599 3300035170 Bacteria 5202
294 Ga0373946_0010719 3300035171 Bacteria 3403
295 Ga0373946_0012219 3300035171 Bacteria 3211
296 Ga0373955_0032067 3300035172 Bacteria 2755
297 Ga0373935_0001809 3300035692 Bacteria 12013
298 Ga0373935_1089479 3300035692 Bacteria 594
299 Ga0373927_0030809 3300035695 Bacteria 3499
300 Ga0373933_0005838 3300035724 Bacteria 6695
301 Ga0373933_0167617 3300035724 Bacteria 1397
302 Ga0373947_0000079 3300035725 Bacteria 49190
303 Ga0373947_0007997 3300035725 Bacteria 6099
304 Ga0373937_0036798 3300036401 Bacteria 4460
305 Ga0373937_0248451 3300036401 Bacteria 1677
306 Ga0373937_0365403 3300036401 Bacteria 1368
307 Ga0373925_0036154 3300037068 Bacteria 3645
308 Ga0373925_0086005 3300037068 Unclassified 2398
309 Ga0395898_0004140 3300037466 Bacteria 15900
310 Ga0395898_0025773 3300037466 Bacteria 5922
311 Ga0395901_0076533 3300038443 Bacteria 3491
312 Ga0395901_0150339 3300038443 Bacteria 2447
313 Ga0451797_0516812 3300041453 Bacteria 959
314 Ga0451800_1371201 3300041459 Bacteria 689
315 Ga0451807_1870713 3300041486 Bacteria 513
316 Ga0451853_3701077 3300041512 Bacteria 958
317 Ga0466972_0006035 3300044658 Bacteria 6087
318 Ga0466965_0000601 3300044683 Bacteria 13111
319 Ga0466965_0144209 3300044683 Bacteria 1242
320 Ga0466961_0792252 3300044693 Bacteria 566
321 Ga0466963_0008711 3300044694 Bacteria 6090
322 Ga0466971_0097762 3300044719 Bacteria 1347
323 Ga0466968_0052772 3300044735 Bacteria 1740
324 Ga0466968_0404372 3300044735 Bacteria 670
325 Ga0466957_0003986 3300044842 Bacteria 8166
326 Ga0466960_0003940 3300044901 Bacteria 5763
327 Ga0466958_0012843 3300045836 Bacteria 4753
328 Ga0466958_0188533 3300045836 Bacteria 1310
329 Ga0466958_0808459 3300045836 Bacteria 611
330 Ga0466967_0017418 3300045976 Bacteria 5703
331 Ga0466967_0034602 3300045976 Bacteria 4290
332 Ga0466967_1741209 3300045976 Bacteria 620
333 Ga0466967_1907804 3300045976 Unclassified 591
334 Ga0495603_0016646 3300046455 Bacteria 4449
335 Ga0495629_0022988 3300046459 Bacteria 4443
336 Ga0495629_0484068 3300046459 Bacteria 836
337 Ga0495641_0010940 3300046461 Bacteria 5210
338 Ga0495651_0079008 3300046462 Bacteria 2487
339 Ga0495653_0059417 3300046463 Bacteria 2901
340 Ga0495580_0027478 3300046472 Bacteria 4140
341 Ga0495639_0002393 3300046475 Bacteria 8204
342 Ga0495662_0038625 3300046476 Bacteria 2307
343 Ga0495662_0046881 3300046476 Bacteria 2086
344 Ga0495594_0303021 3300046499 Bacteria 910
345 Ga0495583_0242542 3300046506 Bacteria 724
346 Ga0495608_0447818 3300046511 Bacteria 786
347 Ga0495608_0618249 3300046511 Unclassified 649
348 Ga0495608_0677687 3300046511 Bacteria 615
349 Ga0495618_0043111 3300046514 Bacteria 2846
350 Ga0495618_0639518 3300046514 Unclassified 630
351 Ga0495630_0012304 3300046517 Bacteria 6209
352 Ga0495666_0004233 3300046526 Bacteria 7237
353 Ga0495652_0165031 3300046529 Bacteria 1715
354 Ga0495665_0005412 3300046531 Bacteria 6882
355 Ga0495640_0041983 3300046533 Bacteria 3193
356 Ga0495640_0144208 3300046533 Unclassified 1533
357 Ga0495586_0115875 3300046535 Bacteria 1494
358 Ga0495587_0611953 3300046536 Bacteria 599
359 Ga0495645_0269708 3300046543 Bacteria 1124
360 Ga0495622_0047864 3300046557 Bacteria 1987
361 Ga0495667_0003763 3300046559 Bacteria 10197
362 Ga0495634_0008470 3300046642 Bacteria 7651
363 Ga0495634_0013480 3300046642 Bacteria 5905
364 Ga0495634_0202640 3300046642 Bacteria 1232
365 Ga0495635_0007117 3300046663 Bacteria 7823
366 Ga0495635_0262477 3300046663 Bacteria 1163
367 Ga0495588_0045791 3300046674 Bacteria 2243
368 Ga0495588_0425690 3300046674 Bacteria 697
369 Ga0495657_0020099 3300046675 Bacteria 4805
370 Ga0495647_0196149 3300046681 Bacteria 884
371 Ga0495658_0006566 3300046683 Bacteria 5713
372 Ga0495613_0003353 3300046689 Bacteria 11972
373 Ga0495613_0021422 3300046689 Bacteria 4818
374 Ga0495624_0016865 3300046690 Bacteria 4914
375 Ga0495589_0032820 3300046794 Bacteria 2610
376 Ga0495589_0280086 3300046794 Bacteria 775
377 Ga0495600_0008172 3300046809 Bacteria 6422
378 Ga0495581_0003353 3300047315 Bacteria 9192
379 Ga0495604_0135455 3300047317 Bacteria 1765
380 Ga0495604_0330369 3300047317 Bacteria 1017
381 Ga0495636_0005535 3300047318 Bacteria 4959
382 Ga0495636_0007045 3300047318 Bacteria 4423
383 Ga0495636_0444749 3300047318 Bacteria 622
384 Ga0495674_0026489 3300047319 Bacteria 5304
385 Ga0495676_0013596 3300047321 Bacteria 7308
386 Ga0495676_0334735 3300047321 Bacteria 1014
387 Ga0495680_0034925 3300047322 Bacteria 4054
388 Ga0495680_0211208 3300047322 Bacteria 1389
389 Ga0495687_001148 3300047443 Bacteria 25640
390 Ga0495687_028371 3300047443 Bacteria 2604
391 Ga0495675_0310021 3300047444 Bacteria 935
392 Ga0495677_0232548 3300047445 Bacteria 719
393 Ga0495685_001628 3300047447 Bacteria 6933
394 Ga0495685_215434 3300047447 Bacteria 613
395 Ga0495684_0001140 3300047471 Bacteria 21381
396 Ga0495593_0014477 3300047673 Bacteria 4483
397 Ga0495602_0058551 3300048088 Bacteria 3371
398 Ga0495614_0003655 3300048089 Bacteria 6897
399 Ga0495614_0115277 3300048089 Bacteria 1182
400 Ga0496100_0052499 3300048903 Bacteria 2651
401 Ga0496100_0076212 3300048903 Bacteria 2251
402 Ga0496100_0131454 3300048903 Bacteria 1763
403 Ga0496100_0170905 3300048903 Bacteria 1565
404 Ga0496101_0009448 3300048904 Bacteria 6411
405 Ga0496101_0013460 3300048904 Bacteria 5483
406 Ga0496101_0703856 3300048904 Bacteria 797
407 Ga0496102_0000990 3300048905 Bacteria 26698
408 Ga0496102_0067459 3300048905 Bacteria 3281
409 Ga0496102_0281164 3300048905 Bacteria 1568
410 Ga0496103_0005862 3300048906 Bacteria 7340
411 Ga0496103_0036083 3300048906 Bacteria 3027
412 Ga0496103_0193004 3300048906 Bacteria 1309
413 Ga0496104_0108765 3300048907 Bacteria 2657
414 Ga0496105_0006746 3300048908 Bacteria 8826
415 Ga0496105_0140926 3300048908 Bacteria 1984
416 Ga0496105_0740887 3300048908 Bacteria 751
417 Ga0496106_0002240 3300048909 Bacteria 14417
418 Ga0496106_0024931 3300048909 Bacteria 4447
419 Ga0496106_0774989 3300048909 Bacteria 762
420 Ga0496107_0001146 3300048910 Bacteria 16039
421 Ga0496107_0002204 3300048910 Bacteria 12523
422 Ga0496107_0142540 3300048910 Bacteria 1771
423 Ga0496108_0002368 3300048911 Bacteria 15096
424 Ga0496108_0009285 3300048911 Bacteria 7960
425 Ga0496108_0490164 3300048911 Bacteria 1073
426 Ga0496109_0001101 3300048912 Bacteria 22392
427 Ga0496109_0017562 3300048912 Bacteria 6273
428 Ga0496109_0091792 3300048912 Bacteria 2808
429 Ga0496109_0386940 3300048912 Bacteria 1321
430 Ga0496110_0001341 3300048913 Bacteria 17705
431 Ga0496110_0002045 3300048913 Bacteria 15048
432 Ga0496111_0001615 3300048914 Bacteria 13041
433 Ga0496111_0005155 3300048914 Bacteria 8330
434 Ga0496111_1020719 3300048914 Bacteria 592
435 Ga0496112_0001852 3300048915 Bacteria 16632
436 Ga0496112_0296599 3300048915 Bacteria 1562
437 Ga0496112_0347796 3300048915 Bacteria 1425
438 Ga0496112_0944947 3300048915 Bacteria 783
439 Ga0496112_0952766 3300048915 Bacteria 779
440 Ga0496113_0003723 3300048916 Bacteria 9195
441 Ga0496113_0017029 3300048916 Bacteria 5035
442 Ga0496114_0012059 3300048917 Bacteria 6915
443 Ga0496114_0194019 3300048917 Bacteria 1777
444 Ga0496114_0222898 3300048917 Bacteria 1655
445 Ga0496114_1079074 3300048917 Bacteria 687
446 Ga0496115_0004701 3300048918 Bacteria 9897
447 Ga0496115_0106753 3300048918 Bacteria 2299
448 Ga0496115_0232623 3300048918 Bacteria 1519
449 Ga0501034_0041844 3300049571 Bacteria 4636
450 Ga0501038_0085323 3300049574 Bacteria 2656
451 Ga0501042_0995882 3300049578 Bacteria 611
452 Ga0501067_0703821 3300049583 Bacteria 568
453 Ga0501068_0040786 3300049584 Bacteria 2788
454 Ga0501069_0144662 3300049585 Bacteria 1365
455 Ga0501069_0754943 3300049585 Bacteria 588
456 Ga0501072_0499833 3300049588 Bacteria 962
457 Ga0501080_0823779 3300049742 Bacteria 813
458 nmdc:mga0yw44_438203_c1 3300050492 Bacteria 885
459 nmdc:mga05p37_576768_c1 3300050507 Bacteria 1275
460 nmdc:mga05p37_9335_c1 3300050507 Bacteria 11605
461 nmdc:mga0qj67_284078_c1 3300050509 Bacteria 1341
462 nmdc:mga0qj67_383804_c1 3300050509 Bacteria 1134
463 nmdc:mga0qj67_761152_c1 3300050509 Bacteria 768
464 nmdc:mga06r32_127472_c1 3300050510 Bacteria 2515
465 nmdc:mga06r32_1793217_c1 3300050510 Bacteria 549
466 nmdc:mga06r32_401648_c1 3300050510 Bacteria 1352
467 nmdc:mga0n895_1136182_c1 3300050512 Bacteria 757
468 nmdc:mga0n895_8088_c1 3300050512 Bacteria 9080
469 nmdc:mga0rr50_141754_c1 3300050513 Bacteria 1934
470 nmdc:mga0rr50_1447195_c1 3300050513 Bacteria 581
471 nmdc:mga0rr50_40615_c1 3300050513 Bacteria 3384
472 nmdc:mga08x19_391580_c1 3300050514 Bacteria 974
473 nmdc:mga08x19_55451_c1 3300050514 Bacteria 2554
474 nmdc:mga0a205_208089_c1 3300050515 Bacteria 1845
475 Ga0495601_0135927 3300053077 Bacteria 1602
476 Ga0495601_0680512 3300053077 Bacteria 657
477 Ga0495612_0027231 3300053078 Bacteria 2298
478 Ga0495595_0024967 3300053084 Bacteria 2643
479 Ga0495595_0034338 3300053084 Bacteria 2293
480 Ga0495619_0054733 3300053085 Bacteria 2641
481 Ga0495619_0234090 3300053085 Bacteria 1273
482 Ga0500616_0001415 3300053153 Bacteria 23131
483 Ga0501082_0164676 3300060353 Bacteria 1927
484 Ga0466962_0064892 3300061719 Bacteria 1743
485 2644177083 2643221631 Bacteria 8168043
486 Ga0496112_0065409
487 JGI25407J50210_10001718
488 JGI25407J50210_10160851
489 Ga0065715_10452157
490 Ga0070676_10080651
491 Ga0070676_10606570
492 Ga0070683_100001475
493 Ga0070683_100619559
494 Ga0070690_100165862
495 Ga0070670_100165372
496 Ga0068869_100061108
497 Ga0070682_100013190
498 Ga0068868_100006166
499 Ga0068868_100483606
500 Ga0068868_101026348
501 Ga0070660_100018639
502 Ga0070689_100813586
503 Ga0070691_10036697
504 Ga0070661_100501205
505 Ga0070661_101007463
506 Ga0070692_10242155
507 Ga0070675_100163857
508 Ga0070674_100139663
509 Ga0070673_100365211
510 Ga0070673_100442123
511 Ga0070673_101186148
512 Ga0070659_100394584
513 Ga0070659_100440678
514 Ga0070709_10243354
515 Ga0070714_100080859
516 Ga0070714_100798814
517 Ga0070714_101939725
518 Ga0070710_10000261
519 Ga0070701_10318175
520 Ga0070711_101523944
521 Ga0070700_100010804
522 Ga0070700_101378193
523 Ga0070708_100307098
524 Ga0070663_101871519
525 Ga0070678_100155492
526 Ga0070678_100690004
527 Ga0070662_100477170
528 Ga0070681_10093352
529 Ga0068867_100136579
530 Ga0068867_100200616
531 Ga0068867_100779560
532 Ga0070706_100002627
533 Ga0070706_100484454
534 Ga0070699_100000246
535 Ga0070699_100539422
536 Ga0070679_100375678
537 Ga0070679_100444177
538 Ga0070684_100082606
539 Ga0070684_100634721
540 Ga0070684_101034773
541 Ga0070697_100815883
542 Ga0070686_100350444
543 Ga0070695_100066070
544 Ga0070695_100067445
545 Ga0070695_100104853
546 Ga0070696_100247913
547 Ga0070696_100288563
548 Ga0070693_100191412
549 Ga0070693_100377931
550 Ga0070665_100058713
551 Ga0070665_101359224
552 Ga0070704_100173643
553 Ga0070704_100743028
554 Ga0070704_101125120
555 Ga0068855_100036302
556 Ga0070664_100029746
557 Ga0068857_100002311
558 Ga0068854_100059850
559 Ga0068854_100796848
560 Ga0068854_101167346
561 Ga0068856_100008287
562 Ga0068856_100016391
563 Ga0068856_100194818
564 Ga0070702_100296218
565 Ga0068852_100077756
566 Ga0068852_102801320
567 Ga0068859_100111565
568 Ga0068859_100522713
569 Ga0068859_101673988
570 Ga0068864_100302559
571 Ga0068864_100439531
572 Ga0068866_10169980
573 Ga0068866_10195665
574 Ga0068866_10300704
575 Ga0068861_100304202
576 Ga0068861_101034556
577 Ga0068870_10358447
578 Ga0068858_100051434
579 Ga0068860_100341747
580 Ga0068862_100257408
581 Ga0081455_10018291
582 Ga0081538_10000678
583 Ga0081538_10033746
584 Ga0081538_10037695
585 Ga0070717_10575927
586 Ga0070716_100525254
587 Ga0070716_101223357
588 Ga0070712_100602797
589 Ga0097621_100148666
590 Ga0068871_100752795
591 Ga0075428_100000495
592 Ga0075430_100139474
593 Ga0075430_100462752
594 Ga0075431_100052327
595 Ga0075434_100007093
596 Ga0075436_100053655
597 Ga0075436_100179791
598 Ga0097620_100111558
599 Ga0097620_100522687
600 Ga0097620_101673824
601 Ga0075435_100040735
602 Ga0075435_100071450
603 Ga0075435_101544036
604 Ga0099794_10050320
605 Ga0099794_10249992
606 Ga0099794_10317621
607 Ga0105250_10396665
608 Ga0105240_10273833
609 Ga0105245_10033849
610 Ga0105245_10245681
611 Ga0105245_10487601
612 Ga0105245_10492660
613 Ga0105245_10681575
614 Ga0105245_11113070
615 Ga0105245_11294908
616 Ga0105247_10195967
617 Ga0114129_10000363
618 Ga0114129_10158715
619 Ga0114129_10746817
620 Ga0105243_10032559
621 Ga0105243_10134084
622 Ga0105243_10321822
623 Ga0105243_10485322
624 Ga0105241_10257564
625 Ga0105241_10515836
626 Ga0105242_10177219
627 Ga0105242_10701304
628 Ga0105242_10946098
629 Ga0105248_10461468
630 Ga0105237_10020014
631 Ga0105238_10062363
632 Ga0105249_10145286
633 Ga0105249_10667697
634 Ga0105249_10693144
635 Ga0105249_11308399
636 Ga0099796_10128505
637 Ga0105239_10473643
638 Ga0105239_10544114
639 Ga0105239_10590779
640 Ga0105239_11265373
641 Ga0105239_12481531
642 Ga0105246_10002414
643 Ga0105246_10170181
644 Ga0157371_10672936
645 Ga0157369_10294946
646 Ga0157369_10310055
647 Ga0157374_10045276
648 Ga0157378_10447994
649 Ga0157378_10500036
650 Ga0163162_10468766
651 Ga0163162_11650026
652 Ga0163162_11798301
653 Ga0163162_12669094
654 Ga0157372_12245686
655 Ga0157375_10009036
656 Ga0157375_10061149
657 Ga0163163_10233131
658 Ga0163163_10554813
659 Ga0157380_10087905
660 Ga0157380_10722298
661 Ga0157380_11387744
662 Ga0157377_10014343
663 Ga0157377_11729450
664 Ga0157379_10044377
665 Ga0157376_10155891
666 Ga0163161_11667842
667 Ga0213876_10051662
668 Ga0207692_10000314
669 Ga0207692_10014420
670 Ga0207642_10146217
671 Ga0207710_10015958
672 Ga0207688_10000608
673 Ga0207688_10077675
674 Ga0207688_10335640
675 Ga0207699_10120761
676 Ga0207699_10496226
677 Ga0207645_10250036
678 Ga0207645_10283387
679 Ga0207684_10002331
680 Ga0207654_10045049
681 Ga0207695_10329234
682 Ga0207671_10088849
683 Ga0207693_10518184
684 Ga0207663_11210490
685 Ga0207663_11598479
686 Ga0207662_10212023
687 Ga0207657_10004577
688 Ga0207657_11334393
689 Ga0207649_10405603
690 Ga0207649_10866943
691 Ga0207652_10502028
692 Ga0207652_10948159
693 Ga0207694_10004064
694 Ga0207650_10102522
695 Ga0207687_10001872
696 Ga0207687_10034049
697 Ga0207687_10275653
698 Ga0207690_10019328
699 Ga0207706_10475195
700 Ga0207686_11312934
701 Ga0207709_10145445
702 Ga0207709_10176346
703 Ga0207709_10291373
704 Ga0207669_10093772
705 Ga0207669_10500705
706 Ga0207669_11108556
707 Ga0207665_10531948
708 Ga0207665_10964643
709 Ga0207691_10089006
710 Ga0207691_10120551
711 Ga0207689_10074107
712 Ga0207689_10145980
713 Ga0207689_11829322
714 Ga0207661_10004084
715 Ga0207661_10082327
716 Ga0207661_10524031
717 Ga0207679_10044738
718 Ga0207679_10271116
719 Ga0207667_10007980
720 Ga0207651_10101990
721 Ga0207651_10574056
722 Ga0207651_10649483
723 Ga0207712_10377033
724 Ga0207712_10550742
725 Ga0207668_10371691
726 Ga0207668_10724566
727 Ga0207668_11299364
728 Ga0207640_10128112
729 Ga0207640_10156623
730 Ga0207677_10008051
731 Ga0207677_10187495
732 Ga0207703_10036068
733 Ga0207678_10351469
734 Ga0207678_10737447
735 Ga0207678_11293737
736 Ga0207708_10020962
737 Ga0207708_10022958
738 Ga0207708_10061189
739 Ga0207702_10021508
740 Ga0207702_10166465
741 Ga0207702_10922491
742 Ga0207648_10035385
743 Ga0207648_10291076
744 Ga0207648_10623968
745 Ga0207676_10283633
746 Ga0207674_10008051
747 Ga0207675_100107689
748 Ga0207675_100159644
749 Ga0207683_10007857
750 Ga0207698_10048644
751 Ga0207698_11895737
752 Ga0268266_10063425
753 Ga0268264_10331924
754 Ga0307517_10382887
755 Ga0265338_10011023
756 Ga0265338_10026869
757 Ga0316177_1105704
758 Ga0314311_1183243
759 Ga0316181_1206026
760 Ga0265760_10247244
761 Ga0265332_10184322
762 Ga0307509_10266176
763 Ga0307413_10036782
764 Ga0307410_10103959
765 Ga0307412_10338315
766 Ga0307409_100372991
767 Ga0307409_100671428
768 Ga0307416_100008828
769 Ga0307414_10493837
770 Ga0307415_100003992
771 Ga0307415_100070552
772 Ga0373926_0001649
773 Ga0373926_0048157
774 Ga0373944_0022548
775 Ga0373936_0163733
776 Ga0373945_0006296
777 Ga0373957_0440078
778 Ga0373943_0006599
779 Ga0373946_0010719
780 Ga0373946_0012219
781 Ga0373955_0032067
782 Ga0373935_0001809
783 Ga0373935_1089479
784 Ga0373927_0030809
785 Ga0373933_0005838
786 Ga0373933_0167617
787 Ga0373947_0000079
788 Ga0373947_0007997
789 Ga0373937_0036798
790 Ga0373937_0248451
791 Ga0373937_0365403
792 Ga0373925_0036154
793 Ga0373925_0086005
794 Ga0395898_0004140
795 Ga0395898_0025773
796 Ga0395901_0076533
797 Ga0395901_0150339
798 Ga0451797_0516812
799 Ga0451800_1371201
800 Ga0451807_1870713
801 Ga0451853_3701077
802 Ga0466972_0006035
803 Ga0466965_0000601
804 Ga0466965_0144209
805 Ga0466961_0792252
806 Ga0466963_0008711
807 Ga0466971_0097762
808 Ga0466968_0052772
809 Ga0466968_0404372
810 Ga0466957_0003986
811 Ga0466960_0003940
812 Ga0466958_0012843
813 Ga0466958_0188533
814 Ga0466958_0808459
815 Ga0466967_0017418
816 Ga0466967_0034602
817 Ga0466967_1741209
818 Ga0466967_1907804
819 Ga0495603_0016646
820 Ga0495629_0022988
821 Ga0495629_0484068
822 Ga0495641_0010940
823 Ga0495651_0079008
824 Ga0495653_0059417
825 Ga0495580_0027478
826 Ga0495639_0002393
827 Ga0495662_0038625
828 Ga0495662_0046881
829 Ga0495594_0303021
830 Ga0495583_0242542
831 Ga0495608_0447818
832 Ga0495608_0618249
833 Ga0495608_0677687
834 Ga0495618_0043111
835 Ga0495618_0639518
836 Ga0495630_0012304
837 Ga0495666_0004233
838 Ga0495652_0165031
839 Ga0495665_0005412
840 Ga0495640_0041983
841 Ga0495640_0144208
842 Ga0495586_0115875
843 Ga0495587_0611953
844 Ga0495645_0269708
845 Ga0495622_0047864
846 Ga0495667_0003763
847 Ga0495634_0008470
848 Ga0495634_0013480
849 Ga0495634_0202640
850 Ga0495635_0007117
851 Ga0495635_0262477
852 Ga0495588_0045791
853 Ga0495588_0425690
854 Ga0495657_0020099
855 Ga0495647_0196149
856 Ga0495658_0006566
857 Ga0495613_0003353
858 Ga0495613_0021422
859 Ga0495624_0016865
860 Ga0495589_0032820
861 Ga0495589_0280086
862 Ga0495600_0008172
863 Ga0495581_0003353
864 Ga0495604_0135455
865 Ga0495604_0330369
866 Ga0495636_0005535
867 Ga0495636_0007045
868 Ga0495636_0444749
869 Ga0495674_0026489
870 Ga0495676_0013596
871 Ga0495676_0334735
872 Ga0495680_0034925
873 Ga0495680_0211208
874 Ga0495687_001148
875 Ga0495687_028371
876 Ga0495675_0310021
877 Ga0495677_0232548
878 Ga0495685_001628
879 Ga0495685_215434
880 Ga0495684_0001140
881 Ga0495593_0014477
882 Ga0495602_0058551
883 Ga0495614_0003655
884 Ga0495614_0115277
885 Ga0496100_0052499
886 Ga0496100_0076212
887 Ga0496100_0131454
888 Ga0496100_0170905
889 Ga0496101_0009448
890 Ga0496101_0013460
891 Ga0496101_0703856
892 Ga0496102_0000990
893 Ga0496102_0067459
894 Ga0496102_0281164
895 Ga0496103_0005862
896 Ga0496103_0036083
897 Ga0496103_0193004
898 Ga0496104_0108765
899 Ga0496105_0006746
900 Ga0496105_0140926
901 Ga0496105_0740887
902 Ga0496106_0002240
903 Ga0496106_0024931
904 Ga0496106_0774989
905 Ga0496107_0001146
906 Ga0496107_0002204
907 Ga0496107_0142540
908 Ga0496108_0002368
909 Ga0496108_0009285
910 Ga0496108_0490164
911 Ga0496109_0001101
912 Ga0496109_0017562
913 Ga0496109_0091792
914 Ga0496109_0386940
915 Ga0496110_0001341
916 Ga0496110_0002045
917 Ga0496111_0001615
918 Ga0496111_0005155
919 Ga0496111_1020719
920 Ga0496112_0001852
921 Ga0496112_0296599
922 Ga0496112_0347796
923 Ga0496112_0944947
924 Ga0496112_0952766
925 Ga0496113_0003723
926 Ga0496113_0017029
927 Ga0496114_0012059
928 Ga0496114_0194019
929 Ga0496114_0222898
930 Ga0496114_1079074
931 Ga0496115_0004701
932 Ga0496115_0106753
933 Ga0496115_0232623
934 Ga0501034_0041844
935 Ga0501038_0085323
936 Ga0501042_0995882
937 Ga0501067_0703821
938 Ga0501068_0040786
939 Ga0501069_0144662
940 Ga0501069_0754943
941 Ga0501072_0499833
942 Ga0501080_0823779
943 nmdc:mga0yw44_438203_c1
944 nmdc:mga05p37_576768_c1
945 nmdc:mga05p37_9335_c1
946 nmdc:mga0qj67_284078_c1
947 nmdc:mga0qj67_383804_c1
948 nmdc:mga0qj67_761152_c1
949 nmdc:mga06r32_127472_c1
950 nmdc:mga06r32_1793217_c1
951 nmdc:mga06r32_401648_c1
952 nmdc:mga0n895_1136182_c1
953 nmdc:mga0n895_8088_c1
954 nmdc:mga0rr50_141754_c1
955 nmdc:mga0rr50_1447195_c1
956 nmdc:mga0rr50_40615_c1
957 nmdc:mga08x19_391580_c1
958 nmdc:mga08x19_55451_c1
959 nmdc:mga0a205_208089_c1
960 Ga0495601_0135927
961 Ga0495601_0680512
962 Ga0495612_0027231
963 Ga0495595_0024967
964 Ga0495595_0034338
965 Ga0495619_0054733
966 Ga0495619_0234090
967 Ga0500616_0001415
968 Ga0501082_0164676
969 Ga0466962_0064892
970 2644177083

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

28

142

0.83

PF13673

Acetyltransf_10

Acetyltransferase (GNAT) domain

26

150

0.76

PF13508

Acetyltransf_7

Acetyltransferase (GNAT) domain

55

141

0.72

Structural Annotation

Top 5 Hits

ID Description Score Start End
5u08-assembly1.cif.gz_A crystal structure of an aminoglycoside acetyltransferase meta-aac0020 from an uncultured soil metagenomic sample in complex with sisomicin 0.9116 2 137
5f47-assembly1.cif.gz_B crystal structure of an aminoglycoside acetyltransferase meta-aac0020 from an uncultured soil metagenomic sample in complex with trehalose 0.9105 2 137
7ypu-assembly4.cif.gz_H orfe-coa-glycylthricin complex 0.8747 38 123
3pp9-assembly1.cif.gz_A-2 1.6 angstrom resolution crystal structure of putative streptothricin acetyltransferase from bacillus anthracis str. ames in complex with acetyl coenzyme a 0.8732 32 123
7ypu-assembly2.cif.gz_D orfe-coa-glycylthricin complex 0.8717 38 123
ID Description Score Start End Superfamily
5f47B00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9158 2 137 3.40.630.30
1y9wB01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8982 39 106 3.40.630.30
af_Q7XUY6_156_314_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8941 68 123 3.40.630.30
af_O13738_1_94_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8901 36 123 3.40.630.30
af_K7KMF1_95_188_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8755 37 110 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A1E8FVW8-F1-model_v4 N-acetyltransferase domain-containing protein 0.9825 1 137 GO:0016747
AF-A0A2G7CPU0-F1-model_v4 deleted 0.9815 1 137
AF-K0JNW9-F1-model_v4 N-acetyltransferase domain-containing protein 0.9781 11 137 GO:0016747
AF-A0A2G7DZT8-F1-model_v4 deleted 0.9779 1 136
AF-A0A7X9Q063-F1-model_v4 GNAT family N-acetyltransferase 0.9755 6 137 GO:0016747

Map