F453164

General Info

Members Datasets Scaffolds Average Seq Length
485 359 968 466

Family's Representative Sequence

Representative Sequence 3300048907|Ga0496104_0015212|Ga0496104_0015212_2513_4003
Length 496
Sequence MARSHPIRSAENIHSKFIVTLRREAMNITRRDFAKGSAAIIGLAGLGPGIAQARDLTPKQARAIAKEAYVYGFPMVDSYRIQHAYFVDTKNPEYKGPWNQIVNTPRVYTPADTAIQTPNSDTPYSWLGLDLRTEPMVLTVPPIEKDRYFSVQMIDAYTFNFAYLGSRATGNDGGSVLVAGPGWKGETPSGVKKVIRSETDFIWAAYRTQLFNPDDIDNVKKVQAGYKAEPLSAFLGQTAPAAAPAVDFIKTLTPKEEKTSPEFFNILNFILQYCPTDPSEIELMARFAKIGVGAGKTIDFDKLSPKMKAAFEQGMADAWKALATLEKQKIDTGEVTSGDVFGTREYLKNNYLYRMAGAVLGIGGNSKQEAMYPVYAVDADGKKLDGANRYTLRFAPGQLPPVNAFWSLTMYELPQSLLVANPINRYLLNSPMLPQFVKDADGGLTFYIQNESPGKDKEPNWLPAPKGPFIAFMRLYWPKEAALDGTWKHPPMTKAA

Samples

Sample ID Description Type Environment
1 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
4 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
5 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
6 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
7 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
8 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
9 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
10 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
11 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
51 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
52 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
53 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
54 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
55 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
56 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
57 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
58 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
79 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
80 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
91 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
92 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
93 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
94 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
96 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
97 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
99 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
100 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
138 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
139 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
143 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
144 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
145 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
146 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
147 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
148 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
149 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
150 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
151 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
152 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
153 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
154 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
155 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
156 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
157 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
158 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
159 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
160 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
161 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
162 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
163 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
164 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
165 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
166 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
167 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
168 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
169 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
170 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
171 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
172 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
173 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
174 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
175 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
176 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
177 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
178 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
179 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
180 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
181 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
182 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
183 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
184 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
185 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
186 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
187 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
188 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
189 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
190 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
191 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
192 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
193 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
194 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
195 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
196 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
197 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
198 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
199 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
200 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
201 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
202 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
203 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
204 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
205 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
206 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
207 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
208 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
209 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
210 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
211 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
212 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
213 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
214 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
215 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
216 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
217 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
218 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
219 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
220 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
221 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
222 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
223 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
224 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
225 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
226 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
227 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
228 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
241 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
242 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
243 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
244 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
245 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
246 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
247 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
248 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
249 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
250 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
251 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
253 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
254 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
255 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
256 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
257 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
258 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
259 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
260 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
261 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
262 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
263 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
264 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
265 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
266 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
267 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
268 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
269 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
270 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
271 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
272 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
273 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
274 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
275 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
276 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
277 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
278 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
279 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
280 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
281 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
282 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
283 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
284 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
285 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
286 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
287 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
288 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
289 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
290 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
291 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
292 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
293 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
294 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
295 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
296 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
297 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
298 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
299 2643221723 Ensifer sp. Root278 Isolate Unclassified
300 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
301 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
302 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
303 2738543013 Variovorax sp. BT01 Isolate Unclassified
304 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
305 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
306 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
307 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
308 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
309 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
310 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
311 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
312 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
313 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
314 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
315 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
316 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
317 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
318 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
319 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
320 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
321 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
322 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
323 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
324 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
325 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
326 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
327 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
328 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
329 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
330 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
331 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
332 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
333 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
334 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
335 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
336 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
337 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
338 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
339 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
340 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
341 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
342 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
343 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
344 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
345 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
346 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
347 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
348 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
349 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
350 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
351 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
352 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
353 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
354 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
355 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
356 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
357 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
358 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule
359 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 82.89
Metatranscriptomes 0
Isolates 17.11

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.26
Nodule 10.72
Rhizoplane 3.51
Rhizosphere 62.68
Stem 0
Stem Tuber 0
Unclassified 0.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496104_0015212 3300048907 Bacteria 6966
2 JGI24739J22299_10037513 3300001989 Bacteria 1632
3 JGI25159J45721_1000020 3300002987 Bacteria 124791
4 JGI25159J45721_1001786 3300002987 Bacteria 8625
5 JGI25160J50197_1000032 3300003354 Bacteria 174525
6 JGI25160J50197_1000055 3300003354 Bacteria 124791
7 JGI25161J50226_1000017 3300003374 Bacteria 174525
8 JGI25161J50226_1000374 3300003374 Bacteria 22499
9 Ga0055526_1000508 3300003771 Bacteria 30971
10 Ga0055526_1008784 3300003771 Bacteria 4976
11 Ga0055536_1007640 3300003781 Bacteria 4795
12 Ga0055531_10004734 3300003794 Bacteria 8141
13 Ga0055543_1000039 3300004625 Bacteria 123885
14 Ga0055543_1000240 3300004625 Bacteria 42475
15 Ga0065165_1000179 3300005262 Bacteria 112568
16 Ga0065165_1001002 3300005262 Bacteria 34597
17 Ga0065165_1007034 3300005262 Bacteria 5667
18 Ga0065707_10108736 3300005295 Bacteria 2498
19 Ga0070658_10000869 3300005327 Bacteria 25832
20 Ga0070676_10000097 3300005328 Bacteria 30711
21 Ga0070683_100000859 3300005329 Bacteria 22458
22 Ga0070683_100070633 3300005329 Bacteria 3257
23 Ga0070670_100030760 3300005331 Bacteria 4623
24 Ga0070666_10021762 3300005335 Bacteria 4156
25 Ga0070682_100072041 3300005337 Bacteria 2213
26 Ga0068868_100001216 3300005338 Bacteria 17693
27 Ga0070689_100220105 3300005340 Bacteria 1557
28 Ga0070661_100185310 3300005344 Bacteria 1585
29 Ga0070668_100000912 3300005347 Bacteria 20597
30 Ga0070668_100022292 3300005347 Bacteria 4787
31 Ga0070669_100071607 3300005353 Bacteria 2565
32 Ga0070675_100208001 3300005354 Bacteria 1700
33 Ga0070671_100009546 3300005355 Bacteria 7793
34 Ga0070673_100000587 3300005364 Bacteria 19767
35 Ga0070673_100057032 3300005364 Bacteria 3085
36 Ga0070688_100035838 3300005365 Bacteria 3016
37 Ga0070667_100001108 3300005367 Bacteria 24656
38 Ga0070667_100069518 3300005367 Bacteria 2996
39 Ga0070705_100061727 3300005440 Bacteria 2229
40 Ga0070678_100006469 3300005456 Bacteria 6880
41 Ga0070678_100202911 3300005456 Bacteria 1638
42 Ga0070662_100134843 3300005457 Bacteria 1908
43 Ga0068867_100001305 3300005459 Bacteria 17233
44 Ga0070684_100084368 3300005535 Bacteria 2816
45 Ga0070697_100056548 3300005536 Bacteria 3191
46 Ga0068853_100016300 3300005539 Bacteria 6114
47 Ga0068853_100032725 3300005539 Bacteria 4407
48 Ga0070672_100000633 3300005543 Bacteria 20584
49 Ga0070672_100014157 3300005543 Bacteria 5645
50 Ga0070665_100001963 3300005548 Bacteria 23141
51 Ga0068855_100080336 3300005563 Bacteria 3781
52 Ga0068855_100187470 3300005563 Bacteria 2336
53 Ga0070664_100001980 3300005564 Bacteria 16408
54 Ga0070664_100262832 3300005564 Bacteria 1553
55 Ga0068857_100011107 3300005577 Bacteria 7834
56 Ga0068856_100042186 3300005614 Bacteria 4488
57 Ga0068856_100263912 3300005614 Bacteria 1738
58 Ga0068852_100140110 3300005616 Bacteria 2237
59 Ga0068859_100172300 3300005617 Bacteria 2245
60 Ga0068864_100001914 3300005618 Bacteria 17084
61 Ga0068864_100037633 3300005618 Bacteria 4130
62 Ga0068864_100107630 3300005618 Bacteria 2480
63 Ga0068864_100128419 3300005618 Bacteria 2274
64 Ga0068866_10054731 3300005718 Bacteria 2046
65 Ga0068851_10000634 3300005834 Bacteria 14963
66 Ga0068863_100011658 3300005841 Bacteria 8503
67 Ga0068858_100001289 3300005842 Bacteria 25885
68 Ga0068860_100004042 3300005843 Bacteria 15062
69 Ga0068860_100283032 3300005843 Bacteria 1621
70 Ga0068862_100015879 3300005844 Bacteria 6257
71 Ga0075365_10014199 3300006038 Bacteria 4786
72 Ga0075365_10027903 3300006038 Bacteria 3596
73 Ga0075365_10035251 3300006038 Bacteria 3236
74 Ga0075368_10006904 3300006042 Bacteria 3991
75 Ga0075363_100003625 3300006048 Bacteria 6617
76 Ga0075364_10000747 3300006051 Bacteria 17073
77 Ga0075364_10009371 3300006051 Bacteria 5869
78 Ga0070716_100048319 3300006173 Bacteria 2405
79 Ga0070712_100029729 3300006175 Bacteria 3665
80 Ga0075367_10020951 3300006178 Bacteria 3648
81 Ga0075369_10004008 3300006186 Bacteria 5409
82 Ga0075369_10039661 3300006186 Bacteria 2011
83 Ga0075366_10007330 3300006195 Bacteria 6085
84 Ga0097621_100000393 3300006237 Bacteria 30466
85 Ga0075370_10006500 3300006353 Bacteria 5884
86 Ga0068871_100014045 3300006358 Bacteria 5956
87 Ga0068871_100014891 3300006358 Bacteria 5811
88 Ga0068871_100020216 3300006358 Bacteria 5098
89 Ga0075428_100045879 3300006844 Bacteria 4801
90 Ga0075430_100045636 3300006846 Bacteria 3701
91 Ga0075431_100047446 3300006847 Bacteria 4428
92 Ga0075429_100043565 3300006880 Bacteria 3905
93 Ga0068865_100001528 3300006881 Bacteria 13508
94 Ga0068865_100016738 3300006881 Bacteria 4699
95 Ga0097620_100172293 3300006931 Bacteria 2245
96 Ga0105240_10016822 3300009093 Bacteria 9888
97 Ga0105240_10109940 3300009093 Bacteria 3337
98 Ga0111539_10092931 3300009094 Bacteria 3544
99 Ga0111539_10410983 3300009094 Bacteria 1576
100 Ga0105247_10006438 3300009101 Bacteria 7271
101 Ga0105243_10086034 3300009148 Bacteria 2578
102 Ga0105242_10006376 3300009176 Bacteria 9083
103 Ga0105242_10008285 3300009176 Bacteria 7988
104 Ga0105242_10049682 3300009176 Bacteria 3413
105 Ga0105248_10056841 3300009177 Bacteria 4390
106 Ga0105237_10020496 3300009545 Bacteria 6812
107 Ga0105238_10053526 3300009551 Bacteria 4055
108 Ga0105249_10002960 3300009553 Bacteria 14658
109 Ga0105239_10053546 3300010375 Bacteria 4427
110 Ga0105239_10089484 3300010375 Bacteria 3394
111 Ga0105246_10081186 3300011119 Bacteria 2310
112 Ga0157373_10004068 3300013100 Bacteria 11019
113 Ga0157371_10010503 3300013102 Bacteria 7201
114 Ga0157374_10007020 3300013296 Bacteria 9589
115 Ga0157378_10002218 3300013297 Bacteria 17223
116 Ga0157378_10085876 3300013297 Bacteria 2851
117 Ga0157378_10176012 3300013297 Bacteria 2010
118 Ga0163162_10002015 3300013306 Bacteria 19126
119 Ga0163162_10117161 3300013306 Bacteria 2765
120 Ga0163162_10131840 3300013306 Bacteria 2608
121 Ga0157372_10103278 3300013307 Bacteria 3257
122 Ga0157375_10007272 3300013308 Bacteria 9687
123 Ga0157375_10133112 3300013308 Bacteria 2607
124 Ga0157375_10215641 3300013308 Bacteria 2077
125 Ga0163163_10003609 3300014325 Bacteria 13148
126 Ga0163163_10018339 3300014325 Bacteria 6549
127 Ga0163163_10311345 3300014325 Bacteria 1628
128 Ga0157377_10054600 3300014745 Bacteria 2262
129 Ga0157379_10000895 3300014968 Bacteria 24098
130 Ga0157376_10001131 3300014969 Bacteria 17505
131 Ga0157376_10003084 3300014969 Bacteria 11437
132 Ga0157376_10011057 3300014969 Bacteria 6635
133 Ga0163161_10001998 3300017792 Bacteria 14764
134 Ga0163161_10014053 3300017792 Bacteria 5575
135 Ga0163161_10213562 3300017792 Bacteria 1491
136 Ga0209436_100691 3300025208 Bacteria 14243
137 Ga0209130_1000026 3300025284 Bacteria 334058
138 Ga0209130_1000092 3300025284 Bacteria 149162
139 Ga0209675_1003565 3300025291 Bacteria 7332
140 Ga0209676_1003613 3300025292 Bacteria 9309
141 Ga0209676_1009852 3300025292 Bacteria 4061
142 Ga0209025_1000767 3300025294 Bacteria 53337
143 Ga0209564_1000208 3300025295 Bacteria 134794
144 Ga0209564_1007625 3300025295 Bacteria 5539
145 Ga0209050_1009774 3300025298 Bacteria 4842
146 Ga0209256_1002161 3300025299 Bacteria 16949
147 Ga0209256_1004077 3300025299 Bacteria 9489
148 Ga0207426_1000006 3300025302 Bacteria 1025969
149 Ga0207426_1000022 3300025302 Bacteria 547377
150 Ga0209051_1002708 3300025303 Bacteria 12325
151 Ga0209051_1011723 3300025303 Bacteria 4304
152 Ga0209257_1004267 3300025304 Bacteria 11276
153 Ga0209257_1014938 3300025304 Bacteria 3282
154 Ga0207697_10006966 3300025315 Bacteria 5068
155 Ga0207697_10016203 3300025315 Bacteria 3073
156 Ga0207656_10000323 3300025321 Bacteria 16457
157 Ga0207647_10007505 3300025904 Bacteria 7876
158 Ga0207645_10000332 3300025907 Bacteria 39392
159 Ga0207705_10003822 3300025909 Bacteria 11455
160 Ga0207671_10026534 3300025914 Bacteria 4339
161 Ga0207693_10099571 3300025915 Bacteria 2279
162 Ga0207694_10067166 3300025924 Bacteria 2799
163 Ga0207650_10009423 3300025925 Bacteria 6674
164 Ga0207650_10013301 3300025925 Bacteria 5695
165 Ga0207659_10033476 3300025926 Bacteria 3537
166 Ga0207644_10008006 3300025931 Bacteria 6910
167 Ga0207706_10121591 3300025933 Bacteria 2296
168 Ga0207706_10169874 3300025933 Bacteria 1916
169 Ga0207706_10191095 3300025933 Bacteria 1797
170 Ga0207686_10006304 3300025934 Bacteria 6380
171 Ga0207669_10076854 3300025937 Bacteria 2121
172 Ga0207704_10009227 3300025938 Bacteria 4749
173 Ga0207704_10077878 3300025938 Bacteria 2130
174 Ga0207665_10025124 3300025939 Bacteria 3929
175 Ga0207691_10000164 3300025940 Bacteria 61768
176 Ga0207691_10011208 3300025940 Bacteria 8603
177 Ga0207689_10132469 3300025942 Bacteria 2052
178 Ga0207679_10019421 3300025945 Bacteria 4564
179 Ga0207667_10051453 3300025949 Bacteria 4343
180 Ga0207667_10155029 3300025949 Bacteria 2357
181 Ga0207651_10000385 3300025960 Bacteria 18809
182 Ga0207651_10101213 3300025960 Bacteria 2138
183 Ga0207651_10180802 3300025960 Bacteria 1673
184 Ga0207712_10008964 3300025961 Bacteria 6326
185 Ga0207712_10077495 3300025961 Bacteria 2409
186 Ga0207668_10004288 3300025972 Bacteria 8369
187 Ga0207668_10043498 3300025972 Bacteria 3049
188 Ga0207640_10097996 3300025981 Bacteria 2048
189 Ga0207658_10000445 3300025986 Bacteria 38969
190 Ga0207677_10002079 3300026023 Bacteria 10537
191 Ga0207703_10001076 3300026035 Bacteria 25996
192 Ga0207639_10008308 3300026041 Bacteria 7114
193 Ga0207639_10040699 3300026041 Bacteria 3470
194 Ga0207678_10089535 3300026067 Bacteria 2630
195 Ga0207702_10203976 3300026078 Bacteria 1834
196 Ga0207641_10004311 3300026088 Bacteria 12351
197 Ga0207648_10006386 3300026089 Bacteria 11716
198 Ga0207676_10001280 3300026095 Bacteria 18696
199 Ga0207676_10070732 3300026095 Bacteria 2799
200 Ga0207676_10108225 3300026095 Bacteria 2320
201 Ga0207674_10008720 3300026116 Bacteria 11674
202 Ga0207683_10018564 3300026121 Bacteria 5935
203 Ga0209813_10004181 3300027866 Bacteria 3430
204 Ga0207428_10002707 3300027907 Bacteria 17662
205 Ga0268266_10045046 3300028379 Bacteria 3772
206 Ga0268265_10071517 3300028380 Bacteria 2702
207 Ga0268264_10003120 3300028381 Bacteria 14358
208 Ga0265330_10043531 3300031235 Bacteria 1985
209 Ga0265339_10001606 3300031249 Bacteria 16730
210 Ga0307513_10006448 3300031456 Bacteria 15328
211 Ga0307513_10023766 3300031456 Bacteria 7151
212 Ga0265314_10032907 3300031711 Bacteria 3808
213 Ga0316576_10009891 3300031727 Bacteria 6173
214 Ga0316576_10054302 3300031727 Bacteria 2922
215 Ga0316578_10046405 3300031728 Bacteria 2532
216 Ga0316577_10007823 3300031733 Bacteria 5708
217 Ga0316577_10020803 3300031733 Unclassified 3635
218 Ga0316577_10086450 3300031733 Bacteria 1755
219 Ga0316580_10003937 3300032139 Bacteria 4269
220 Ga0316574_0003919 3300035398 Bacteria 7738
221 Ga0316584_0024064 3300036712 Bacteria 4453
222 Ga0316584_0025906 3300036712 Unclassified 4304
223 Ga0436361_0127754 3300039447 Bacteria 16813
224 Ga0451833_0671016 3300041491 Bacteria 3063
225 Ga0451835_0611318 3300041492 Bacteria 2500
226 Ga0451849_0009036 3300041505 Bacteria 3557
227 Ga0451849_1386845 3300041505 Bacteria 2461
228 Ga0451843_0572038 3300041509 Bacteria 2523
229 Ga0439449_0044871 3300042007 Bacteria 1639
230 Ga0451577_0008546 3300042876 Bacteria 9958
231 Ga0451577_0121944 3300042876 Unclassified 2335
232 Ga0466965_0020543 3300044683 Bacteria 3175
233 Ga0453684_0001539 3300044712 Archaea 64426
234 Ga0453684_0014353 3300044712 Bacteria 12688
235 Ga0453684_0020633 3300044712 Archaea 9917
236 Ga0466960_0004428 3300044901 Bacteria 5489
237 Ga0495592_0114075 3300046454 Bacteria 1909
238 Ga0495629_0000013 3300046459 Bacteria 212317
239 Ga0495638_0000373 3300046460 Bacteria 55670
240 Ga0495638_0002876 3300046460 Bacteria 13787
241 Ga0495638_0012340 3300046460 Bacteria 5859
242 Ga0495638_0022069 3300046460 Bacteria 4182
243 Ga0495638_0026218 3300046460 Bacteria 3780
244 Ga0495650_0000531 3300046471 Bacteria 55413
245 Ga0495582_0003337 3300046473 Bacteria 9025
246 Ga0495605_0001623 3300046474 Bacteria 14521
247 Ga0495584_0047854 3300046491 Bacteria 2156
248 Ga0495585_0002873 3300046492 Bacteria 11975
249 Ga0495585_0014492 3300046492 Bacteria 4592
250 Ga0495585_0034003 3300046492 Bacteria 2882
251 Ga0495594_0005889 3300046499 Bacteria 6301
252 Ga0495607_0071605 3300046501 Bacteria 1932
253 Ga0495583_0000921 3300046506 Bacteria 34568
254 Ga0495583_0032166 3300046506 Bacteria 2534
255 Ga0495610_0016428 3300046512 Bacteria 4261
256 Ga0495616_0010358 3300046513 Bacteria 5400
257 Ga0495620_0024211 3300046515 Bacteria 2891
258 Ga0495631_0009683 3300046518 Bacteria 4804
259 Ga0495631_0014708 3300046518 Bacteria 3770
260 Ga0495632_0000166 3300046519 Bacteria 68543
261 Ga0495632_0018995 3300046519 Bacteria 3753
262 Ga0495632_0047052 3300046519 Bacteria 2141
263 Ga0495637_0048625 3300046520 Bacteria 1785
264 Ga0495643_0005555 3300046522 Bacteria 8494
265 Ga0495643_0012734 3300046522 Bacteria 5062
266 Ga0495643_0027562 3300046522 Bacteria 3191
267 Ga0495643_0037421 3300046522 Bacteria 2661
268 Ga0495644_0019899 3300046523 Bacteria 2562
269 Ga0495648_0027094 3300046524 Bacteria 3844
270 Ga0495642_0000016 3300046528 Bacteria 114282
271 Ga0495654_0009433 3300046530 Bacteria 5348
272 Ga0495609_0000186 3300046538 Bacteria 62251
273 Ga0495621_0000774 3300046539 Bacteria 8093
274 Ga0495597_0032369 3300046542 Bacteria 2374
275 Ga0495622_0003769 3300046557 Bacteria 7088
276 Ga0495656_0018400 3300046615 Bacteria 2681
277 Ga0495668_0014873 3300046616 Bacteria 4554
278 Ga0495668_0074487 3300046616 Bacteria 1864
279 Ga0495611_0005606 3300046648 Bacteria 5355
280 Ga0495611_0007891 3300046648 Bacteria 4518
281 Ga0495625_0024227 3300046660 Bacteria 4622
282 Ga0495625_0040544 3300046660 Bacteria 3394
283 Ga0495625_0061762 3300046660 Bacteria 2650
284 Ga0495625_0100744 3300046660 Bacteria 1985
285 Ga0495635_0000605 3300046663 Bacteria 23104
286 Ga0495659_0000444 3300046664 Bacteria 15459
287 Ga0495647_0017430 3300046681 Bacteria 2541
288 Ga0495658_0000092 3300046683 Bacteria 46249
289 Ga0495613_0001834 3300046689 Bacteria 16157
290 Ga0495670_0036017 3300046691 Bacteria 2465
291 Ga0495649_0009939 3300046694 Bacteria 5626
292 Ga0495660_0045132 3300046810 Bacteria 2420
293 Ga0495672_0072524 3300047320 Bacteria 1944
294 Ga0495680_0000316 3300047322 Bacteria 54202
295 Ga0495687_026156 3300047443 Bacteria 2751
296 Ga0495687_029816 3300047443 Bacteria 2519
297 Ga0495677_0000488 3300047445 Bacteria 16816
298 Ga0495679_003813 3300047446 Bacteria 7139
299 Ga0495685_000735 3300047447 Bacteria 10014
300 Ga0495673_0019049 3300047469 Bacteria 3445
301 Ga0495681_0053944 3300047470 Bacteria 1880
302 Ga0495686_0089152 3300047472 Bacteria 1874
303 Ga0495614_0000204 3300048089 Bacteria 22916
304 Ga0495626_0002483 3300048091 Bacteria 12759
305 Ga0496102_0051355 3300048905 Bacteria 3756
306 Ga0496103_0068815 3300048906 Bacteria 2212
307 Ga0496104_0049907 3300048907 Bacteria 3947
308 Ga0496105_0016043 3300048908 Bacteria 5975
309 Ga0496109_0032022 3300048912 Bacteria 4723
310 Ga0496109_0039082 3300048912 Bacteria 4294
311 Ga0496110_0058388 3300048913 Bacteria 3399
312 Ga0496110_0196279 3300048913 Bacteria 1833
313 Ga0496111_0033155 3300048914 Bacteria 3683
314 Ga0496112_0074369 3300048915 Bacteria 3359
315 Ga0496112_0103506 3300048915 Unclassified 2817
316 Ga0496113_0165348 3300048916 Bacteria 1750
317 Ga0496116_0051219 3300048919 Bacteria 2744
318 Ga0496118_0035297 3300048921 Bacteria 4063
319 Ga0496118_0049334 3300048921 Bacteria 3243
320 Ga0496121_0016590 3300048924 Bacteria 7592
321 Ga0496121_0041417 3300048924 Bacteria 4024
322 Ga0496121_0085777 3300048924 Bacteria 2477
323 Ga0496122_0032274 3300048925 Bacteria 4335
324 Ga0496123_0038659 3300048926 Bacteria 3350
325 Ga0496124_0018150 3300048927 Bacteria 6601
326 Ga0496124_0039877 3300048927 Bacteria 4066
327 Ga0496124_0053982 3300048927 Bacteria 3403
328 Ga0496125_0045761 3300048928 Bacteria 3678
329 Ga0496125_0046962 3300048928 Bacteria 3617
330 Ga0496126_0053334 3300048929 Bacteria 3669
331 Ga0495682_0003475 3300049460 Bacteria 7004
332 Ga0495682_0003587 3300049460 Bacteria 6853
333 Ga0501031_0005761 3300049568 Bacteria 8073
334 Ga0501032_0054177 3300049569 Bacteria 2700
335 Ga0501033_0022507 3300049570 Bacteria 4755
336 Ga0501036_0003437 3300049572 Bacteria 12651
337 Ga0501036_0030683 3300049572 Bacteria 4540
338 Ga0501037_0012800 3300049573 Bacteria 6182
339 Ga0501038_0013434 3300049574 Bacteria 7462
340 Ga0501039_0030707 3300049575 Bacteria 4143
341 Ga0501040_0001856 3300049576 Bacteria 13551
342 Ga0501041_0000614 3300049577 Bacteria 18621
343 Ga0501042_0001371 3300049578 Bacteria 14294
344 Ga0501042_0021951 3300049578 Bacteria 4456
345 Ga0501043_0069200 3300049579 Bacteria 2772
346 Ga0501046_0005902 3300049580 Bacteria 10917
347 Ga0501048_0015778 3300049582 Bacteria 5575
348 Ga0501068_0011122 3300049584 Bacteria 5069
349 Ga0501071_0004801 3300049587 Bacteria 8608
350 Ga0501071_0009454 3300049587 Bacteria 6493
351 Ga0501072_0002717 3300049588 Bacteria 13283
352 Ga0501073_0062446 3300049589 Bacteria 2599
353 Ga0501074_0032168 3300049590 Bacteria 3800
354 Ga0501075_0003069 3300049591 Bacteria 11166
355 Ga0501076_0000432 3300049592 Bacteria 26432
356 Ga0501077_0007121 3300049593 Bacteria 6895
357 Ga0501079_0001654 3300049741 Bacteria 15864
358 Ga0501080_0026148 3300049742 Bacteria 5421
359 Ga0501035_0029781 3300049822 Bacteria 4979
360 Ga0501045_0018986 3300049824 Bacteria 4896
361 nmdc:mga03683_4056_c1 3300050489 Bacteria 4808
362 nmdc:mga03n38_4132_c1 3300050490 Bacteria 4768
363 nmdc:mga03n38_5202_c1 3300050490 Bacteria 4404
364 nmdc:mga0yw44_17491_c1 3300050492 Bacteria 3903
365 nmdc:mga0yw44_21321_c1 3300050492 Bacteria 3612
366 nmdc:mga0yw44_28746_c1 3300050492 Bacteria 3202
367 nmdc:mga0yw44_80350_c1 3300050492 Bacteria 2042
368 nmdc:mga0k408_21389_c1 3300050493 Bacteria 3633
369 nmdc:mga06z11_23108_c1 3300050494 Bacteria 2915
370 nmdc:mga06z11_67426_c1 3300050494 Bacteria 1884
371 nmdc:mga04h51_29992_c1 3300050495 Bacteria 1709
372 nmdc:mga07m45_110675_c1 3300050496 Bacteria 1582
373 nmdc:mga05p37_196271_c1 3300050507 Bacteria 2447
374 nmdc:mga05p37_31112_c1 3300050507 Bacteria 5580
375 nmdc:mga06r32_27219_c1 3300050510 Bacteria 5339
376 nmdc:mga08y16_14762_c1 3300050511 Bacteria 8213
377 nmdc:mga08y16_286349_c1 3300050511 Bacteria 1699
378 nmdc:mga0n895_84065_c1 3300050512 Bacteria 3175
379 nmdc:mga08x19_7307_c1 3300050514 Bacteria 6560
380 nmdc:mga0sz30_556_c1 3300050516 Bacteria 13933
381 Ga0500610_0000538 3300053079 Bacteria 11663
382 Ga0500610_0035316 3300053079 Bacteria 2563
383 Ga0495619_0001510 3300053085 Bacteria 15343
384 Ga0495619_0121778 3300053085 Bacteria 1789
385 Ga0500578_0044447 3300053086 Bacteria 2851
386 Ga0500644_0008054 3300053088 Bacteria 2769
387 Ga0500562_005880 3300053108 Bacteria 3088
388 Ga0500569_001247 3300053109 Bacteria 4743
389 Ga0500594_0002445 3300053118 Bacteria 4045
390 Ga0500655_003734 3300053133 Bacteria 2745
391 Ga0500568_0000168 3300053139 Bacteria 56752
392 Ga0500590_019939 3300053148 Bacteria 3476
393 Ga0500616_0001366 3300053153 Bacteria 23717
394 Ga0500616_0022173 3300053153 Bacteria 3550
395 Ga0500622_0000316 3300053156 Bacteria 48869
396 Ga0500645_000121 3300053730 Bacteria 61869
397 Ga0500645_010298 3300053730 Bacteria 3100
398 Ga0501084_0013713 3300054114 Bacteria 6708
399 Ga0501082_0004241 3300060353 Bacteria 12530
400 Ga0501082_0082522 3300060353 Bacteria 2774
401 Ga0530510_0003943 3300061734 Bacteria 10233
402 2511181838 2510917028 Bacteria 6185411
403 2513581031 2513237085 Bacteria 7695351
404 2513631751 2513237093 Bacteria 7545552
405 2513708315 2513237103 Bacteria 7647401
406 2515634120 2515154113 Bacteria 7807172
407 2515640205 2515154114 Bacteria 7848616
408 2517036432 2516653077 Bacteria 7555578
409 2517074993 2516653085 Bacteria 7346596
410 2585205418 2582581294 Bacteria 6626667
411 2585254303 2582581304 Bacteria 5831370
412 2585266389 2582581306 Bacteria 6450535
413 2585387364 2582581865 Bacteria 6644329
414 2585394333 2582581866 Bacteria 6859583
415 2585394374 2582581866 Bacteria 6859583
416 2585400276 2582581867 Bacteria 7184437
417 2599938292 2599185301 Bacteria 6161860
418 2600195651 2599185352 Bacteria 7228948
419 2644191571 2643221634 Bacteria 6705461
420 2644676551 2643221723 Bacteria 7095460
421 2738668404 2738541264 Bacteria 5935393
422 2738707091 2738541274 Bacteria 6909446
423 2739147474 2738541356 Bacteria 5935017
424 2739248970 2738543013 Bacteria 5618633
425 2739333479 2738543028 Bacteria 6917070
426 2770197011 2767802442 Bacteria 5747986
427 2770198212 2767802442 Bacteria 5747986
428 2776270827 2775506902 Bacteria 6208009
429 2776271790 2775506902 Bacteria 6208009
430 2776279695 2775506904 Bacteria 5954060
431 2776280350 2775506904 Bacteria 5954060
432 2792626258 2791355092 Bacteria 6248105
433 2838682854 2838680041 Bacteria 6545511
434 2838693935 2838686498 Bacteria 7807632
435 2838697486 2838694306 Bacteria 6853137
436 2838709336 2838707686 Bacteria 6619912
437 2838736876 2838729681 Bacteria 7400765
438 2838749820 2838742623 Bacteria 7396178
439 2840769913 2840764183 Bacteria 6358399
440 2841858760 2841851746 Bacteria 7532261
441 2842077446 2842077413 Bacteria 6508645
442 2842120045 2842118031 Bacteria 7033875
443 2842163676 2842156927 Bacteria 6894975
444 2842187281 2842180545 Bacteria 6888678
445 2842217658 2842217011 Bacteria 7497767
446 2842237001 2842229732 Bacteria 7475766
447 2842238747 2842237096 Bacteria 6620661
448 2842250851 2842243621 Bacteria 7421798
449 2842264636 2842257432 Bacteria 7401195
450 2842278463 2842271015 Bacteria 7807131
451 2842291108 2842291075 Bacteria 7076806
452 2842307254 2842304105 Bacteria 7023636
453 2842373483 2842370503 Bacteria 7038661
454 2842377504 2842377471 Bacteria 7140707
455 2842386556 2842384541 Bacteria 7057858
456 2844455619 2844454524 Bacteria 7952546
457 2876375516 2876369609 Bacteria 6807521
458 2902802174 2902799365 Bacteria 5419524
459 2904581507 2904578770 Bacteria 5302906
460 2919106007 2919100787 Bacteria 7710546
461 2919122741 2919119836 Bacteria 5208557
462 2924734201 2924733363 Bacteria 7574837
463 2933572633 2933570622 Bacteria 7023390
464 2935778559 2935777560 Bacteria 8077691
465 2935792224 2935785616 Bacteria 7962367
466 2935800387 2935793552 Bacteria 8012592
467 2935900379 2935894831 Bacteria 6620579
468 3003934310 3003930520 Bacteria 5667563
469 639648933 639633055 Bacteria 7751309
470 8016548016 8016539877 Bacteria 8155419
471 8016554114 8016548790 Bacteria 8155074
472 8016562490 8016557553 Bacteria 8154380
473 8016573148 8016566248 Bacteria 8158151
474 8016600282 8016595262 Bacteria 8149947
475 8016610468 8016603502 Bacteria 8731218
476 8016614466 8016613128 Bacteria 8794220
477 8016626530 8016622563 Bacteria 7999408
478 8019534567 8019530166 Bacteria 8155624
479 8019544904 8019538911 Bacteria 7872763
480 8019553628 8019547302 Bacteria 7996444
481 8023681554 8023680758 Bacteria 7729763
482 8023683522 8023680758 Bacteria 7729763
483 8056968814 8056967851 Bacteria 9038162
484 8057878730 8057874678 Bacteria 7494653
485 Ga0496104_0015212
486 JGI24739J22299_10037513
487 JGI25159J45721_1000020
488 JGI25159J45721_1001786
489 JGI25160J50197_1000032
490 JGI25160J50197_1000055
491 JGI25161J50226_1000017
492 JGI25161J50226_1000374
493 Ga0055526_1000508
494 Ga0055526_1008784
495 Ga0055536_1007640
496 Ga0055531_10004734
497 Ga0055543_1000039
498 Ga0055543_1000240
499 Ga0065165_1000179
500 Ga0065165_1001002
501 Ga0065165_1007034
502 Ga0065707_10108736
503 Ga0070658_10000869
504 Ga0070676_10000097
505 Ga0070683_100000859
506 Ga0070683_100070633
507 Ga0070670_100030760
508 Ga0070666_10021762
509 Ga0070682_100072041
510 Ga0068868_100001216
511 Ga0070689_100220105
512 Ga0070661_100185310
513 Ga0070668_100000912
514 Ga0070668_100022292
515 Ga0070669_100071607
516 Ga0070675_100208001
517 Ga0070671_100009546
518 Ga0070673_100000587
519 Ga0070673_100057032
520 Ga0070688_100035838
521 Ga0070667_100001108
522 Ga0070667_100069518
523 Ga0070705_100061727
524 Ga0070678_100006469
525 Ga0070678_100202911
526 Ga0070662_100134843
527 Ga0068867_100001305
528 Ga0070684_100084368
529 Ga0070697_100056548
530 Ga0068853_100016300
531 Ga0068853_100032725
532 Ga0070672_100000633
533 Ga0070672_100014157
534 Ga0070665_100001963
535 Ga0068855_100080336
536 Ga0068855_100187470
537 Ga0070664_100001980
538 Ga0070664_100262832
539 Ga0068857_100011107
540 Ga0068856_100042186
541 Ga0068856_100263912
542 Ga0068852_100140110
543 Ga0068859_100172300
544 Ga0068864_100001914
545 Ga0068864_100037633
546 Ga0068864_100107630
547 Ga0068864_100128419
548 Ga0068866_10054731
549 Ga0068851_10000634
550 Ga0068863_100011658
551 Ga0068858_100001289
552 Ga0068860_100004042
553 Ga0068860_100283032
554 Ga0068862_100015879
555 Ga0075365_10014199
556 Ga0075365_10027903
557 Ga0075365_10035251
558 Ga0075368_10006904
559 Ga0075363_100003625
560 Ga0075364_10000747
561 Ga0075364_10009371
562 Ga0070716_100048319
563 Ga0070712_100029729
564 Ga0075367_10020951
565 Ga0075369_10004008
566 Ga0075369_10039661
567 Ga0075366_10007330
568 Ga0097621_100000393
569 Ga0075370_10006500
570 Ga0068871_100014045
571 Ga0068871_100014891
572 Ga0068871_100020216
573 Ga0075428_100045879
574 Ga0075430_100045636
575 Ga0075431_100047446
576 Ga0075429_100043565
577 Ga0068865_100001528
578 Ga0068865_100016738
579 Ga0097620_100172293
580 Ga0105240_10016822
581 Ga0105240_10109940
582 Ga0111539_10092931
583 Ga0111539_10410983
584 Ga0105247_10006438
585 Ga0105243_10086034
586 Ga0105242_10006376
587 Ga0105242_10008285
588 Ga0105242_10049682
589 Ga0105248_10056841
590 Ga0105237_10020496
591 Ga0105238_10053526
592 Ga0105249_10002960
593 Ga0105239_10053546
594 Ga0105239_10089484
595 Ga0105246_10081186
596 Ga0157373_10004068
597 Ga0157371_10010503
598 Ga0157374_10007020
599 Ga0157378_10002218
600 Ga0157378_10085876
601 Ga0157378_10176012
602 Ga0163162_10002015
603 Ga0163162_10117161
604 Ga0163162_10131840
605 Ga0157372_10103278
606 Ga0157375_10007272
607 Ga0157375_10133112
608 Ga0157375_10215641
609 Ga0163163_10003609
610 Ga0163163_10018339
611 Ga0163163_10311345
612 Ga0157377_10054600
613 Ga0157379_10000895
614 Ga0157376_10001131
615 Ga0157376_10003084
616 Ga0157376_10011057
617 Ga0163161_10001998
618 Ga0163161_10014053
619 Ga0163161_10213562
620 Ga0209436_100691
621 Ga0209130_1000026
622 Ga0209130_1000092
623 Ga0209675_1003565
624 Ga0209676_1003613
625 Ga0209676_1009852
626 Ga0209025_1000767
627 Ga0209564_1000208
628 Ga0209564_1007625
629 Ga0209050_1009774
630 Ga0209256_1002161
631 Ga0209256_1004077
632 Ga0207426_1000006
633 Ga0207426_1000022
634 Ga0209051_1002708
635 Ga0209051_1011723
636 Ga0209257_1004267
637 Ga0209257_1014938
638 Ga0207697_10006966
639 Ga0207697_10016203
640 Ga0207656_10000323
641 Ga0207647_10007505
642 Ga0207645_10000332
643 Ga0207705_10003822
644 Ga0207671_10026534
645 Ga0207693_10099571
646 Ga0207694_10067166
647 Ga0207650_10009423
648 Ga0207650_10013301
649 Ga0207659_10033476
650 Ga0207644_10008006
651 Ga0207706_10121591
652 Ga0207706_10169874
653 Ga0207706_10191095
654 Ga0207686_10006304
655 Ga0207669_10076854
656 Ga0207704_10009227
657 Ga0207704_10077878
658 Ga0207665_10025124
659 Ga0207691_10000164
660 Ga0207691_10011208
661 Ga0207689_10132469
662 Ga0207679_10019421
663 Ga0207667_10051453
664 Ga0207667_10155029
665 Ga0207651_10000385
666 Ga0207651_10101213
667 Ga0207651_10180802
668 Ga0207712_10008964
669 Ga0207712_10077495
670 Ga0207668_10004288
671 Ga0207668_10043498
672 Ga0207640_10097996
673 Ga0207658_10000445
674 Ga0207677_10002079
675 Ga0207703_10001076
676 Ga0207639_10008308
677 Ga0207639_10040699
678 Ga0207678_10089535
679 Ga0207702_10203976
680 Ga0207641_10004311
681 Ga0207648_10006386
682 Ga0207676_10001280
683 Ga0207676_10070732
684 Ga0207676_10108225
685 Ga0207674_10008720
686 Ga0207683_10018564
687 Ga0209813_10004181
688 Ga0207428_10002707
689 Ga0268266_10045046
690 Ga0268265_10071517
691 Ga0268264_10003120
692 Ga0265330_10043531
693 Ga0265339_10001606
694 Ga0307513_10006448
695 Ga0307513_10023766
696 Ga0265314_10032907
697 Ga0316576_10009891
698 Ga0316576_10054302
699 Ga0316578_10046405
700 Ga0316577_10007823
701 Ga0316577_10020803
702 Ga0316577_10086450
703 Ga0316580_10003937
704 Ga0316574_0003919
705 Ga0316584_0024064
706 Ga0316584_0025906
707 Ga0436361_0127754
708 Ga0451833_0671016
709 Ga0451835_0611318
710 Ga0451849_0009036
711 Ga0451849_1386845
712 Ga0451843_0572038
713 Ga0439449_0044871
714 Ga0451577_0008546
715 Ga0451577_0121944
716 Ga0466965_0020543
717 Ga0453684_0001539
718 Ga0453684_0014353
719 Ga0453684_0020633
720 Ga0466960_0004428
721 Ga0495592_0114075
722 Ga0495629_0000013
723 Ga0495638_0000373
724 Ga0495638_0002876
725 Ga0495638_0012340
726 Ga0495638_0022069
727 Ga0495638_0026218
728 Ga0495650_0000531
729 Ga0495582_0003337
730 Ga0495605_0001623
731 Ga0495584_0047854
732 Ga0495585_0002873
733 Ga0495585_0014492
734 Ga0495585_0034003
735 Ga0495594_0005889
736 Ga0495607_0071605
737 Ga0495583_0000921
738 Ga0495583_0032166
739 Ga0495610_0016428
740 Ga0495616_0010358
741 Ga0495620_0024211
742 Ga0495631_0009683
743 Ga0495631_0014708
744 Ga0495632_0000166
745 Ga0495632_0018995
746 Ga0495632_0047052
747 Ga0495637_0048625
748 Ga0495643_0005555
749 Ga0495643_0012734
750 Ga0495643_0027562
751 Ga0495643_0037421
752 Ga0495644_0019899
753 Ga0495648_0027094
754 Ga0495642_0000016
755 Ga0495654_0009433
756 Ga0495609_0000186
757 Ga0495621_0000774
758 Ga0495597_0032369
759 Ga0495622_0003769
760 Ga0495656_0018400
761 Ga0495668_0014873
762 Ga0495668_0074487
763 Ga0495611_0005606
764 Ga0495611_0007891
765 Ga0495625_0024227
766 Ga0495625_0040544
767 Ga0495625_0061762
768 Ga0495625_0100744
769 Ga0495635_0000605
770 Ga0495659_0000444
771 Ga0495647_0017430
772 Ga0495658_0000092
773 Ga0495613_0001834
774 Ga0495670_0036017
775 Ga0495649_0009939
776 Ga0495660_0045132
777 Ga0495672_0072524
778 Ga0495680_0000316
779 Ga0495687_026156
780 Ga0495687_029816
781 Ga0495677_0000488
782 Ga0495679_003813
783 Ga0495685_000735
784 Ga0495673_0019049
785 Ga0495681_0053944
786 Ga0495686_0089152
787 Ga0495614_0000204
788 Ga0495626_0002483
789 Ga0496102_0051355
790 Ga0496103_0068815
791 Ga0496104_0049907
792 Ga0496105_0016043
793 Ga0496109_0032022
794 Ga0496109_0039082
795 Ga0496110_0058388
796 Ga0496110_0196279
797 Ga0496111_0033155
798 Ga0496112_0074369
799 Ga0496112_0103506
800 Ga0496113_0165348
801 Ga0496116_0051219
802 Ga0496118_0035297
803 Ga0496118_0049334
804 Ga0496121_0016590
805 Ga0496121_0041417
806 Ga0496121_0085777
807 Ga0496122_0032274
808 Ga0496123_0038659
809 Ga0496124_0018150
810 Ga0496124_0039877
811 Ga0496124_0053982
812 Ga0496125_0045761
813 Ga0496125_0046962
814 Ga0496126_0053334
815 Ga0495682_0003475
816 Ga0495682_0003587
817 Ga0501031_0005761
818 Ga0501032_0054177
819 Ga0501033_0022507
820 Ga0501036_0003437
821 Ga0501036_0030683
822 Ga0501037_0012800
823 Ga0501038_0013434
824 Ga0501039_0030707
825 Ga0501040_0001856
826 Ga0501041_0000614
827 Ga0501042_0001371
828 Ga0501042_0021951
829 Ga0501043_0069200
830 Ga0501046_0005902
831 Ga0501048_0015778
832 Ga0501068_0011122
833 Ga0501071_0004801
834 Ga0501071_0009454
835 Ga0501072_0002717
836 Ga0501073_0062446
837 Ga0501074_0032168
838 Ga0501075_0003069
839 Ga0501076_0000432
840 Ga0501077_0007121
841 Ga0501079_0001654
842 Ga0501080_0026148
843 Ga0501035_0029781
844 Ga0501045_0018986
845 nmdc:mga03683_4056_c1
846 nmdc:mga03n38_4132_c1
847 nmdc:mga03n38_5202_c1
848 nmdc:mga0yw44_17491_c1
849 nmdc:mga0yw44_21321_c1
850 nmdc:mga0yw44_28746_c1
851 nmdc:mga0yw44_80350_c1
852 nmdc:mga0k408_21389_c1
853 nmdc:mga06z11_23108_c1
854 nmdc:mga06z11_67426_c1
855 nmdc:mga04h51_29992_c1
856 nmdc:mga07m45_110675_c1
857 nmdc:mga05p37_196271_c1
858 nmdc:mga05p37_31112_c1
859 nmdc:mga06r32_27219_c1
860 nmdc:mga08y16_14762_c1
861 nmdc:mga08y16_286349_c1
862 nmdc:mga0n895_84065_c1
863 nmdc:mga08x19_7307_c1
864 nmdc:mga0sz30_556_c1
865 Ga0500610_0000538
866 Ga0500610_0035316
867 Ga0495619_0001510
868 Ga0495619_0121778
869 Ga0500578_0044447
870 Ga0500644_0008054
871 Ga0500562_005880
872 Ga0500569_001247
873 Ga0500594_0002445
874 Ga0500655_003734
875 Ga0500568_0000168
876 Ga0500590_019939
877 Ga0500616_0001366
878 Ga0500616_0022173
879 Ga0500622_0000316
880 Ga0500645_000121
881 Ga0500645_010298
882 Ga0501084_0013713
883 Ga0501082_0004241
884 Ga0501082_0082522
885 Ga0530510_0003943
886 2511181838
887 2513581031
888 2513631751
889 2513708315
890 2515634120
891 2515640205
892 2517036432
893 2517074993
894 2585205418
895 2585254303
896 2585266389
897 2585387364
898 2585394333
899 2585394374
900 2585400276
901 2599938292
902 2600195651
903 2644191571
904 2644676551
905 2738668404
906 2738707091
907 2739147474
908 2739248970
909 2739333479
910 2770197011
911 2770198212
912 2776270827
913 2776271790
914 2776279695
915 2776280350
916 2792626258
917 2838682854
918 2838693935
919 2838697486
920 2838709336
921 2838736876
922 2838749820
923 2840769913
924 2841858760
925 2842077446
926 2842120045
927 2842163676
928 2842187281
929 2842217658
930 2842237001
931 2842238747
932 2842250851
933 2842264636
934 2842278463
935 2842291108
936 2842307254
937 2842373483
938 2842377504
939 2842386556
940 2844455619
941 2876375516
942 2902802174
943 2904581507
944 2919106007
945 2919122741
946 2924734201
947 2933572633
948 2935778559
949 2935792224
950 2935800387
951 2935900379
952 3003934310
953 639648933
954 8016548016
955 8016554114
956 8016562490
957 8016573148
958 8016600282
959 8016610468
960 8016614466
961 8016626530
962 8019534567
963 8019544904
964 8019553628
965 8023681554
966 8023683522
967 8056968814
968 8057878730

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06742

DUF1214

Protein of unknown function (DUF1214)

369

480

0.98

PF06863

DUF1254

Protein of unknown function (DUF1254)

98

230

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3u07-assembly3.cif.gz_C crystal structure of the vpa0106 protein from vibrio parahaemolyticus. northeast structural genomics consortium target vpr106. 0.8798 37 471
3u07-assembly2.cif.gz_B crystal structure of the vpa0106 protein from vibrio parahaemolyticus. northeast structural genomics consortium target vpr106. 0.8794 37 471
3u07-assembly3.cif.gz_C crystal structure of the vpa0106 protein from vibrio parahaemolyticus. northeast structural genomics consortium target vpr106. 0.8737 37 471
3u07-assembly2.cif.gz_B crystal structure of the vpa0106 protein from vibrio parahaemolyticus. northeast structural genomics consortium target vpr106. 0.8732 37 471
3vb9-assembly2.cif.gz_D crystal structure of vpa0735 from vibrio parahaemolyticus in monoclinic form, northeast structural genomics target vpr109 0.6827 34 471
ID Description Score Start End Superfamily
3u07C02 Mainly Beta;Sandwich;Jelly Rolls; 0.8725 347 471 2.60.120.1600
3vb9A04 Mainly Beta;Sandwich;Jelly Rolls;Domain of unknown function DUF1214, C-terminal domain 0.8683 346 471 2.60.120.600
3u07C02 Mainly Beta;Sandwich;Jelly Rolls; 0.8586 347 471 2.60.120.1600
3vb9A03 Mainly Beta;Sandwich;Immunoglobulin-like;Domain of unknown function DUF1254 0.7956 82 206 2.60.40.1610
3vb9A03 Mainly Beta;Sandwich;Immunoglobulin-like;Domain of unknown function DUF1254 0.6671 82 206 2.60.40.1610
ID Description Score Start End GO Terms
AF-A0A853MPS6-F1-model_v4 deleted 0.9992 103 206
AF-A0A7W6U5C5-F1-model_v4 deleted 0.9932 52 471
AF-A0A3S3M672-F1-model_v4 DUF1214 domain-containing protein 0.992 368 466
AF-S3IAL2-F1-model_v4 DUF1254 domain-containing protein 0.9907 113 198
AF-A0A109LEV8-F1-model_v4 DUF1214 domain-containing protein 0.9878 340 471

Map