F453095

General Info

Members Datasets Scaffolds Average Seq Length
485 290 484 245

Family's Representative Sequence

Representative Sequence 3300011119|Ga0105246_10129317|Ga0105246_101293173
Length 269
Sequence MYRMVRQRHPVGNRLSASYGATMTRRAFDLWSPAVGGSGGVLAYGTWGRPVLVFPSEAGKASDFESNGMVDAIADLLDAGRVKLYCVDSYDSASWSDRGIPLEERARRHGAYESWILDQVAPWIHDDCGGPLPILTLGASMGAYHAANFALRRADLFPQALCLSGNYDPSTWHGWGEQGDALYYQNPTAYVANLHGDHLAWLRHHVHLTLVCGQGMWEDTTGAQASTRKLAGLLAEKDIPHELDVWGHDVAHDWPWWRRQLTHHLSAMS

Samples

Sample ID Description Type Environment
1 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
2 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
3 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
67 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
68 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
69 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
70 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
71 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
72 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
73 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
74 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
75 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
76 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
77 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
78 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
80 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
81 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
82 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
83 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
84 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
85 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
86 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
87 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
88 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
90 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
91 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
92 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
94 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
95 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
97 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
98 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
99 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
100 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
101 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
102 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
103 3300012476 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 Metagenome Rhizosphere
104 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
105 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
106 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
107 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
108 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
109 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
110 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
111 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
112 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
113 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
114 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
115 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
116 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
117 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
118 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
119 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
121 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
122 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
123 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
178 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
182 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
183 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
184 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
185 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
186 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
187 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
188 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
189 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
190 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
191 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
192 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
193 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
194 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
195 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
196 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
197 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
198 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
199 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
200 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
201 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
202 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
203 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
204 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
205 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
206 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
207 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
208 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
209 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
210 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
211 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
212 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
213 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
214 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
215 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
216 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
217 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
218 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
219 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
220 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
221 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
222 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
223 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
224 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
225 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
226 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
227 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
228 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
229 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
230 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
231 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
232 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
233 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
234 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
235 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
236 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
237 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
238 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
239 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
240 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
241 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
242 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
243 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
244 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
245 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
246 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
247 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
248 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
249 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
250 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
251 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
252 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
253 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
254 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
255 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
256 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
257 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
258 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
259 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
260 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
261 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
262 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
263 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
264 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
265 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
266 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
267 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
268 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
269 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
270 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
271 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
272 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
273 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
274 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
275 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
276 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
277 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
278 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
279 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
280 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
281 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
282 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
283 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
284 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
285 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
286 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
287 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
288 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
289 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
290 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.38
Metatranscriptomes 0.41
Isolates 0.21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.44
Nodule 0
Rhizoplane 5.77
Rhizosphere 89.48
Stem 0
Stem Tuber 0
Unclassified 3.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25404J52841_10002154 3300003659 Bacteria 3674
2 JGI25405J52794_10029790 3300003911 Bacteria 1130
3 Ga0070658_10285506 3300005327 Bacteria 1405
4 Ga0070676_10504206 3300005328 Bacteria 860
5 Ga0070683_100000838 3300005329 Bacteria 22807
6 Ga0070670_100358826 3300005331 Bacteria 1281
7 Ga0068869_100184290 3300005334 Bacteria 1638
8 Ga0070666_10047520 3300005335 Bacteria 2881
9 Ga0070666_10061118 3300005335 Bacteria 2550
10 Ga0070680_100089831 3300005336 Bacteria 2542
11 Ga0070682_100048588 3300005337 Bacteria 2642
12 Ga0070682_100064254 3300005337 Bacteria 2329
13 Ga0070682_100141928 3300005337 Bacteria 1638
14 Ga0070682_100169093 3300005337 Bacteria 1517
15 Ga0070682_100278560 3300005337 Bacteria 1218
16 Ga0070682_100403405 3300005337 Bacteria 1034
17 Ga0070660_100022057 3300005339 Bacteria 4704
18 Ga0070660_100028728 3300005339 Bacteria 4163
19 Ga0070689_100032317 3300005340 Bacteria 3979
20 Ga0070689_100065746 3300005340 Bacteria 2825
21 Ga0070691_10080679 3300005341 Bacteria 1592
22 Ga0070691_10104728 3300005341 Bacteria 1409
23 Ga0070661_100042663 3300005344 Bacteria 3311
24 Ga0070661_100130564 3300005344 Bacteria 1886
25 Ga0070661_100375215 3300005344 Bacteria 1120
26 Ga0070692_10070638 3300005345 Bacteria 1859
27 Ga0070692_10122125 3300005345 Bacteria 1454
28 Ga0070668_100094717 3300005347 Bacteria 2358
29 Ga0070668_100123922 3300005347 Bacteria 2068
30 Ga0070669_100181271 3300005353 Bacteria 1648
31 Ga0070669_100520713 3300005353 Bacteria 989
32 Ga0070675_100110840 3300005354 Bacteria 2321
33 Ga0070675_100119285 3300005354 Bacteria 2240
34 Ga0070671_100124623 3300005355 Bacteria 2169
35 Ga0070671_100392429 3300005355 Bacteria 1187
36 Ga0070674_100015544 3300005356 Bacteria 4753
37 Ga0070674_100033620 3300005356 Bacteria 3415
38 Ga0070673_100021002 3300005364 Bacteria 4722
39 Ga0070673_100022760 3300005364 Bacteria 4567
40 Ga0070673_100182986 3300005364 Bacteria 1795
41 Ga0070659_100011248 3300005366 Bacteria 6611
42 Ga0070667_100027816 3300005367 Bacteria 4706
43 Ga0070667_100070070 3300005367 Bacteria 2985
44 Ga0070709_10043859 3300005434 Bacteria 2767
45 Ga0070709_10073938 3300005434 Bacteria 2208
46 Ga0070714_100026049 3300005435 Bacteria 4831
47 Ga0070714_100153425 3300005435 Bacteria 2077
48 Ga0070714_100365803 3300005435 Bacteria 1357
49 Ga0070713_100166858 3300005436 Bacteria 1969
50 Ga0070713_100171340 3300005436 Bacteria 1945
51 Ga0070713_100556118 3300005436 Bacteria 1087
52 Ga0070710_10026660 3300005437 Bacteria 3073
53 Ga0070710_10154011 3300005437 Bacteria 1420
54 Ga0070701_10158409 3300005438 Bacteria 1309
55 Ga0070711_100014605 3300005439 Bacteria 4949
56 Ga0070711_100018217 3300005439 Bacteria 4480
57 Ga0070705_100041278 3300005440 Bacteria 2629
58 Ga0070700_100028288 3300005441 Bacteria 3332
59 Ga0070663_100016253 3300005455 Bacteria 4827
60 Ga0070678_100018429 3300005456 Bacteria 4523
61 Ga0070678_100451102 3300005456 Bacteria 1126
62 Ga0070662_100057315 3300005457 Bacteria 2831
63 Ga0070662_100164452 3300005457 Bacteria 1738
64 Ga0070681_10113311 3300005458 Bacteria 2651
65 Ga0068867_100068955 3300005459 Bacteria 2640
66 Ga0070685_10154119 3300005466 Bacteria 1459
67 Ga0070706_100136900 3300005467 Bacteria 2286
68 Ga0070679_100080220 3300005530 Bacteria 3252
69 Ga0070684_100002112 3300005535 Bacteria 14646
70 Ga0070684_100032575 3300005535 Bacteria 4442
71 Ga0070684_100214378 3300005535 Bacteria 1755
72 Ga0070697_100056457 3300005536 Bacteria 3195
73 Ga0068853_100021234 3300005539 Bacteria 5409
74 Ga0068853_100069790 3300005539 Bacteria 3058
75 Ga0070672_100069350 3300005543 Bacteria 2799
76 Ga0070672_100076155 3300005543 Bacteria 2680
77 Ga0070686_100253753 3300005544 Bacteria 1286
78 Ga0070695_100379222 3300005545 Bacteria 1066
79 Ga0070696_100061356 3300005546 Bacteria 2630
80 Ga0070693_100005265 3300005547 Bacteria 6194
81 Ga0070693_100026933 3300005547 Bacteria 3108
82 Ga0070665_100219140 3300005548 Bacteria 1903
83 Ga0070704_100107592 3300005549 Bacteria 2115
84 Ga0070704_100283108 3300005549 Bacteria 1374
85 Ga0070664_100094378 3300005564 Bacteria 2594
86 Ga0070664_100247552 3300005564 Bacteria 1601
87 Ga0068857_100143737 3300005577 Bacteria 2158
88 Ga0068854_100011823 3300005578 Bacteria 5699
89 Ga0068854_100175235 3300005578 Bacteria 1671
90 Ga0068856_100036503 3300005614 Bacteria 4818
91 Ga0070702_100001720 3300005615 Bacteria 9089
92 Ga0070702_100004631 3300005615 Bacteria 6306
93 Ga0070702_100191358 3300005615 Bacteria 1347
94 Ga0068859_100053587 3300005617 Bacteria 4057
95 Ga0068859_100221137 3300005617 Bacteria 1981
96 Ga0068859_101018376 3300005617 Bacteria 910
97 Ga0068864_100100041 3300005618 Bacteria 2570
98 Ga0068864_100114256 3300005618 Bacteria 2407
99 Ga0068866_10093132 3300005718 Bacteria 1645
100 Ga0068861_100037809 3300005719 Bacteria 3589
101 Ga0068861_100038802 3300005719 Bacteria 3551
102 Ga0068851_10054886 3300005834 Bacteria 2030
103 Ga0068870_10193304 3300005840 Bacteria 1229
104 Ga0068870_10417669 3300005840 Bacteria 877
105 Ga0068863_100114640 3300005841 Bacteria 2567
106 Ga0068858_100038963 3300005842 Bacteria 4408
107 Ga0068860_100028370 3300005843 Bacteria 5387
108 Ga0068860_100090534 3300005843 Bacteria 2914
109 Ga0068862_100157928 3300005844 Bacteria 2023
110 Ga0068862_100260939 3300005844 Bacteria 1581
111 Ga0081455_10001637 3300005937 Bacteria 27271
112 Ga0081455_10003623 3300005937 Bacteria 17700
113 Ga0081455_10007123 3300005937 Bacteria 11841
114 Ga0081455_10083244 3300005937 Bacteria 2615
115 Ga0081538_10000703 3300005981 Bacteria 36689
116 Ga0081540_1000424 3300005983 Bacteria 41696
117 Ga0081539_10003082 3300005985 Bacteria 21449
118 Ga0070717_10023709 3300006028 Bacteria 4865
119 Ga0075365_10149151 3300006038 Bacteria 1626
120 Ga0075363_100020684 3300006048 Bacteria 3304
121 Ga0075364_10319816 3300006051 Bacteria 1057
122 Ga0075432_10000302 3300006058 Bacteria 13803
123 Ga0075432_10018467 3300006058 Bacteria 2379
124 Ga0070715_10035018 3300006163 Bacteria 2062
125 Ga0070716_100088305 3300006173 Bacteria 1870
126 Ga0070712_100081298 3300006175 Bacteria 2347
127 Ga0070712_100211877 3300006175 Bacteria 1528
128 Ga0097621_100024855 3300006237 Bacteria 4683
129 Ga0097621_100103356 3300006237 Bacteria 2400
130 Ga0097621_100300026 3300006237 Bacteria 1419
131 Ga0068871_100021850 3300006358 Bacteria 4926
132 Ga0068871_100136904 3300006358 Bacteria 2080
133 Ga0075428_100012923 3300006844 Bacteria 9288
134 Ga0075428_100204408 3300006844 Unclassified 2135
135 Ga0075430_100615794 3300006846 Bacteria 896
136 Ga0075431_100073057 3300006847 Bacteria 3539
137 Ga0075433_10005821 3300006852 Bacteria 9707
138 Ga0075433_10039254 3300006852 Bacteria 4092
139 Ga0075434_100017460 3300006871 Bacteria 6915
140 Ga0075434_100051097 3300006871 Bacteria 4107
141 Ga0075429_100273651 3300006880 Bacteria 1479
142 Ga0075429_100376056 3300006880 Bacteria 1244
143 Ga0075429_100659362 3300006880 Bacteria 917
144 Ga0068865_100055107 3300006881 Bacteria 2765
145 Ga0068865_100057211 3300006881 Bacteria 2720
146 Ga0075436_100001626 3300006914 Bacteria 15378
147 Ga0075436_100056396 3300006914 Bacteria 2713
148 Ga0097620_100053586 3300006931 Bacteria 4057
149 Ga0097620_100221128 3300006931 Bacteria 1981
150 Ga0097620_101018463 3300006931 Bacteria 910
151 Ga0075435_100117314 3300007076 Bacteria 2218
152 Ga0075435_100188905 3300007076 Bacteria 1743
153 Ga0105251_10009229 3300009011 Bacteria 5847
154 Ga0105240_10025974 3300009093 Bacteria 7692
155 Ga0105240_10122036 3300009093 Bacteria 3136
156 Ga0111539_10006133 3300009094 Bacteria 15519
157 Ga0111539_10025829 3300009094 Bacteria 7192
158 Ga0111539_10738242 3300009094 Bacteria 1146
159 Ga0105245_10071217 3300009098 Bacteria 3157
160 Ga0105247_10006468 3300009101 Bacteria 7252
161 Ga0105247_10043435 3300009101 Bacteria 2753
162 Ga0105247_10187651 3300009101 Bacteria 1383
163 Ga0105247_10220354 3300009101 Bacteria 1284
164 Ga0114129_10127169 3300009147 Bacteria 3503
165 Ga0114129_10799083 3300009147 Bacteria 1203
166 Ga0105243_10117919 3300009148 Bacteria 2233
167 Ga0105243_10147876 3300009148 Bacteria 2012
168 Ga0105243_10245130 3300009148 Bacteria 1597
169 Ga0105241_10005218 3300009174 Bacteria 9592
170 Ga0105241_10138397 3300009174 Bacteria 1979
171 Ga0105242_10166706 3300009176 Bacteria 1933
172 Ga0105242_10471677 3300009176 Bacteria 1187
173 Ga0105237_10047022 3300009545 Bacteria 4338
174 Ga0105237_10280967 3300009545 Bacteria 1667
175 Ga0105238_10507708 3300009551 Bacteria 1207
176 Ga0105238_10516716 3300009551 Bacteria 1196
177 Ga0105249_10005082 3300009553 Bacteria 11336
178 Ga0105249_10146872 3300009553 Bacteria 2266
179 Ga0105246_10044963 3300011119 Bacteria 3004
180 Ga0105246_10129317 3300011119 Bacteria 1883
181 Ga0157344_1000314 3300012476 Bacteria 1791
182 Ga0157338_1005923 3300012515 Bacteria 1115
183 Ga0157371_10017191 3300013102 Bacteria 5378
184 Ga0157371_10075763 3300013102 Bacteria 2382
185 Ga0157371_10241202 3300013102 Bacteria 1300
186 Ga0157371_10426328 3300013102 Bacteria 973
187 Ga0157370_10017343 3300013104 Bacteria 7267
188 Ga0157370_10239300 3300013104 Bacteria 1680
189 Ga0157369_10200984 3300013105 Bacteria 2092
190 Ga0157369_10267396 3300013105 Bacteria 1782
191 Ga0157369_10323158 3300013105 Bacteria 1604
192 Ga0157369_10325278 3300013105 Bacteria 1598
193 Ga0157374_10168405 3300013296 Bacteria 2136
194 Ga0157374_10585697 3300013296 Bacteria 1125
195 Ga0157378_10101907 3300013297 Bacteria 2622
196 Ga0157372_10013332 3300013307 Bacteria 8775
197 Ga0157372_10367968 3300013307 Bacteria 1675
198 Ga0157375_10435674 3300013308 Bacteria 1477
199 Ga0157375_10719298 3300013308 Bacteria 1151
200 Ga0163163_10088524 3300014325 Bacteria 3107
201 Ga0157380_10120832 3300014326 Bacteria 2219
202 Ga0157377_10009394 3300014745 Bacteria 4796
203 Ga0157377_10032273 3300014745 Bacteria 2851
204 Ga0157377_10385637 3300014745 Bacteria 950
205 Ga0157379_10119656 3300014968 Bacteria 2368
206 Ga0157376_10308201 3300014969 Bacteria 1501
207 Ga0182005_1051301 3300015265 Bacteria 1122
208 Ga0163161_10006095 3300017792 Bacteria 8353
209 Ga0163161_10057748 3300017792 Bacteria 2820
210 Ga0163161_10122335 3300017792 Bacteria 1956
211 Ga0206353_11525011 3300020082 Bacteria 1564
212 Ga0213875_10001625 3300021388 Bacteria 14192
213 Ga0213875_10004624 3300021388 Bacteria 7510
214 Ga0213875_10050786 3300021388 Bacteria 1943
215 Ga0224712_10005649 3300022467 Bacteria 3507
216 Ga0207426_1024553 3300025302 Bacteria 2043
217 Ga0207656_10055696 3300025321 Bacteria 1722
218 Ga0207656_10068926 3300025321 Bacteria 1568
219 Ga0207653_10005210 3300025885 Bacteria 4063
220 Ga0207642_10029927 3300025899 Bacteria 2262
221 Ga0207642_10149615 3300025899 Bacteria 1241
222 Ga0207710_10039429 3300025900 Bacteria 2091
223 Ga0207688_10001078 3300025901 Bacteria 13975
224 Ga0207688_10002565 3300025901 Bacteria 9828
225 Ga0207680_10010079 3300025903 Bacteria 4714
226 Ga0207647_10089450 3300025904 Bacteria 1838
227 Ga0207685_10005018 3300025905 Bacteria 3442
228 Ga0207699_10001180 3300025906 Bacteria 12366
229 Ga0207699_10033395 3300025906 Bacteria 2908
230 Ga0207643_10010726 3300025908 Bacteria 4937
231 Ga0207654_10039214 3300025911 Bacteria 2663
232 Ga0207695_10256601 3300025913 Bacteria 1647
233 Ga0207671_10119451 3300025914 Bacteria 2014
234 Ga0207693_10001733 3300025915 Bacteria 19144
235 Ga0207693_10008332 3300025915 Bacteria 8484
236 Ga0207693_10376212 3300025915 Bacteria 1111
237 Ga0207663_10414142 3300025916 Bacteria 1033
238 Ga0207660_10083419 3300025917 Bacteria 2353
239 Ga0207660_10282858 3300025917 Bacteria 1317
240 Ga0207662_10405257 3300025918 Bacteria 925
241 Ga0207657_10005808 3300025919 Bacteria 12856
242 Ga0207657_10032899 3300025919 Bacteria 4678
243 Ga0207657_10033192 3300025919 Bacteria 4655
244 Ga0207649_10435122 3300025920 Bacteria 987
245 Ga0207652_10780068 3300025921 Bacteria 849
246 Ga0207681_10198863 3300025923 Bacteria 1538
247 Ga0207694_10367144 3300025924 Bacteria 1193
248 Ga0207694_10402580 3300025924 Bacteria 1138
249 Ga0207687_10117024 3300025927 Bacteria 1988
250 Ga0207687_10174196 3300025927 Bacteria 1662
251 Ga0207700_10044988 3300025928 Bacteria 3254
252 Ga0207700_10474016 3300025928 Bacteria 1105
253 Ga0207700_10540320 3300025928 Bacteria 1034
254 Ga0207664_10037552 3300025929 Bacteria 3750
255 Ga0207664_10319549 3300025929 Bacteria 1370
256 Ga0207664_10392393 3300025929 Bacteria 1233
257 Ga0207644_10116103 3300025931 Bacteria 2031
258 Ga0207644_10116393 3300025931 Bacteria 2028
259 Ga0207690_10141241 3300025932 Bacteria 1774
260 Ga0207706_10009802 3300025933 Bacteria 8789
261 Ga0207706_10042371 3300025933 Bacteria 4034
262 Ga0207706_10149128 3300025933 Bacteria 2057
263 Ga0207709_10330957 3300025935 Bacteria 1143
264 Ga0207709_10658176 3300025935 Bacteria 835
265 Ga0207670_10216563 3300025936 Bacteria 1463
266 Ga0207670_10374941 3300025936 Bacteria 1132
267 Ga0207669_10072950 3300025937 Bacteria 2164
268 Ga0207669_10191317 3300025937 Bacteria 1476
269 Ga0207669_10308814 3300025937 Bacteria 1205
270 Ga0207704_10071084 3300025938 Bacteria 2207
271 Ga0207704_10129557 3300025938 Bacteria 1744
272 Ga0207704_10149664 3300025938 Bacteria 1645
273 Ga0207665_10001334 3300025939 Bacteria 16625
274 Ga0207691_10034660 3300025940 Bacteria 4692
275 Ga0207691_10081886 3300025940 Bacteria 2900
276 Ga0207711_10139103 3300025941 Bacteria 2183
277 Ga0207689_10018207 3300025942 Bacteria 5929
278 Ga0207689_10027491 3300025942 Bacteria 4760
279 Ga0207689_10157063 3300025942 Bacteria 1875
280 Ga0207689_10352871 3300025942 Bacteria 1223
281 Ga0207661_10007946 3300025944 Bacteria 7563
282 Ga0207667_10014793 3300025949 Bacteria 8878
283 Ga0207667_10103372 3300025949 Bacteria 2938
284 Ga0207667_10130073 3300025949 Bacteria 2593
285 Ga0207651_10063699 3300025960 Bacteria 2576
286 Ga0207651_10088197 3300025960 Bacteria 2261
287 Ga0207651_10286962 3300025960 Bacteria 1363
288 Ga0207712_10074508 3300025961 Bacteria 2451
289 Ga0207712_10086081 3300025961 Bacteria 2302
290 Ga0207712_10181731 3300025961 Bacteria 1653
291 Ga0207668_10211255 3300025972 Bacteria 1552
292 Ga0207668_10211846 3300025972 Bacteria 1550
293 Ga0207640_10137388 3300025981 Bacteria 1776
294 Ga0207640_10365430 3300025981 Bacteria 1164
295 Ga0207677_10034196 3300026023 Bacteria 3289
296 Ga0207677_10213630 3300026023 Bacteria 1542
297 Ga0207703_10216264 3300026035 Bacteria 1711
298 Ga0207639_10019553 3300026041 Bacteria 4832
299 Ga0207639_10406815 3300026041 Bacteria 1227
300 Ga0207639_10497958 3300026041 Bacteria 1113
301 Ga0207678_10005489 3300026067 Bacteria 11334
302 Ga0207678_10101278 3300026067 Bacteria 2460
303 Ga0207708_10039538 3300026075 Bacteria 3594
304 Ga0207708_10102498 3300026075 Bacteria 2216
305 Ga0207702_10020887 3300026078 Bacteria 5417
306 Ga0207702_10037548 3300026078 Unclassified 4055
307 Ga0207702_10059391 3300026078 Bacteria 3257
308 Ga0207641_10155237 3300026088 Bacteria 2076
309 Ga0207648_10032203 3300026089 Bacteria 4630
310 Ga0207648_10210006 3300026089 Bacteria 1728
311 Ga0207676_10185020 3300026095 Bacteria 1827
312 Ga0207674_10004108 3300026116 Bacteria 17631
313 Ga0207674_10104607 3300026116 Bacteria 2809
314 Ga0207674_10494380 3300026116 Bacteria 1182
315 Ga0207674_10586480 3300026116 Bacteria 1077
316 Ga0207674_10644202 3300026116 Bacteria 1023
317 Ga0207675_100011497 3300026118 Bacteria 8282
318 Ga0207675_100013260 3300026118 Bacteria 7694
319 Ga0207675_100051279 3300026118 Bacteria 3849
320 Ga0207683_10007708 3300026121 Bacteria 9220
321 Ga0207683_10021718 3300026121 Bacteria 5501
322 Ga0207428_10032155 3300027907 Bacteria 4319
323 Ga0268266_10122939 3300028379 Bacteria 2311
324 Ga0268265_10140894 3300028380 Bacteria 2019
325 Ga0268264_10203626 3300028381 Bacteria 1812
326 Ga0307513_10017450 3300031456 Bacteria 8607
327 Ga0307408_100600159 3300031548 Unclassified 978
328 Ga0307405_10025828 3300031731 Bacteria 3377
329 Ga0307413_10005292 3300031824 Bacteria 5738
330 Ga0307410_10020758 3300031852 Bacteria 4027
331 Ga0307410_10169987 3300031852 Bacteria 1641
332 Ga0307406_10000224 3300031901 Bacteria 34452
333 Ga0307406_10038976 3300031901 Bacteria 2944
334 Ga0307406_10067018 3300031901 Bacteria 2339
335 Ga0307407_10191165 3300031903 Bacteria 1364
336 Ga0307407_10539481 3300031903 Bacteria 861
337 Ga0307412_10040183 3300031911 Bacteria 3026
338 Ga0307412_10352127 3300031911 Bacteria 1183
339 Ga0307409_100000129 3300031995 Bacteria 28229
340 Ga0307409_100023998 3300031995 Bacteria 4242
341 Ga0307409_100103607 3300031995 Bacteria 2367
342 Ga0307409_100107517 3300031995 Bacteria 2330
343 Ga0307409_100159311 3300031995 Bacteria 1971
344 Ga0307409_100309078 3300031995 Bacteria 1474
345 Ga0307416_100000332 3300032002 Bacteria 24390
346 Ga0307416_100016098 3300032002 Bacteria 5184
347 Ga0307416_100046400 3300032002 Bacteria 3428
348 Ga0307416_100074004 3300032002 Bacteria 2843
349 Ga0307416_100127241 3300032002 Bacteria 2284
350 Ga0307414_10015366 3300032004 Bacteria 4620
351 Ga0307414_10093723 3300032004 Bacteria 2239
352 Ga0307414_10186432 3300032004 Bacteria 1674
353 Ga0307411_10088863 3300032005 Bacteria 2150
354 Ga0307415_100000723 3300032126 Bacteria 14791
355 Ga0307415_100006695 3300032126 Bacteria 6240
356 Ga0307415_100020075 3300032126 Bacteria 4071
357 Ga0307415_100027177 3300032126 Bacteria 3622
358 Ga0307415_100107545 3300032126 Bacteria 2061
359 Ga0307415_100120134 3300032126 Bacteria 1968
360 Ga0307415_100424153 3300032126 Bacteria 1142
361 Ga0316214_1000450 3300033545 Bacteria 4183
362 Ga0373930_0007867 3300034816 Bacteria 1848
363 Ga0373930_0061180 3300034816 Bacteria 840
364 Ga0373934_0000078 3300035086 Bacteria 34263
365 Ga0373940_0003816 3300035088 Bacteria 3121
366 Ga0373949_0034914 3300035090 Bacteria 1214
367 Ga0373923_0071125 3300035111 Bacteria 1494
368 Ga0373932_0001219 3300035112 Bacteria 7299
369 Ga0373936_0006922 3300035113 Bacteria 4267
370 Ga0373939_0014244 3300035114 Bacteria 2060
371 Ga0373941_0005886 3300035115 Bacteria 2918
372 Ga0373945_0036775 3300035116 Bacteria 1755
373 Ga0373953_0000181 3300035117 Bacteria 16763
374 Ga0373954_0010105 3300035118 Bacteria 4159
375 Ga0373956_0000098 3300035119 Bacteria 29655
376 Ga0373957_0000011 3300035120 Bacteria 47051
377 Ga0373960_0040848 3300035121 Bacteria 1340
378 Ga0373943_0004883 3300035170 Bacteria 6061
379 Ga0373955_0000060 3300035172 Bacteria 42697
380 Ga0373961_0008541 3300035241 Bacteria 2492
381 Ga0373962_0007363 3300035242 Bacteria 2695
382 Ga0373962_0009146 3300035242 Bacteria 2448
383 Ga0373924_0000070 3300035410 Bacteria 27222
384 Ga0373924_0001632 3300035410 Bacteria 7362
385 Ga0373931_0059776 3300035691 Bacteria 2051
386 Ga0373933_0000009 3300035724 Bacteria 112662
387 Ga0373937_0000110 3300036401 Bacteria 77832
388 Ga0373925_0137156 3300037068 Bacteria 1912
389 Ga0436364_0180450 3300037853 Bacteria 44360
390 Ga0436364_0577320 3300037853 Bacteria 7514
391 Ga0436364_0736983 3300037853 Bacteria 1242
392 Ga0395901_0134744 3300038443 Bacteria 2596
393 Ga0436365_1396317 3300039437 Bacteria 14894
394 Ga0436363_0536993 3300039450 Bacteria 3709
395 Ga0436362_1149216 3300039453 Bacteria 975
396 Ga0451791_0719303 3300041451 Bacteria 1901
397 Ga0451841_0678703 3300041498 Bacteria 1289
398 Ga0451841_0999285 3300041498 Bacteria 956
399 Ga0451849_0046291 3300041505 Unclassified 1111
400 Ga0451843_1776865 3300041509 Unclassified 927
401 Ga0439455_0045078 3300042012 Bacteria 1139
402 Ga0439463_036893 3300042016 Bacteria 1239
403 Ga0439444_0025815 3300042437 Bacteria 1071
404 Ga0439464_0010644 3300042439 Bacteria 2429
405 Ga0439460_0054197 3300042461 Bacteria 1209
406 Ga0466963_0406257 3300044694 Bacteria 960
407 Ga0466963_0512658 3300044694 Bacteria 847
408 Ga0466970_0299356 3300044765 Bacteria 907
409 Ga0466967_0182202 3300045976 Bacteria 1982
410 Ga0495592_0000049 3300046454 Bacteria 113704
411 Ga0495651_0000007 3300046462 Bacteria 158577
412 Ga0495651_0077632 3300046462 Bacteria 2513
413 Ga0495653_0000996 3300046463 Bacteria 21820
414 Ga0495639_0008360 3300046475 Bacteria 4438
415 Ga0495594_0123122 3300046499 Bacteria 1466
416 Ga0495608_0000076 3300046511 Bacteria 74854
417 Ga0495628_0034024 3300046516 Bacteria 4102
418 Ga0495652_0000168 3300046529 Bacteria 74913
419 Ga0495665_0008942 3300046531 Bacteria 5434
420 Ga0495640_0021791 3300046533 Bacteria 4693
421 Ga0495587_0000032 3300046536 Bacteria 124143
422 Ga0495645_0060446 3300046543 Bacteria 2746
423 Ga0495645_0167309 3300046543 Bacteria 1515
424 Ga0495622_0106251 3300046557 Bacteria 1286
425 Ga0495667_0000072 3300046559 Bacteria 75080
426 Ga0495635_0035646 3300046663 Bacteria 3449
427 Ga0495657_0000424 3300046675 Bacteria 39370
428 Ga0495599_0000062 3300046678 Bacteria 74940
429 Ga0495646_0018348 3300046680 Bacteria 4431
430 Ga0495658_0014458 3300046683 Bacteria 4034
431 Ga0495600_0000743 3300046809 Bacteria 17166
432 Ga0495600_0044654 3300046809 Bacteria 2890
433 Ga0495604_0000062 3300047317 Bacteria 93264
434 Ga0495680_0000101 3300047322 Bacteria 78550
435 Ga0495675_0000116 3300047444 Bacteria 57631
436 Ga0495602_0000115 3300048088 Bacteria 75982
437 Ga0496101_0132833 3300048904 Bacteria 1891
438 Ga0496101_0632759 3300048904 Bacteria 845
439 Ga0496102_0060047 3300048905 Bacteria 3478
440 Ga0496102_0077932 3300048905 Bacteria 3050
441 Ga0496103_0053250 3300048906 Bacteria 2507
442 Ga0496104_0019808 3300048907 Bacteria 6160
443 Ga0496104_0040531 3300048907 Bacteria 4365
444 Ga0496104_0673695 3300048907 Bacteria 943
445 Ga0496105_0020698 3300048908 Bacteria 5318
446 Ga0496105_0084720 3300048908 Bacteria 2618
447 Ga0496106_0299494 3300048909 Bacteria 1289
448 Ga0496107_0013473 3300048910 Bacteria 5716
449 Ga0496108_0018702 3300048911 Bacteria 5677
450 Ga0496109_0008734 3300048912 Bacteria 8626
451 Ga0496110_0039368 3300048913 Bacteria 4115
452 Ga0496110_0550039 3300048913 Bacteria 1049
453 Ga0496111_0048932 3300048914 Bacteria 3047
454 Ga0496111_0066677 3300048914 Bacteria 2614
455 Ga0496111_0254556 3300048914 Bacteria 1303
456 Ga0496112_0129213 3300048915 Bacteria 2497
457 Ga0496112_0170911 3300048915 Bacteria 2139
458 Ga0496113_0008204 3300048916 Bacteria 6788
459 Ga0496114_0012758 3300048917 Bacteria 6729
460 Ga0496114_0158380 3300048917 Bacteria 1967
461 Ga0496114_0458302 3300048917 Bacteria 1129
462 Ga0496115_0164165 3300048918 Bacteria 1836
463 Ga0496115_0373531 3300048918 Bacteria 1160
464 Ga0496126_0038279 3300048929 Bacteria 4465
465 Ga0501217_014618 3300049661 Bacteria 1777
466 Ga0501247_013301 3300049677 Unclassified 1011
467 nmdc:mga03n38_193641_c1 3300050490 Bacteria 1048
468 nmdc:mga05p37_1032333_c1 3300050507 Bacteria 869
469 nmdc:mga05p37_382689_c1 3300050507 Bacteria 1648
470 nmdc:mga09592_216765_c2 3300050508 Bacteria 1257
471 nmdc:mga08y16_11330_c1 3300050511 Bacteria 9369
472 nmdc:mga0n895_1019_c1 3300050512 Bacteria 20374
473 nmdc:mga0n895_67052_c1 3300050512 Bacteria 3554
474 nmdc:mga0rr50_248070_c1 3300050513 Bacteria 1478
475 nmdc:mga08x19_1165_c1 3300050514 Bacteria 16461
476 nmdc:mga08x19_54667_c1 3300050514 Bacteria 2571
477 nmdc:mga0a205_10905_c1 3300050515 Bacteria 5601
478 nmdc:mga0a205_88642_c1 3300050515 Bacteria 2990
479 Ga0495612_0008139 3300053078 Bacteria 4264
480 Ga0495595_0000198 3300053084 Bacteria 24262
481 Ga0495619_0119880 3300053085 Bacteria 1803
482 Ga0495619_0175354 3300053085 Bacteria 1483
483 Ga0500644_0000185 3300053088 Bacteria 39629
484 Ga0500630_104190 3300053159 Bacteria 1287

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053085 Ga0495619_0119880 Ga0495619_0119880_1137_1790 205
2 3300034816 Ga0373930_0061180 Ga0373930_0061180_137_790 210
3 3300031852 Ga0307410_10169987 Ga0307410_101699872 212
4 3300031903 Ga0307407_10191165 Ga0307407_101911652 212
5 3300031911 Ga0307412_10040183 Ga0307412_100401832 212
6 3300031995 Ga0307409_100107517 Ga0307409_1001075173 212
7 3300032004 Ga0307414_10093723 Ga0307414_100937232 212
8 3300032005 Ga0307411_10088863 Ga0307411_100888632 212
9 3300041498 Ga0451841_0999285 Ga0451841_0999285_287_946 212
10 3300006844 Ga0075428_100204408 Ga0075428_1002044082 215
11 3300041509 Ga0451843_1776865 Ga0451843_1776865_132_803 215
12 3300003911 JGI25405J52794_10029790 JGI25405J52794_100297902 222
13 3300005615 Ga0070702_100191358 Ga0070702_1001913582 222
14 3300005937 Ga0081455_10001637 Ga0081455_1000163720 222
15 3300005937 Ga0081455_10007123 Ga0081455_100071239 222
16 3300033545 Ga0316214_1000450 Ga0316214_10004502 222
17 3300048913 Ga0496110_0550039 Ga0496110_0550039_281_970 222
18 3300005435 Ga0070714_100365803 Ga0070714_1003658032 225
19 3300025929 Ga0207664_10319549 Ga0207664_103195492 225
20 3300039437 Ga0436365_1396317 Ga0436365_1396317_297_995 225
21 3300046663 Ga0495635_0035646 Ga0495635_0035646_1934_2677 227
22 iso_pu_bacteria 2643221689 2644498049 227
23 3300005329 Ga0070683_100000838 Ga0070683_10000083816 230
24 3300005535 Ga0070684_100002112 Ga0070684_1000021126 230
25 3300025915 Ga0207693_10376212 Ga0207693_103762121 230
26 3300025921 Ga0207652_10780068 Ga0207652_107800681 230
27 3300025944 Ga0207661_10007946 Ga0207661_100079466 230
28 3300026116 Ga0207674_10644202 Ga0207674_106442022 230
29 3300006048 Ga0075363_100020684 Ga0075363_1000206842 231
30 3300013105 Ga0157369_10267396 Ga0157369_102673963 231
31 3300021388 Ga0213875_10050786 Ga0213875_100507862 231
32 3300037853 Ga0436364_0736983 Ga0436364_0736983_342_1085 231
33 3300005344 Ga0070661_100130564 Ga0070661_1001305642 232
34 3300005347 Ga0070668_100094717 Ga0070668_1000947174 232
35 3300005539 Ga0068853_100069790 Ga0068853_1000697902 232
36 3300006237 Ga0097621_100300026 Ga0097621_1003000262 232
37 3300009551 Ga0105238_10507708 Ga0105238_105077082 232
38 3300025321 Ga0207656_10068926 Ga0207656_100689262 232
39 3300025919 Ga0207657_10033192 Ga0207657_100331924 232
40 3300025924 Ga0207694_10367144 Ga0207694_103671442 232
41 3300025961 Ga0207712_10181731 Ga0207712_101817312 232
42 3300031901 Ga0307406_10038976 Ga0307406_100389762 232
43 3300031911 Ga0307412_10352127 Ga0307412_103521272 232
44 3300031995 Ga0307409_100103607 Ga0307409_1001036072 232
45 3300032002 Ga0307416_100127241 Ga0307416_1001272412 232
46 3300032004 Ga0307414_10186432 Ga0307414_101864322 232
47 3300038443 Ga0395901_0134744 Ga0395901_0134744_1471_2190 232
48 3300006051 Ga0075364_10319816 Ga0075364_103198162 233
49 3300009147 Ga0114129_10799083 Ga0114129_107990831 233
50 3300005937 Ga0081455_10003623 Ga0081455_1000362315 234
51 3300013296 Ga0157374_10585697 Ga0157374_105856972 234
52 3300025949 Ga0207667_10130073 Ga0207667_101300733 234
53 3300026078 Ga0207702_10037548 Ga0207702_100375481 234
54 3300050507 nmdc:mga05p37_1032333_c1 nmdc:mga05p37_1032333_c1_81_824 234
55 3300005840 Ga0068870_10417669 Ga0068870_104176691 235
56 3300005981 Ga0081538_10000703 Ga0081538_100007032 235
57 3300035113 Ga0373936_0006922 Ga0373936_0006922_2895_3638 235
58 3300035116 Ga0373945_0036775 Ga0373945_0036775_861_1604 235
59 3300035170 Ga0373943_0004883 Ga0373943_0004883_2301_3044 235
60 3300035410 Ga0373924_0001632 Ga0373924_0001632_4405_5148 235
61 3300037068 Ga0373925_0137156 Ga0373925_0137156_35_778 235
62 3300042012 Ga0439455_0045078 Ga0439455_0045078_216_959 235
63 3300042439 Ga0439464_0010644 Ga0439464_0010644_982_1725 235
64 3300046462 Ga0495651_0077632 Ga0495651_0077632_61_804 235
65 3300046475 Ga0495639_0008360 Ga0495639_0008360_2998_3741 235
66 3300046499 Ga0495594_0123122 Ga0495594_0123122_692_1435 235
67 3300046531 Ga0495665_0008942 Ga0495665_0008942_2391_3134 235
68 3300046533 Ga0495640_0021791 Ga0495640_0021791_2215_2958 235
69 3300046543 Ga0495645_0060446 Ga0495645_0060446_1423_2166 235
70 3300046557 Ga0495622_0106251 Ga0495622_0106251_362_1105 235
71 3300046683 Ga0495658_0014458 Ga0495658_0014458_1187_1930 235
72 3300046809 Ga0495600_0044654 Ga0495600_0044654_61_804 235
73 3300050490 nmdc:mga03n38_193641_c1 nmdc:mga03n38_193641_c1_262_1017 235
74 3300050507 nmdc:mga05p37_382689_c1 nmdc:mga05p37_382689_c1_320_1066 235
75 3300053078 Ga0495612_0008139 Ga0495612_0008139_630_1373 235
76 3300034816 Ga0373930_0007867 Ga0373930_0007867_384_1118 236
77 3300035090 Ga0373949_0034914 Ga0373949_0034914_335_1069 236
78 3300035112 Ga0373932_0001219 Ga0373932_0001219_4040_4774 236
79 3300035114 Ga0373939_0014244 Ga0373939_0014244_1198_1932 236
80 3300035115 Ga0373941_0005886 Ga0373941_0005886_1222_1956 236
81 3300035242 Ga0373962_0009146 Ga0373962_0009146_1526_2260 236
82 3300048904 Ga0496101_0632759 Ga0496101_0632759_57_791 236
83 3300048905 Ga0496102_0060047 Ga0496102_0060047_569_1303 236
84 3300048907 Ga0496104_0040531 Ga0496104_0040531_1306_2040 236
85 3300048908 Ga0496105_0084720 Ga0496105_0084720_1035_1769 236
86 3300048909 Ga0496106_0299494 Ga0496106_0299494_180_914 236
87 3300048910 Ga0496107_0013473 Ga0496107_0013473_1428_2162 236
88 3300048911 Ga0496108_0018702 Ga0496108_0018702_2699_3433 236
89 3300048912 Ga0496109_0008734 Ga0496109_0008734_2176_2910 236
90 3300048914 Ga0496111_0066677 Ga0496111_0066677_1371_2105 236
91 3300048916 Ga0496113_0008204 Ga0496113_0008204_5194_5928 236
92 3300048917 Ga0496114_0012758 Ga0496114_0012758_328_1062 236
93 3300050512 nmdc:mga0n895_1019_c1 nmdc:mga0n895_1019_c1_1334_2068 236
94 3300050513 nmdc:mga0rr50_248070_c1 nmdc:mga0rr50_248070_c1_604_1338 236
95 3300050514 nmdc:mga08x19_54667_c1 nmdc:mga08x19_54667_c1_313_1047 236
96 3300025302 Ga0207426_1024553 Ga0207426_10245532 238
97 3300031548 Ga0307408_100600159 Ga0307408_1006001592 238
98 3300031901 Ga0307406_10067018 Ga0307406_100670182 238
99 3300031903 Ga0307407_10539481 Ga0307407_105394811 238
100 3300031995 Ga0307409_100309078 Ga0307409_1003090782 238
101 3300032126 Ga0307415_100027177 Ga0307415_1000271771 238
102 3300032126 Ga0307415_100424153 Ga0307415_1004241532 238
103 3300041451 Ga0451791_0719303 Ga0451791_0719303_498_1235 238
104 3300041498 Ga0451841_0678703 Ga0451841_0678703_357_1094 238
105 3300041505 Ga0451849_0046291 Ga0451849_0046291_210_947 238
106 3300042016 Ga0439463_036893 Ga0439463_036893_291_1028 238
107 3300044694 Ga0466963_0406257 Ga0466963_0406257_64_801 238
108 3300005337 Ga0070682_100169093 Ga0070682_1001690932 239
109 3300005337 Ga0070682_100278560 Ga0070682_1002785602 239
110 3300005337 Ga0070682_100403405 Ga0070682_1004034051 239
111 3300005355 Ga0070671_100392429 Ga0070671_1003924291 239
112 3300005617 Ga0068859_101018376 Ga0068859_1010183762 239
113 3300005985 Ga0081539_10003082 Ga0081539_1000308214 239
114 3300006846 Ga0075430_100615794 Ga0075430_1006157941 239
115 3300006880 Ga0075429_100376056 Ga0075429_1003760562 239
116 3300006931 Ga0097620_101018463 Ga0097620_1010184631 239
117 3300007076 Ga0075435_100188905 Ga0075435_1001889052 239
118 3300009094 Ga0111539_10738242 Ga0111539_107382421 239
119 3300009101 Ga0105247_10220354 Ga0105247_102203542 239
120 3300013102 Ga0157371_10241202 Ga0157371_102412022 239
121 3300013105 Ga0157369_10325278 Ga0157369_103252782 239
122 3300013308 Ga0157375_10719298 Ga0157375_107192981 239
123 3300014745 Ga0157377_10385637 Ga0157377_103856372 239
124 3300025936 Ga0207670_10216563 Ga0207670_102165632 239
125 3300025942 Ga0207689_10352871 Ga0207689_103528712 239
126 3300025981 Ga0207640_10365430 Ga0207640_103654302 239
127 3300026067 Ga0207678_10101278 Ga0207678_101012782 239
128 3300026089 Ga0207648_10210006 Ga0207648_102100061 239
129 3300044694 Ga0466963_0512658 Ga0466963_0512658_15_755 239
130 3300048907 Ga0496104_0673695 Ga0496104_0673695_74_829 239
131 3300053159 Ga0500630_104190 Ga0500630_104190_535_1275 239
132 3300003659 JGI25404J52841_10002154 JGI25404J52841_100021543 240
133 3300005327 Ga0070658_10285506 Ga0070658_102855062 240
134 3300005328 Ga0070676_10504206 Ga0070676_105042061 240
135 3300005331 Ga0070670_100358826 Ga0070670_1003588262 240
136 3300005334 Ga0068869_100184290 Ga0068869_1001842902 240
137 3300005335 Ga0070666_10047520 Ga0070666_100475202 240
138 3300005335 Ga0070666_10061118 Ga0070666_100611182 240
139 3300005336 Ga0070680_100089831 Ga0070680_1000898312 240
140 3300005337 Ga0070682_100048588 Ga0070682_1000485882 240
141 3300005337 Ga0070682_100064254 Ga0070682_1000642542 240
142 3300005337 Ga0070682_100141928 Ga0070682_1001419282 240
143 3300005339 Ga0070660_100022057 Ga0070660_1000220573 240
144 3300005339 Ga0070660_100028728 Ga0070660_1000287282 240
145 3300005340 Ga0070689_100032317 Ga0070689_1000323172 240
146 3300005340 Ga0070689_100065746 Ga0070689_1000657462 240
147 3300005341 Ga0070691_10080679 Ga0070691_100806791 240
148 3300005341 Ga0070691_10104728 Ga0070691_101047281 240
149 3300005344 Ga0070661_100042663 Ga0070661_1000426632 240
150 3300005344 Ga0070661_100375215 Ga0070661_1003752152 240
151 3300005345 Ga0070692_10070638 Ga0070692_100706382 240
152 3300005345 Ga0070692_10122125 Ga0070692_101221252 240
153 3300005347 Ga0070668_100123922 Ga0070668_1001239221 240
154 3300005353 Ga0070669_100181271 Ga0070669_1001812712 240
155 3300005353 Ga0070669_100520713 Ga0070669_1005207132 240
156 3300005354 Ga0070675_100110840 Ga0070675_1001108402 240
157 3300005354 Ga0070675_100119285 Ga0070675_1001192851 240
158 3300005355 Ga0070671_100124623 Ga0070671_1001246232 240
159 3300005356 Ga0070674_100015544 Ga0070674_1000155444 240
160 3300005356 Ga0070674_100033620 Ga0070674_1000336202 240
161 3300005364 Ga0070673_100021002 Ga0070673_1000210023 240
162 3300005364 Ga0070673_100022760 Ga0070673_1000227605 240
163 3300005364 Ga0070673_100182986 Ga0070673_1001829862 240
164 3300005366 Ga0070659_100011248 Ga0070659_1000112484 240
165 3300005367 Ga0070667_100027816 Ga0070667_1000278165 240
166 3300005367 Ga0070667_100070070 Ga0070667_1000700702 240
167 3300005434 Ga0070709_10043859 Ga0070709_100438592 240
168 3300005434 Ga0070709_10073938 Ga0070709_100739382 240
169 3300005435 Ga0070714_100026049 Ga0070714_1000260492 240
170 3300005435 Ga0070714_100153425 Ga0070714_1001534252 240
171 3300005436 Ga0070713_100166858 Ga0070713_1001668582 240
172 3300005436 Ga0070713_100171340 Ga0070713_1001713402 240
173 3300005436 Ga0070713_100556118 Ga0070713_1005561181 240
174 3300005437 Ga0070710_10026660 Ga0070710_100266602 240
175 3300005437 Ga0070710_10154011 Ga0070710_101540111 240
176 3300005438 Ga0070701_10158409 Ga0070701_101584092 240
177 3300005439 Ga0070711_100014605 Ga0070711_1000146057 240
178 3300005439 Ga0070711_100018217 Ga0070711_1000182173 240
179 3300005440 Ga0070705_100041278 Ga0070705_1000412782 240
180 3300005441 Ga0070700_100028288 Ga0070700_1000282882 240
181 3300005455 Ga0070663_100016253 Ga0070663_1000162535 240
182 3300005456 Ga0070678_100018429 Ga0070678_1000184293 240
183 3300005456 Ga0070678_100451102 Ga0070678_1004511022 240
184 3300005457 Ga0070662_100057315 Ga0070662_1000573152 240
185 3300005457 Ga0070662_100164452 Ga0070662_1001644522 240
186 3300005458 Ga0070681_10113311 Ga0070681_101133112 240
187 3300005459 Ga0068867_100068955 Ga0068867_1000689551 240
188 3300005466 Ga0070685_10154119 Ga0070685_101541191 240
189 3300005467 Ga0070706_100136900 Ga0070706_1001369002 240
190 3300005530 Ga0070679_100080220 Ga0070679_1000802202 240
191 3300005535 Ga0070684_100032575 Ga0070684_1000325752 240
192 3300005535 Ga0070684_100214378 Ga0070684_1002143782 240
193 3300005536 Ga0070697_100056457 Ga0070697_1000564572 240
194 3300005539 Ga0068853_100021234 Ga0068853_1000212342 240
195 3300005543 Ga0070672_100069350 Ga0070672_1000693503 240
196 3300005543 Ga0070672_100076155 Ga0070672_1000761552 240
197 3300005544 Ga0070686_100253753 Ga0070686_1002537532 240
198 3300005545 Ga0070695_100379222 Ga0070695_1003792222 240
199 3300005546 Ga0070696_100061356 Ga0070696_1000613562 240
200 3300005547 Ga0070693_100005265 Ga0070693_1000052652 240
201 3300005547 Ga0070693_100026933 Ga0070693_1000269332 240
202 3300005548 Ga0070665_100219140 Ga0070665_1002191402 240
203 3300005549 Ga0070704_100107592 Ga0070704_1001075922 240
204 3300005549 Ga0070704_100283108 Ga0070704_1002831082 240
205 3300005564 Ga0070664_100094378 Ga0070664_1000943782 240
206 3300005564 Ga0070664_100247552 Ga0070664_1002475522 240
207 3300005577 Ga0068857_100143737 Ga0068857_1001437372 240
208 3300005578 Ga0068854_100011823 Ga0068854_1000118232 240
209 3300005578 Ga0068854_100175235 Ga0068854_1001752352 240
210 3300005614 Ga0068856_100036503 Ga0068856_1000365035 240
211 3300005615 Ga0070702_100001720 Ga0070702_1000017206 240
212 3300005615 Ga0070702_100004631 Ga0070702_1000046315 240
213 3300005617 Ga0068859_100053587 Ga0068859_1000535872 240
214 3300005617 Ga0068859_100221137 Ga0068859_1002211373 240
215 3300005618 Ga0068864_100100041 Ga0068864_1001000412 240
216 3300005618 Ga0068864_100114256 Ga0068864_1001142562 240
217 3300005718 Ga0068866_10093132 Ga0068866_100931323 240
218 3300005719 Ga0068861_100037809 Ga0068861_1000378091 240
219 3300005719 Ga0068861_100038802 Ga0068861_1000388025 240
220 3300005834 Ga0068851_10054886 Ga0068851_100548862 240
221 3300005840 Ga0068870_10193304 Ga0068870_101933042 240
222 3300005841 Ga0068863_100114640 Ga0068863_1001146402 240
223 3300005842 Ga0068858_100038963 Ga0068858_1000389632 240
224 3300005843 Ga0068860_100028370 Ga0068860_1000283704 240
225 3300005843 Ga0068860_100090534 Ga0068860_1000905343 240
226 3300005844 Ga0068862_100157928 Ga0068862_1001579283 240
227 3300005844 Ga0068862_100260939 Ga0068862_1002609392 240
228 3300005937 Ga0081455_10083244 Ga0081455_100832442 240
229 3300005983 Ga0081540_1000424 Ga0081540_100042442 240
230 3300006028 Ga0070717_10023709 Ga0070717_100237092 240
231 3300006038 Ga0075365_10149151 Ga0075365_101491512 240
232 3300006058 Ga0075432_10000302 Ga0075432_1000030215 240
233 3300006058 Ga0075432_10018467 Ga0075432_100184672 240
234 3300006163 Ga0070715_10035018 Ga0070715_100350182 240
235 3300006173 Ga0070716_100088305 Ga0070716_1000883052 240
236 3300006175 Ga0070712_100081298 Ga0070712_1000812982 240
237 3300006175 Ga0070712_100211877 Ga0070712_1002118772 240
238 3300006237 Ga0097621_100024855 Ga0097621_1000248553 240
239 3300006237 Ga0097621_100103356 Ga0097621_1001033562 240
240 3300006358 Ga0068871_100021850 Ga0068871_1000218504 240
241 3300006358 Ga0068871_100136904 Ga0068871_1001369042 240
242 3300006844 Ga0075428_100012923 Ga0075428_1000129232 240
243 3300006847 Ga0075431_100073057 Ga0075431_1000730571 240
244 3300006852 Ga0075433_10005821 Ga0075433_100058213 240
245 3300006852 Ga0075433_10039254 Ga0075433_100392542 240
246 3300006871 Ga0075434_100017460 Ga0075434_1000174608 240
247 3300006871 Ga0075434_100051097 Ga0075434_1000510972 240
248 3300006880 Ga0075429_100273651 Ga0075429_1002736512 240
249 3300006880 Ga0075429_100659362 Ga0075429_1006593622 240
250 3300006881 Ga0068865_100055107 Ga0068865_1000551073 240
251 3300006881 Ga0068865_100057211 Ga0068865_1000572112 240
252 3300006914 Ga0075436_100001626 Ga0075436_10000162616 240
253 3300006914 Ga0075436_100056396 Ga0075436_1000563963 240
254 3300006931 Ga0097620_100053586 Ga0097620_1000535862 240
255 3300006931 Ga0097620_100221128 Ga0097620_1002211283 240
256 3300007076 Ga0075435_100117314 Ga0075435_1001173142 240
257 3300009011 Ga0105251_10009229 Ga0105251_100092292 240
258 3300009093 Ga0105240_10025974 Ga0105240_100259743 240
259 3300009093 Ga0105240_10122036 Ga0105240_101220362 240
260 3300009094 Ga0111539_10006133 Ga0111539_1000613316 240
261 3300009094 Ga0111539_10025829 Ga0111539_100258297 240
262 3300009098 Ga0105245_10071217 Ga0105245_100712172 240
263 3300009101 Ga0105247_10006468 Ga0105247_100064682 240
264 3300009101 Ga0105247_10043435 Ga0105247_100434353 240
265 3300009101 Ga0105247_10187651 Ga0105247_101876512 240
266 3300009147 Ga0114129_10127169 Ga0114129_101271694 240
267 3300009148 Ga0105243_10117919 Ga0105243_101179191 240
268 3300009148 Ga0105243_10147876 Ga0105243_101478762 240
269 3300009148 Ga0105243_10245130 Ga0105243_102451302 240
270 3300009174 Ga0105241_10005218 Ga0105241_100052182 240
271 3300009174 Ga0105241_10138397 Ga0105241_101383972 240
272 3300009176 Ga0105242_10166706 Ga0105242_101667062 240
273 3300009176 Ga0105242_10471677 Ga0105242_104716772 240
274 3300009545 Ga0105237_10047022 Ga0105237_100470222 240
275 3300009545 Ga0105237_10280967 Ga0105237_102809672 240
276 3300009551 Ga0105238_10516716 Ga0105238_105167162 240
277 3300009553 Ga0105249_10005082 Ga0105249_100050822 240
278 3300009553 Ga0105249_10146872 Ga0105249_101468722 240
279 3300011119 Ga0105246_10044963 Ga0105246_100449632 240
280 3300011119 Ga0105246_10129317 Ga0105246_101293173 240
281 3300012476 Ga0157344_1000314 Ga0157344_10003142 240
282 3300012515 Ga0157338_1005923 Ga0157338_10059232 240
283 3300013102 Ga0157371_10017191 Ga0157371_100171912 240
284 3300013102 Ga0157371_10075763 Ga0157371_100757632 240
285 3300013102 Ga0157371_10426328 Ga0157371_104263282 240
286 3300013104 Ga0157370_10017343 Ga0157370_100173436 240
287 3300013104 Ga0157370_10239300 Ga0157370_102393002 240
288 3300013105 Ga0157369_10200984 Ga0157369_102009842 240
289 3300013105 Ga0157369_10323158 Ga0157369_103231582 240
290 3300013296 Ga0157374_10168405 Ga0157374_101684052 240
291 3300013297 Ga0157378_10101907 Ga0157378_101019072 240
292 3300013307 Ga0157372_10013332 Ga0157372_100133325 240
293 3300013307 Ga0157372_10367968 Ga0157372_103679682 240
294 3300013308 Ga0157375_10435674 Ga0157375_104356742 240
295 3300014325 Ga0163163_10088524 Ga0163163_100885242 240
296 3300014326 Ga0157380_10120832 Ga0157380_101208322 240
297 3300014745 Ga0157377_10009394 Ga0157377_100093944 240
298 3300014745 Ga0157377_10032273 Ga0157377_100322732 240
299 3300014968 Ga0157379_10119656 Ga0157379_101196563 240
300 3300014969 Ga0157376_10308201 Ga0157376_103082012 240
301 3300015265 Ga0182005_1051301 Ga0182005_10513012 240
302 3300017792 Ga0163161_10006095 Ga0163161_100060956 240
303 3300017792 Ga0163161_10057748 Ga0163161_100577482 240
304 3300017792 Ga0163161_10122335 Ga0163161_101223353 240
305 3300020082 Ga0206353_11525011 Ga0206353_115250112 240
306 3300021388 Ga0213875_10001625 Ga0213875_100016252 240
307 3300021388 Ga0213875_10004624 Ga0213875_100046247 240
308 3300022467 Ga0224712_10005649 Ga0224712_100056492 240
309 3300025321 Ga0207656_10055696 Ga0207656_100556962 240
310 3300025885 Ga0207653_10005210 Ga0207653_100052103 240
311 3300025899 Ga0207642_10029927 Ga0207642_100299272 240
312 3300025899 Ga0207642_10149615 Ga0207642_101496152 240
313 3300025900 Ga0207710_10039429 Ga0207710_100394292 240
314 3300025901 Ga0207688_10001078 Ga0207688_100010786 240
315 3300025901 Ga0207688_10002565 Ga0207688_100025654 240
316 3300025903 Ga0207680_10010079 Ga0207680_100100792 240
317 3300025904 Ga0207647_10089450 Ga0207647_100894502 240
318 3300025905 Ga0207685_10005018 Ga0207685_100050182 240
319 3300025906 Ga0207699_10001180 Ga0207699_100011802 240
320 3300025906 Ga0207699_10033395 Ga0207699_100333952 240
321 3300025908 Ga0207643_10010726 Ga0207643_100107262 240
322 3300025911 Ga0207654_10039214 Ga0207654_100392142 240
323 3300025913 Ga0207695_10256601 Ga0207695_102566012 240
324 3300025914 Ga0207671_10119451 Ga0207671_101194512 240
325 3300025915 Ga0207693_10001733 Ga0207693_1000173315 240
326 3300025915 Ga0207693_10008332 Ga0207693_100083322 240
327 3300025916 Ga0207663_10414142 Ga0207663_104141421 240
328 3300025917 Ga0207660_10083419 Ga0207660_100834192 240
329 3300025917 Ga0207660_10282858 Ga0207660_102828582 240
330 3300025918 Ga0207662_10405257 Ga0207662_104052571 240
331 3300025919 Ga0207657_10005808 Ga0207657_100058084 240
332 3300025919 Ga0207657_10032899 Ga0207657_100328993 240
333 3300025920 Ga0207649_10435122 Ga0207649_104351222 240
334 3300025923 Ga0207681_10198863 Ga0207681_101988632 240
335 3300025924 Ga0207694_10402580 Ga0207694_104025802 240
336 3300025927 Ga0207687_10117024 Ga0207687_101170241 240
337 3300025927 Ga0207687_10174196 Ga0207687_101741963 240
338 3300025928 Ga0207700_10044988 Ga0207700_100449882 240
339 3300025928 Ga0207700_10474016 Ga0207700_104740162 240
340 3300025928 Ga0207700_10540320 Ga0207700_105403202 240
341 3300025929 Ga0207664_10037552 Ga0207664_100375522 240
342 3300025929 Ga0207664_10392393 Ga0207664_103923932 240
343 3300025931 Ga0207644_10116103 Ga0207644_101161032 240
344 3300025931 Ga0207644_10116393 Ga0207644_101163932 240
345 3300025932 Ga0207690_10141241 Ga0207690_101412412 240
346 3300025933 Ga0207706_10009802 Ga0207706_100098022 240
347 3300025933 Ga0207706_10042371 Ga0207706_100423714 240
348 3300025933 Ga0207706_10149128 Ga0207706_101491282 240
349 3300025935 Ga0207709_10330957 Ga0207709_103309571 240
350 3300025935 Ga0207709_10658176 Ga0207709_106581761 240
351 3300025936 Ga0207670_10374941 Ga0207670_103749411 240
352 3300025937 Ga0207669_10072950 Ga0207669_100729502 240
353 3300025937 Ga0207669_10191317 Ga0207669_101913172 240
354 3300025937 Ga0207669_10308814 Ga0207669_103088142 240
355 3300025938 Ga0207704_10071084 Ga0207704_100710841 240
356 3300025938 Ga0207704_10129557 Ga0207704_101295572 240
357 3300025938 Ga0207704_10149664 Ga0207704_101496642 240
358 3300025939 Ga0207665_10001334 Ga0207665_1000133410 240
359 3300025940 Ga0207691_10034660 Ga0207691_100346602 240
360 3300025940 Ga0207691_10081886 Ga0207691_100818862 240
361 3300025941 Ga0207711_10139103 Ga0207711_101391032 240
362 3300025942 Ga0207689_10018207 Ga0207689_100182075 240
363 3300025942 Ga0207689_10027491 Ga0207689_100274913 240
364 3300025942 Ga0207689_10157063 Ga0207689_101570632 240
365 3300025949 Ga0207667_10014793 Ga0207667_100147936 240
366 3300025949 Ga0207667_10103372 Ga0207667_101033722 240
367 3300025960 Ga0207651_10063699 Ga0207651_100636992 240
368 3300025960 Ga0207651_10088197 Ga0207651_100881972 240
369 3300025960 Ga0207651_10286962 Ga0207651_102869622 240
370 3300025961 Ga0207712_10074508 Ga0207712_100745082 240
371 3300025961 Ga0207712_10086081 Ga0207712_100860812 240
372 3300025972 Ga0207668_10211255 Ga0207668_102112552 240
373 3300025972 Ga0207668_10211846 Ga0207668_102118462 240
374 3300025981 Ga0207640_10137388 Ga0207640_101373882 240
375 3300026023 Ga0207677_10034196 Ga0207677_100341962 240
376 3300026023 Ga0207677_10213630 Ga0207677_102136301 240
377 3300026035 Ga0207703_10216264 Ga0207703_102162642 240
378 3300026041 Ga0207639_10019553 Ga0207639_100195532 240
379 3300026041 Ga0207639_10406815 Ga0207639_104068152 240
380 3300026041 Ga0207639_10497958 Ga0207639_104979581 240
381 3300026067 Ga0207678_10005489 Ga0207678_100054898 240
382 3300026075 Ga0207708_10039538 Ga0207708_100395381 240
383 3300026075 Ga0207708_10102498 Ga0207708_101024982 240
384 3300026078 Ga0207702_10020887 Ga0207702_100208874 240
385 3300026078 Ga0207702_10059391 Ga0207702_100593912 240
386 3300026088 Ga0207641_10155237 Ga0207641_101552372 240
387 3300026089 Ga0207648_10032203 Ga0207648_100322037 240
388 3300026095 Ga0207676_10185020 Ga0207676_101850202 240
389 3300026116 Ga0207674_10004108 Ga0207674_100041083 240
390 3300026116 Ga0207674_10104607 Ga0207674_101046073 240
391 3300026116 Ga0207674_10494380 Ga0207674_104943802 240
392 3300026116 Ga0207674_10586480 Ga0207674_105864802 240
393 3300026118 Ga0207675_100011497 Ga0207675_1000114974 240
394 3300026118 Ga0207675_100013260 Ga0207675_1000132603 240
395 3300026118 Ga0207675_100051279 Ga0207675_1000512794 240
396 3300026121 Ga0207683_10007708 Ga0207683_100077087 240
397 3300026121 Ga0207683_10021718 Ga0207683_100217181 240
398 3300027907 Ga0207428_10032155 Ga0207428_100321552 240
399 3300028379 Ga0268266_10122939 Ga0268266_101229392 240
400 3300028380 Ga0268265_10140894 Ga0268265_101408942 240
401 3300028381 Ga0268264_10203626 Ga0268264_102036262 240
402 3300031456 Ga0307513_10017450 Ga0307513_100174506 240
403 3300031731 Ga0307405_10025828 Ga0307405_100258283 240
404 3300031824 Ga0307413_10005292 Ga0307413_100052926 240
405 3300031852 Ga0307410_10020758 Ga0307410_100207583 240
406 3300031901 Ga0307406_10000224 Ga0307406_1000022426 240
407 3300031995 Ga0307409_100000129 Ga0307409_1000001296 240
408 3300031995 Ga0307409_100023998 Ga0307409_1000239983 240
409 3300031995 Ga0307409_100159311 Ga0307409_1001593112 240
410 3300032002 Ga0307416_100000332 Ga0307416_10000033224 240
411 3300032002 Ga0307416_100016098 Ga0307416_1000160984 240
412 3300032002 Ga0307416_100046400 Ga0307416_1000464003 240
413 3300032002 Ga0307416_100074004 Ga0307416_1000740042 240
414 3300032004 Ga0307414_10015366 Ga0307414_100153664 240
415 3300032126 Ga0307415_100000723 Ga0307415_10000072310 240
416 3300032126 Ga0307415_100006695 Ga0307415_1000066955 240
417 3300032126 Ga0307415_100020075 Ga0307415_1000200752 240
418 3300032126 Ga0307415_100107545 Ga0307415_1001075452 240
419 3300032126 Ga0307415_100120134 Ga0307415_1001201342 240
420 3300035086 Ga0373934_0000078 Ga0373934_0000078_1962_2705 240
421 3300035088 Ga0373940_0003816 Ga0373940_0003816_1147_1890 240
422 3300035111 Ga0373923_0071125 Ga0373923_0071125_82_825 240
423 3300035117 Ga0373953_0000181 Ga0373953_0000181_11320_12063 240
424 3300035118 Ga0373954_0010105 Ga0373954_0010105_2387_3130 240
425 3300035119 Ga0373956_0000098 Ga0373956_0000098_10951_11694 240
426 3300035120 Ga0373957_0000011 Ga0373957_0000011_19095_19838 240
427 3300035121 Ga0373960_0040848 Ga0373960_0040848_478_1224 240
428 3300035172 Ga0373955_0000060 Ga0373955_0000060_24890_25633 240
429 3300035241 Ga0373961_0008541 Ga0373961_0008541_1322_2065 240
430 3300035242 Ga0373962_0007363 Ga0373962_0007363_1148_1891 240
431 3300035410 Ga0373924_0000070 Ga0373924_0000070_14070_14813 240
432 3300035691 Ga0373931_0059776 Ga0373931_0059776_239_982 240
433 3300035724 Ga0373933_0000009 Ga0373933_0000009_22496_23239 240
434 3300036401 Ga0373937_0000110 Ga0373937_0000110_26443_27186 240
435 3300037853 Ga0436364_0180450 Ga0436364_0180450_25942_26685 240
436 3300037853 Ga0436364_0577320 Ga0436364_0577320_148_894 240
437 3300039450 Ga0436363_0536993 Ga0436363_0536993_2306_3049 240
438 3300039453 Ga0436362_1149216 Ga0436362_1149216_76_819 240
439 3300042437 Ga0439444_0025815 Ga0439444_0025815_40_783 240
440 3300042461 Ga0439460_0054197 Ga0439460_0054197_281_1024 240
441 3300044765 Ga0466970_0299356 Ga0466970_0299356_128_874 240
442 3300045976 Ga0466967_0182202 Ga0466967_0182202_934_1677 240
443 3300046454 Ga0495592_0000049 Ga0495592_0000049_89448_90191 240
444 3300046462 Ga0495651_0000007 Ga0495651_0000007_27229_27972 240
445 3300046463 Ga0495653_0000996 Ga0495653_0000996_16830_17573 240
446 3300046511 Ga0495608_0000076 Ga0495608_0000076_23489_24232 240
447 3300046516 Ga0495628_0034024 Ga0495628_0034024_3151_3894 240
448 3300046529 Ga0495652_0000168 Ga0495652_0000168_23514_24257 240
449 3300046536 Ga0495587_0000032 Ga0495587_0000032_16309_17052 240
450 3300046543 Ga0495645_0167309 Ga0495645_0167309_463_1206 240
451 3300046559 Ga0495667_0000072 Ga0495667_0000072_50837_51580 240
452 3300046675 Ga0495657_0000424 Ga0495657_0000424_15004_15747 240
453 3300046678 Ga0495599_0000062 Ga0495599_0000062_23514_24257 240
454 3300046680 Ga0495646_0018348 Ga0495646_0018348_1271_2014 240
455 3300046809 Ga0495600_0000743 Ga0495600_0000743_8889_9632 240
456 3300047317 Ga0495604_0000062 Ga0495604_0000062_23514_24257 240
457 3300047322 Ga0495680_0000101 Ga0495680_0000101_50613_51356 240
458 3300047444 Ga0495675_0000116 Ga0495675_0000116_6237_6980 240
459 3300048088 Ga0495602_0000115 Ga0495602_0000115_50643_51386 240
460 3300048904 Ga0496101_0132833 Ga0496101_0132833_626_1369 240
461 3300048905 Ga0496102_0077932 Ga0496102_0077932_1339_2082 240
462 3300048906 Ga0496103_0053250 Ga0496103_0053250_656_1399 240
463 3300048907 Ga0496104_0019808 Ga0496104_0019808_3135_3878 240
464 3300048908 Ga0496105_0020698 Ga0496105_0020698_1231_1974 240
465 3300048913 Ga0496110_0039368 Ga0496110_0039368_1099_1842 240
466 3300048914 Ga0496111_0048932 Ga0496111_0048932_1602_2345 240
467 3300048914 Ga0496111_0254556 Ga0496111_0254556_233_976 240
468 3300048915 Ga0496112_0129213 Ga0496112_0129213_583_1326 240
469 3300048915 Ga0496112_0170911 Ga0496112_0170911_1247_1990 240
470 3300048917 Ga0496114_0158380 Ga0496114_0158380_400_1143 240
471 3300048917 Ga0496114_0458302 Ga0496114_0458302_233_976 240
472 3300048918 Ga0496115_0164165 Ga0496115_0164165_50_793 240
473 3300048918 Ga0496115_0373531 Ga0496115_0373531_354_1097 240
474 3300048929 Ga0496126_0038279 Ga0496126_0038279_595_1338 240
475 3300049661 Ga0501217_014618 Ga0501217_014618_140_883 240
476 3300049677 Ga0501247_013301 Ga0501247_013301_88_831 240
477 3300050508 nmdc:mga09592_216765_c2 nmdc:mga09592_216765_c2_155_898 240
478 3300050511 nmdc:mga08y16_11330_c1 nmdc:mga08y16_11330_c1_8500_9243 240
479 3300050512 nmdc:mga0n895_67052_c1 nmdc:mga0n895_67052_c1_108_890 240
480 3300050514 nmdc:mga08x19_1165_c1 nmdc:mga08x19_1165_c1_15570_16352 240
481 3300050515 nmdc:mga0a205_10905_c1 nmdc:mga0a205_10905_c1_152_895 240
482 3300050515 nmdc:mga0a205_88642_c1 nmdc:mga0a205_88642_c1_1273_2016 240
483 3300053084 Ga0495595_0000198 Ga0495595_0000198_1731_2474 240
484 3300053085 Ga0495619_0175354 Ga0495619_0175354_385_1128 240
485 3300053088 Ga0500644_0000185 Ga0500644_0000185_13845_14591 240

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00756

Esterase

Putative esterase

53

268

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
5vol-assembly2.cif.gz_D bacint_04212 ferulic acid esterase 0.7788 2 238
5vol-assembly1.cif.gz_C bacint_04212 ferulic acid esterase 0.7689 2 238
5vol-assembly2.cif.gz_E bacint_04212 ferulic acid esterase 0.7688 2 238
5vol-assembly2.cif.gz_D bacint_04212 ferulic acid esterase 0.7669 2 238
1r88-assembly2.cif.gz_B the crystal structure of mycobacterium tuberculosis mpt51 (fbpc1) 0.7605 1 238
ID Description Score Start End Superfamily
af_A0A0G2JYG2_4_177_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.749 3 143 3.40.50.1820
af_Q54RL8_4_285_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.747 3 238 3.40.50.1820
1r88A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7453 1 238 3.40.50.1820
af_P94973_191_467_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7391 27 238 3.40.50.1820
1r88A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7368 1 238 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A6I1GDG3-F1-model_v4 Esterase 0.9879 17 240
AF-A0A512T551-F1-model_v4 Esterase 0.9836 1 240
AF-A0A3N5YD01-F1-model_v4 Transposase 0.9831 1 129
AF-A0A7Z9XF59-F1-model_v4 Transposase 0.983 1 147
AF-A0A4U6QJ27-F1-model_v4 Esterase 0.9824 2 240

Feature Viewer

pLDDT pTM Quality
94.54 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map