F452985

General Info

Members Datasets Scaffolds Average Seq Length
484 397 968 180

Family's Representative Sequence

Representative Sequence 3300046463|Ga0495653_0510679|Ga0495653_0510679_23_658
Length 211
Sequence MRFLVAARTAPRKPAKVQIVFCRALSDPRPMRNLPLAKVYQKLEPGPVVLLTTARAGRGGVVGFNIMTMSWHMMVEFEPPLIACVVADGDYSHAALRKTGECVIAIPGADLAEKVVGIGNCSGREVEKFARFGLTARPASSVAAPLIAECGVNIECRVVDKKLATRYNLFVLEAVKAWIDPALAQEKTLHHCGFGRFVLDGEVLQLPSSKP

Samples

Sample ID Description Type Environment
1 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
2 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
3 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
4 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
5 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
8 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
9 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
10 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
11 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
12 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
13 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
14 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
15 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
16 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
17 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
18 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
19 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
20 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
21 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
22 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
23 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
24 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
25 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
26 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
27 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
28 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
29 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
30 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
31 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
32 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
33 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
34 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
35 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
36 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
37 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
38 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
39 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
40 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
41 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
42 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
43 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
44 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
45 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
46 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
47 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
48 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
50 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
51 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
52 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
53 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
55 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
56 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
57 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
58 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
59 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
60 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
61 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
62 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
63 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
64 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
65 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
66 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
67 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
68 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
69 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
70 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
71 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
72 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
73 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
74 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
75 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
76 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
77 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
78 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
79 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
80 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
81 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
82 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
83 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
84 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
85 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
86 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
87 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
88 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
89 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
90 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
91 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
92 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
93 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
94 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
95 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
96 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
97 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
98 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
99 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
100 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
101 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
102 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
103 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
104 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
105 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
106 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
107 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
108 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
109 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
110 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
111 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
112 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
113 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
114 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
115 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
116 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
117 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
118 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
119 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
120 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
121 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
122 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
123 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
124 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
125 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
126 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
127 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
128 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
129 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
130 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
131 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
132 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
133 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
134 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
135 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
136 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
137 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
138 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
139 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
140 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
141 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
142 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
143 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
144 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
145 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
146 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
147 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
148 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
149 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
150 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
151 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
152 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
153 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
154 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
155 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
156 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
157 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
158 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
162 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
163 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
164 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
165 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
166 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
167 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
168 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
169 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
170 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
171 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
172 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
173 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
174 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
175 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
176 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
177 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
178 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
179 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
180 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
181 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
182 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
183 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
184 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
185 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
186 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
187 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
188 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
189 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
190 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
191 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
192 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
193 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
194 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
195 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
196 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
197 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
198 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
199 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
200 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
201 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
202 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
203 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
204 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
205 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
206 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
207 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
208 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
209 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
210 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
211 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
212 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
213 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
214 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
215 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
216 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
217 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
218 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
219 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
220 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
221 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
222 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
223 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
224 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
225 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
226 2643221557 Ensifer sp. Root558 Isolate Unclassified
227 2643221618 Ensifer sp. Root231 Isolate Unclassified
228 2643221655 Ensifer sp. Root1252 Isolate Unclassified
229 2643221659 Ensifer sp. Root127 Isolate Unclassified
230 2643221668 Ensifer sp. Root423 Isolate Unclassified
231 2643221712 Ensifer sp. Root258 Isolate Unclassified
232 2643221723 Ensifer sp. Root278 Isolate Unclassified
233 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
234 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
235 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
236 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
237 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
238 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
239 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
240 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
241 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
242 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
243 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
244 2802429633 Rhizobium anhuiense J3 Isolate Nodule
245 2802429634 Rhizobium anhuiense S10 Isolate Nodule
246 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
247 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
248 2802429637 Rhizobium anhuiense C15 Isolate Nodule
249 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
250 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
251 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
252 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
253 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
254 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
255 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
256 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
257 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
258 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
259 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
260 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
261 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
262 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
263 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
264 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
265 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
266 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
267 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
268 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
269 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
270 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
271 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
272 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
273 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
274 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
275 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
276 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
277 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
278 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
279 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
280 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
281 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
282 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
283 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
284 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
285 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere
286 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
287 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
288 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
289 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
290 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
291 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
292 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
293 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
294 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
295 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
296 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
297 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
298 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
299 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
300 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
301 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
302 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
303 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
304 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
305 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
306 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
307 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
308 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
309 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
310 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
311 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
312 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
313 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
314 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
315 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
316 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
317 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
318 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
319 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
320 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
321 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
322 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
323 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
324 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
325 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
326 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
327 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
328 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
329 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
330 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
331 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
332 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
333 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
334 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
335 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
336 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
337 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
338 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
339 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
340 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
341 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
342 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
343 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
344 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
345 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
346 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
347 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
348 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
349 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
350 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
351 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
352 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
353 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
354 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
355 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
356 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
357 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
358 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
359 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
360 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
361 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
362 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
363 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
364 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
365 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
366 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
367 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
368 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
369 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
370 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
371 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
372 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
373 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
374 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
375 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
376 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
377 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
378 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
379 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
380 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
381 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
382 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
383 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
384 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
385 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
386 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
387 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
388 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
389 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
390 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
391 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
392 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
393 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
394 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
395 8054002106 Azospirillum lipoferum 59b Isolate Unclassified
396 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
397 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 56.61
Metatranscriptomes 0
Isolates 43.39

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.15
Nodule 35.95
Rhizoplane 0.62
Rhizosphere 36.98
Stem 0
Stem Tuber 0
Unclassified 0.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495653_0510679 3300046463 Bacteria 748
2 JGI25158J39367_1003446 3300002739 Bacteria 2443
3 JGI25150J39212_1000238 3300002774 Bacteria 29744
4 JGI25159J45721_1000012 3300002987 Bacteria 149808
5 JGI25151J46595_10000506 3300003187 Bacteria 36556
6 JGI25151J46595_10000645 3300003187 Bacteria 29743
7 JGI25153J46596_10006251 3300003215 Bacteria 6089
8 JGI25153J46596_10026154 3300003215 Bacteria 2072
9 JGI25160J50197_1000042 3300003354 Bacteria 149808
10 JGI25161J50226_1000210 3300003374 Bacteria 37233
11 JGI25161J50226_1007117 3300003374 Bacteria 1924
12 Ga0055526_1000834 3300003771 Bacteria 23036
13 Ga0055526_1007675 3300003771 Bacteria 5554
14 Ga0055524_1011056 3300003775 Bacteria 3552
15 Ga0055536_1002660 3300003781 Bacteria 9910
16 Ga0055528_1014723 3300003790 Bacteria 2874
17 Ga0055528_1014921 3300003790 Bacteria 2838
18 Ga0055540_1008671 3300003792 Bacteria 3627
19 Ga0055531_10028477 3300003794 Bacteria 1925
20 Ga0058692_1003844 3300003856 Bacteria 4561
21 Ga0055543_1000123 3300004625 Bacteria 64977
22 Ga0055543_1000148 3300004625 Bacteria 58420
23 Ga0065165_1000174 3300005262 Bacteria 113769
24 Ga0065165_1012758 3300005262 Bacteria 3397
25 Ga0070697_100497193 3300005536 Unclassified 1066
26 Ga0075365_10001782 3300006038 Bacteria 10042
27 Ga0075362_10000427 3300006177 Bacteria 12160
28 Ga0075369_10008301 3300006186 Bacteria 3992
29 Ga0075369_10031430 3300006186 Bacteria 2241
30 Ga0075366_10017855 3300006195 Bacteria 4091
31 Ga0075366_10300393 3300006195 Bacteria 982
32 Ga0075370_10103006 3300006353 Bacteria 1653
33 Ga0075370_10468011 3300006353 Bacteria 759
34 Ga0075430_100088452 3300006846 Bacteria 2592
35 Ga0075431_100091771 3300006847 Bacteria 3134
36 Ga0075429_100361577 3300006880 Bacteria 1271
37 Ga0111539_10140812 3300009094 Bacteria 2824
38 Ga0157322_1000399 3300012490 Bacteria 1560
39 Ga0157314_1001492 3300012500 Bacteria 1675
40 Ga0157326_1015127 3300012513 Bacteria 903
41 Ga0157380_10641032 3300014326 Bacteria 1058
42 Ga0228711_1005616 3300022739 Bacteria 19035
43 Ga0228710_1003183 3300022740 Bacteria 26184
44 Ga0209436_100140 3300025208 Bacteria 35032
45 Ga0207425_1000385 3300025245 Bacteria 29798
46 Ga0207425_1010466 3300025245 Bacteria 2256
47 Ga0209129_1000467 3300025258 Bacteria 29791
48 Ga0209129_1001535 3300025258 Bacteria 12746
49 Ga0209129_1028179 3300025258 Bacteria 956
50 Ga0209673_1001721 3300025273 Bacteria 18419
51 Ga0209673_1007407 3300025273 Bacteria 5069
52 Ga0209130_1000075 3300025284 Bacteria 171698
53 Ga0209676_1016341 3300025292 Bacteria 2684
54 Ga0209025_1000097 3300025294 Bacteria 236632
55 Ga0209025_1000603 3300025294 Bacteria 64824
56 Ga0209025_1001974 3300025294 Bacteria 23554
57 Ga0209564_1000278 3300025295 Bacteria 105405
58 Ga0209564_1000966 3300025295 Bacteria 36349
59 Ga0209564_1019230 3300025295 Bacteria 2563
60 Ga0209758_1000714 3300025297 Bacteria 49025
61 Ga0209758_1002145 3300025297 Bacteria 20789
62 Ga0209758_1002343 3300025297 Bacteria 19519
63 Ga0209050_1006411 3300025298 Bacteria 6972
64 Ga0209256_1000411 3300025299 Bacteria 67351
65 Ga0209256_1005222 3300025299 Bacteria 7621
66 Ga0209256_1020620 3300025299 Bacteria 2051
67 Ga0207426_1000094 3300025302 Bacteria 275293
68 Ga0207426_1000163 3300025302 Bacteria 171698
69 Ga0209051_1000201 3300025303 Bacteria 106123
70 Ga0209051_1010915 3300025303 Bacteria 4534
71 Ga0209257_1003318 3300025304 Bacteria 13938
72 Ga0209257_1005317 3300025304 Bacteria 9131
73 Ga0209257_1030256 3300025304 Bacteria 1750
74 Ga0209257_1061964 3300025304 Bacteria 1013
75 Ga0207648_10732532 3300026089 Bacteria 918
76 Ga0209281_1000590 3300027111 Bacteria 42187
77 Ga0209281_1000640 3300027111 Bacteria 38244
78 Ga0209371_1000930 3300027312 Bacteria 22961
79 Ga0209282_1000049 3300027666 Bacteria 109875
80 Ga0209813_10015463 3300027866 Bacteria 2069
81 Ga0268266_10002965 3300028379 Bacteria 17506
82 Ga0265337_1001354 3300028556 Bacteria 12087
83 Ga0265334_10015359 3300028573 Bacteria 3181
84 Ga0265318_10032033 3300028577 Bacteria 2035
85 Ga0265323_10041719 3300028653 Bacteria 1664
86 Ga0307515_10009985 3300028794 Bacteria 18277
87 Ga0265338_10407361 3300028800 Bacteria 968
88 Ga0268256_1000585 3300030500 Bacteria 29255
89 Ga0265330_10008741 3300031235 Bacteria 4855
90 Ga0265330_10021797 3300031235 Bacteria 2919
91 Ga0265332_10037200 3300031238 Bacteria 2112
92 Ga0265328_10000060 3300031239 Bacteria 64523
93 Ga0265320_10111665 3300031240 Bacteria 1251
94 Ga0265325_10031853 3300031241 Bacteria 2818
95 Ga0265325_10049091 3300031241 Bacteria 2180
96 Ga0265325_10262423 3300031241 Unclassified 779
97 Ga0265329_10048776 3300031242 Bacteria 1350
98 Ga0265329_10089105 3300031242 Bacteria 979
99 Ga0265340_10027006 3300031247 Bacteria 2896
100 Ga0265340_10065720 3300031247 Bacteria 1727
101 Ga0265339_10041520 3300031249 Bacteria 2553
102 Ga0265339_10060852 3300031249 Bacteria 2034
103 Ga0265339_10206931 3300031249 Bacteria 965
104 Ga0265316_10001220 3300031344 Bacteria 27686
105 Ga0265316_10028984 3300031344 Bacteria 4558
106 Ga0265316_10042087 3300031344 Bacteria 3652
107 Ga0265316_10147657 3300031344 Bacteria 1763
108 Ga0265316_10429252 3300031344 Bacteria 949
109 Ga0307513_10081746 3300031456 Bacteria 3328
110 Ga0265313_10003411 3300031595 Bacteria 12876
111 Ga0265313_10007545 3300031595 Bacteria 7395
112 Ga0265313_10030568 3300031595 Bacteria 2771
113 Ga0265313_10240859 3300031595 Bacteria 740
114 Ga0307508_10320896 3300031616 Bacteria 1141
115 Ga0265314_10121125 3300031711 Bacteria 1646
116 Ga0265342_10035108 3300031712 Bacteria 3071
117 Ga0265342_10047072 3300031712 Bacteria 2589
118 Ga0265342_10339100 3300031712 Bacteria 785
119 Ga0307516_10059061 3300031730 Bacteria 3731
120 Ga0315914_1000005 3300031967 Bacteria 242195
121 Ga0315913_1001476 3300033430 Bacteria 26019
122 Ga0315915_1000004 3300033464 Bacteria 403083
123 Ga0373953_0011746 3300035117 Bacteria 3084
124 Ga0373954_0000084 3300035118 Bacteria 33354
125 Ga0373954_0177155 3300035118 Bacteria 1045
126 Ga0373956_0000384 3300035119 Bacteria 18025
127 Ga0373957_0017698 3300035120 Bacteria 2487
128 Ga0373960_0260586 3300035121 Bacteria 633
129 Ga0373955_0001982 3300035172 Bacteria 8821
130 Ga0373961_0183387 3300035241 Bacteria 730
131 Ga0373961_0192783 3300035241 Bacteria 715
132 Ga0373924_0121964 3300035410 Bacteria 1131
133 Ga0373933_0002444 3300035724 Bacteria 10470
134 Ga0439465_0145192 3300041413 Bacteria 845
135 Ga0451577_0008962 3300042876 Bacteria 9675
136 Ga0451577_0012047 3300042876 Bacteria 8136
137 Ga0453684_0000953 3300044712 Bacteria 95365
138 Ga0453684_0010320 3300044712 Bacteria 15990
139 Ga0451576_0001188 3300045051 Bacteria 46552
140 Ga0451576_0013305 3300045051 Bacteria 9205
141 Ga0451576_0055423 3300045051 Bacteria 4147
142 Ga0495592_0081249 3300046454 Bacteria 2343
143 Ga0495629_0006802 3300046459 Bacteria 8455
144 Ga0495629_0268737 3300046459 Bacteria 1172
145 Ga0495638_0000092 3300046460 Bacteria 145060
146 Ga0495651_0636826 3300046462 Bacteria 669
147 Ga0495653_0018436 3300046463 Bacteria 5667
148 Ga0495605_0369703 3300046474 Bacteria 599
149 Ga0495585_0013995 3300046492 Bacteria 4685
150 Ga0495596_0207426 3300046500 Bacteria 761
151 Ga0495607_0122482 3300046501 Bacteria 1363
152 Ga0495583_0010657 3300046506 Bacteria 5343
153 Ga0495606_0029538 3300046507 Bacteria 3846
154 Ga0495610_0028909 3300046512 Bacteria 2926
155 Ga0495610_0038815 3300046512 Bacteria 2413
156 Ga0495616_0041550 3300046513 Bacteria 2345
157 Ga0495618_0091551 3300046514 Bacteria 1944
158 Ga0495620_0056349 3300046515 Bacteria 1653
159 Ga0495620_0072800 3300046515 Bacteria 1402
160 Ga0495628_0016804 3300046516 Bacteria 6096
161 Ga0495628_0119051 3300046516 Bacteria 2027
162 Ga0495631_0061837 3300046518 Bacteria 1623
163 Ga0495632_0028294 3300046519 Bacteria 2926
164 Ga0495637_0097073 3300046520 Bacteria 1156
165 Ga0495643_0002782 3300046522 Bacteria 13374
166 Ga0495643_0025687 3300046522 Bacteria 3330
167 Ga0495643_0084604 3300046522 Bacteria 1646
168 Ga0495654_0082548 3300046530 Bacteria 1504
169 Ga0495640_0008933 3300046533 Bacteria 7826
170 Ga0495609_0035407 3300046538 Bacteria 2260
171 Ga0495597_0051003 3300046542 Bacteria 1825
172 Ga0495645_0155560 3300046543 Bacteria 1584
173 Ga0495633_0008987 3300046558 Bacteria 5563
174 Ga0495667_0010607 3300046559 Bacteria 6233
175 Ga0495668_0024161 3300046616 Bacteria 3458
176 Ga0495668_0025983 3300046616 Bacteria 3325
177 Ga0495634_0007388 3300046642 Bacteria 8268
178 Ga0495611_0290058 3300046648 Bacteria 755
179 Ga0495625_0032301 3300046660 Bacteria 3884
180 Ga0495625_0056009 3300046660 Bacteria 2808
181 Ga0495625_0258877 3300046660 Bacteria 1127
182 Ga0495635_0001844 3300046663 Bacteria 14340
183 Ga0495661_0039276 3300046665 Bacteria 2942
184 Ga0495657_0011319 3300046675 Bacteria 6675
185 Ga0495599_0003115 3300046678 Bacteria 9661
186 Ga0495623_0028476 3300046679 Bacteria 3593
187 Ga0495646_0004538 3300046680 Bacteria 8742
188 Ga0495670_0015046 3300046691 Bacteria 3806
189 Ga0495649_0294339 3300046694 Bacteria 827
190 Ga0495600_0007977 3300046809 Bacteria 6486
191 Ga0495660_0078333 3300046810 Bacteria 1737
192 Ga0495660_0325727 3300046810 Bacteria 689
193 Ga0495604_0006658 3300047317 Bacteria 9154
194 Ga0495636_0052655 3300047318 Bacteria 1708
195 Ga0495674_0033515 3300047319 Bacteria 4651
196 Ga0495672_0037238 3300047320 Bacteria 2979
197 Ga0495680_0115160 3300047322 Bacteria 1989
198 Ga0495680_0779041 3300047322 Unclassified 626
199 Ga0495683_0010490 3300047323 Bacteria 4894
200 Ga0495687_013198 3300047443 Bacteria 4324
201 Ga0495679_040902 3300047446 Bacteria 1439
202 Ga0495681_0065126 3300047470 Bacteria 1667
203 Ga0495686_0027225 3300047472 Bacteria 3734
204 Ga0495686_0054633 3300047472 Bacteria 2500
205 Ga0495686_0714776 3300047472 Bacteria 510
206 Ga0495593_0002656 3300047673 Bacteria 10746
207 Ga0495602_0001871 3300048088 Bacteria 21055
208 Ga0495615_0008567 3300048090 Bacteria 1983
209 Ga0495626_0053450 3300048091 Bacteria 1859
210 Ga0496113_0030706 3300048916 Bacteria 3892
211 Ga0496116_0001605 3300048919 Bacteria 24833
212 Ga0496117_0000033 3300048920 Bacteria 345605
213 Ga0496118_0000748 3300048921 Bacteria 52574
214 Ga0496119_0001309 3300048922 Bacteria 30695
215 Ga0496119_0191957 3300048922 Bacteria 1063
216 Ga0496120_0000509 3300048923 Bacteria 60589
217 Ga0496120_0353600 3300048923 Bacteria 659
218 Ga0496122_0000365 3300048925 Bacteria 97184
219 Ga0496122_0003590 3300048925 Bacteria 20223
220 Ga0496122_0017448 3300048925 Bacteria 6710
221 Ga0496123_0000298 3300048926 Bacteria 97184
222 Ga0496123_0002846 3300048926 Bacteria 20442
223 Ga0496123_0011370 3300048926 Bacteria 7724
224 Ga0496124_0001649 3300048927 Bacteria 31949
225 Ga0496124_0002269 3300048927 Bacteria 25484
226 Ga0496125_0001442 3300048928 Bacteria 34575
227 Ga0496125_0032410 3300048928 Bacteria 4642
228 Ga0496126_0013056 3300048929 Bacteria 8476
229 Ga0495682_0042002 3300049460 Bacteria 1676
230 Ga0501034_0025963 3300049571 Bacteria 5967
231 Ga0501034_0881085 3300049571 Bacteria 784
232 Ga0501046_0564473 3300049580 Bacteria 810
233 Ga0501047_0215596 3300049581 Bacteria 1777
234 Ga0501067_0875929 3300049583 Bacteria 506
235 Ga0501072_0018506 3300049588 Bacteria 5366
236 Ga0501073_0011816 3300049589 Bacteria 6373
237 Ga0501077_0590758 3300049593 Bacteria 713
238 Ga0501236_054802 3300049670 Bacteria 694
239 Ga0501080_0364576 3300049742 Bacteria 1303
240 Ga0501080_0875326 3300049742 Bacteria 784
241 Ga0501083_0018236 3300049744 Bacteria 4891
242 Ga0501083_0052738 3300049744 Bacteria 2732
243 nmdc:mga03683_2838_c1 3300050489 Bacteria 5460
244 nmdc:mga03n38_77849_c1 3300050490 Bacteria 1551
245 nmdc:mga0yw44_6939_c1 3300050492 Bacteria 5524
246 nmdc:mga0k408_3431_c2 3300050493 Bacteria 2129
247 nmdc:mga06z11_265589_c1 3300050494 Bacteria 1014
248 nmdc:mga04h51_50024_c1 3300050495 Bacteria 1399
249 nmdc:mga09592_494950_c1 3300050508 Bacteria 1053
250 nmdc:mga0qj67_73375_c1 3300050509 Bacteria 2733
251 nmdc:mga0sz30_123656_c1 3300050516 Bacteria 1138
252 nmdc:mga0sz30_20626_c1 3300050516 Bacteria 2659
253 Ga0495601_0031759 3300053077 Bacteria 3283
254 Ga0495595_0010611 3300053084 Bacteria 3832
255 Ga0495619_0004437 3300053085 Bacteria 8950
256 Ga0500578_0308372 3300053086 Bacteria 936
257 Ga0500578_0420474 3300053086 Bacteria 766
258 Ga0500557_012734 3300053105 Bacteria 2190
259 Ga0500594_0001433 3300053118 Bacteria 5171
260 Ga0500618_000585 3300053125 Bacteria 22530
261 Ga0500618_002296 3300053125 Bacteria 7361
262 Ga0500568_0000460 3300053139 Bacteria 30312
263 Ga0500588_0136035 3300053146 Bacteria 879
264 Ga0500616_0002470 3300053153 Bacteria 15341
265 Ga0500616_0007659 3300053153 Bacteria 6821
266 Ga0500616_0016527 3300053153 Bacteria 4197
267 Ga0500627_0316259 3300053158 Bacteria 679
268 Ga0500636_0059190 3300053177 Bacteria 2239
269 Ga0501084_0276809 3300054114 Bacteria 1417
270 Ga0501084_0703523 3300054114 Bacteria 852
271 Ga0590075_032359 3300059424 Bacteria 1327
272 Ga0501082_0042709 3300060353 Bacteria 3908
273 Ga0501082_0132121 3300060353 Bacteria 2166
274 Ga0501082_0238404 3300060353 Bacteria 1583
275 2510893994 2510461076 Bacteria 8618824
276 2510899019 2510461076 Bacteria 8618824
277 2511182019 2510917028 Bacteria 6185411
278 2512974938 2512875026 Bacteria 6861065
279 2513575574 2513237085 Bacteria 7695351
280 2513585912 2513237086 Bacteria 7265287
281 2513603727 2513237089 Bacteria 6553624
282 2513632843 2513237093 Bacteria 7545552
283 2513710429 2513237103 Bacteria 7647401
284 2513987721 2513237156 Bacteria 6402557
285 2514000602 2513237159 Bacteria 6810126
286 2514004315 2513237160 Bacteria 6650282
287 2515634864 2515154113 Bacteria 7807172
288 2515656040 2515154116 Bacteria 7552979
289 2515739288 2515154134 Bacteria 7220242
290 2517040334 2516653077 Bacteria 7555578
291 2517075826 2516653085 Bacteria 7346596
292 2517567585 2517487022 Bacteria 7227575
293 2524453799 2524023207 Bacteria 6813453
294 2551681746 2551306084 Bacteria 8942552
295 2551685242 2551306085 Bacteria 7347181
296 2551690484 2551306086 Bacteria 6843938
297 2551729237 2551306091 Bacteria 7086830
298 2551732442 2551306092 Bacteria 6992595
299 2585268680 2582581306 Bacteria 6450535
300 2585324889 2582581315 Bacteria 7318924
301 2585334530 2582581316 Bacteria 7774528
302 2585395085 2582581866 Bacteria 6859583
303 2585404206 2582581867 Bacteria 7184437
304 2585528921 2585427526 Bacteria 7258840
305 2585540184 2585427528 Bacteria 6842387
306 2585820618 2585427590 Bacteria 6824633
307 2585838382 2585427593 Bacteria 7141551
308 2599605383 2599185210 Bacteria 5624189
309 2600194549 2599185352 Bacteria 7228948
310 2643803859 2643221557 Bacteria 7184309
311 2644109650 2643221618 Bacteria 7717186
312 2644312528 2643221655 Bacteria 7722067
313 2644334230 2643221659 Bacteria 7890716
314 2644376956 2643221668 Bacteria 7306521
315 2644618258 2643221712 Bacteria 7729434
316 2644672421 2643221723 Bacteria 7095460
317 2692318930 2690316117 Bacteria 6800650
318 2725951660 2724679232 Bacteria 7646494
319 2739037823 2738541333 Bacteria 7106503
320 2766063614 2765235942 Bacteria 7445910
321 2792630348 2791355092 Bacteria 6248105
322 2802718221 2802428858 Bacteria 6636079
323 2802725984 2802428859 Bacteria 6667919
324 2802731304 2802428860 Bacteria 6525526
325 2802736502 2802428861 Bacteria 6534206
326 2802744477 2802428862 Bacteria 6633353
327 2802749934 2802428863 Bacteria 6410669
328 2806048530 2802429633 Bacteria 7341974
329 2806053627 2802429634 Bacteria 7083200
330 2806060827 2802429635 Bacteria 7650140
331 2806067702 2802429636 Bacteria 7597525
332 2806072946 2802429637 Bacteria 7067217
333 2819561679 2818991439 Bacteria 6907412
334 2821130515 2821123053 Bacteria 7836056
335 2838016739 2838016132 Bacteria 6577831
336 2838693457 2838686498 Bacteria 7807632
337 2838719445 2838714209 Bacteria 5525906
338 2838724842 2838719591 Bacteria 5523910
339 2838735150 2838729681 Bacteria 7400765
340 2838741855 2838736955 Bacteria 5760694
341 2838747999 2838742623 Bacteria 7396178
342 2841845729 2841840854 Bacteria 5761912
343 2841857567 2841851746 Bacteria 7532261
344 2842111180 2842110456 Bacteria 7656360
345 2842145433 2842140634 Bacteria 5759631
346 2842162914 2842156927 Bacteria 6894975
347 2842165218 2842163707 Bacteria 6916235
348 2842175690 2842170452 Bacteria 5525737
349 2842186556 2842180545 Bacteria 6888678
350 2842192568 2842187318 Bacteria 5524014
351 2842216899 2842211629 Bacteria 5523832
352 2842220398 2842217011 Bacteria 7497767
353 2842229583 2842224351 Bacteria 5524473
354 2842235760 2842229732 Bacteria 7475766
355 2842249088 2842243621 Bacteria 7421798
356 2842263043 2842257432 Bacteria 7401195
357 2842277936 2842271015 Bacteria 7807131
358 2842309918 2842304105 Bacteria 7023636
359 2842523591 2842521101 Bacteria 6569494
360 2844454688 2844454524 Bacteria 7952546
361 2847422564 2847417321 Bacteria 6913799
362 2855830062 2855825444 Bacteria 6785811
363 2855844953 2855839649 Bacteria 7135830
364 2855875904 2855872281 Bacteria 6964271
365 2857523354 2857516855 Bacteria 7787325
366 2857535789 2857531043 Bacteria 6754041
367 2858804671 2858800743 Bacteria 6603254
368 2883296936 2883291878 Bacteria 5894118
369 2883359720 2883354860 Bacteria 5865246
370 2899805772 2899803654 Bacteria 5577784
371 2899846065 2899845264 Bacteria 5672268
372 2915986877 2915980308 Bacteria 6624279
373 2915993978 2915993759 Bacteria 7016183
374 2916010182 2916007675 Bacteria 6898660
375 2916016303 2916014648 Bacteria 6946486
376 2916040921 2916035215 Bacteria 6755766
377 2916046203 2916041962 Bacteria 6820487
378 2916063786 2916061851 Bacteria 6737736
379 2916073547 2916068649 Bacteria 6943657
380 2919469126 2919468124 Bacteria 9133025
381 2921238131 2921237296 Bacteria 6876710
382 2921247987 2921244191 Bacteria 6568419
383 2921253468 2921250672 Bacteria 6677771
384 2921286138 2921282425 Bacteria 6826397
385 2921292758 2921289301 Bacteria 7316391
386 2921304671 2921296804 Bacteria 7176999
387 2924149761 2924144063 Bacteria 6883928
388 2924153087 2924150972 Bacteria 7169444
389 2924169745 2924165586 Bacteria 7260590
390 2924203667 2924200457 Bacteria 6757188
391 2924212392 2924207177 Bacteria 6917007
392 2924221391 2924214083 Bacteria 7080103
393 2924228151 2924221636 Bacteria 7113495
394 2924231793 2924228884 Bacteria 6633132
395 2926759781 2926754445 Bacteria 5964435
396 2928526482 2928521798 Bacteria 4960112
397 2933576353 2933570622 Bacteria 7023390
398 2933587205 2933586486 Bacteria 7667493
399 2935905163 2935901341 Bacteria 7341747
400 2937003827 2937002841 Bacteria 6934057
401 2937018890 2937016420 Bacteria 6782579
402 2937035325 2937029754 Bacteria 6424026
403 2937040088 2937036028 Bacteria 6846469
404 2937053206 2937049772 Bacteria 6757901
405 2937077791 2937071275 Bacteria 6984483
406 2937079112 2937078374 Bacteria 6610289
407 2937085029 2937084907 Bacteria 6618516
408 2937095449 2937091812 Bacteria 6979387
409 2937131377 2937126314 Bacteria 6771275
410 2937131902 2937126314 Bacteria 6771275
411 2937828015 2937822353 Bacteria 7290551
412 2941505736 2941499720 Bacteria 7599444
413 2957376165 2957375807 Bacteria 6425588
414 2957391157 2957388812 Bacteria 6778072
415 2957412189 2957408893 Bacteria 6558585
416 2957420296 2957415311 Bacteria 6991633
417 2957434476 2957430029 Bacteria 7022557
418 2957440887 2957437181 Bacteria 6568994
419 2957470037 2957464669 Bacteria 6568877
420 2957477231 2957471148 Bacteria 6797643
421 2957488316 2957484790 Bacteria 6703082
422 2957501121 2957498199 Bacteria 7126688
423 2957509837 2957505466 Bacteria 7253085
424 2960586566 2960584000 Bacteria 6864594
425 2960597540 2960591022 Bacteria 6622873
426 2960606679 2960603979 Bacteria 6898737
427 2960627752 2960624210 Bacteria 6875384
428 2960636734 2960631154 Bacteria 6732508
429 2960686238 2960680706 Bacteria 6624464
430 2960696994 2960693952 Bacteria 6749742
431 2964622017 2964621998 Bacteria 6834995
432 2964648717 2964643177 Bacteria 6820887
433 2964650687 2964649959 Bacteria 6675118
434 2964656876 2964656573 Bacteria 7100150
435 2964669500 2964663802 Bacteria 7019362
436 2964684210 2964678106 Bacteria 6792020
437 2964689655 2964685014 Bacteria 6839111
438 2964697586 2964691889 Bacteria 6802758
439 2964708260 2964705432 Bacteria 7114648
440 2964712039 2964705432 Bacteria 7114648
441 2967689851 2967686174 Bacteria 6678622
442 2967700079 2967699805 Bacteria 6854538
443 2967713513 2967706974 Bacteria 7186053
444 2967719208 2967714385 Bacteria 7000047
445 2967727419 2967721400 Bacteria 7073753
446 2967733259 2967728569 Bacteria 6641507
447 2967748561 2967742019 Bacteria 6794534
448 2967750587 2967748971 Bacteria 6733771
449 2967765504 2967762386 Bacteria 6923502
450 2967772445 2967769361 Bacteria 6587838
451 2970031429 2970026789 Bacteria 6785236
452 2970044230 2970040964 Bacteria 6731123
453 2970049771 2970047711 Bacteria 7088379
454 2970055784 2970054988 Bacteria 6611507
455 2970092434 2970088815 Bacteria 6933825
456 2970115492 2970109326 Bacteria 6863976
457 2970119435 2970116247 Bacteria 6501857
458 2970127877 2970122695 Bacteria 6625855
459 2970143003 2970136068 Bacteria 7207982
460 2970147873 2970143518 Bacteria 6446480
461 2970153448 2970149975 Bacteria 6779706
462 2970166291 2970164137 Bacteria 6861252
463 2970174845 2970170962 Bacteria 6876229
464 2970191035 2970184632 Bacteria 7054431
465 2977529355 2977523885 Bacteria 6960446
466 2977536598 2977530762 Bacteria 6951399
467 2977541269 2977537788 Bacteria 6929320
468 2977548701 2977544691 Bacteria 6875412
469 2977561532 2977558990 Bacteria 6863948
470 2977574340 2977572785 Bacteria 6763888
471 2977583154 2977579622 Bacteria 6772100
472 2979103466 2979100975 Bacteria 5423623
473 639647854 639633055 Bacteria 7751309
474 648740003 648276728 Bacteria 6968865
475 650741355 650716007 Bacteria 5573770
476 8004005126 8003999396 Bacteria 7063185
477 8005314848 8005307578 Bacteria 7395396
478 8005378579 8005376324 Bacteria 6590079
479 8005575209 8005570704 Bacteria 6957481
480 8023682030 8023680758 Bacteria 7729763
481 8054007271 8054002106 Bacteria 7987183
482 8056877900 8056875544 Bacteria 4355797
483 8056879156 8056875544 Bacteria 4355797
484 8057875711 8057874678 Bacteria 7494653
485 Ga0495653_0510679
486 JGI25158J39367_1003446
487 JGI25150J39212_1000238
488 JGI25159J45721_1000012
489 JGI25151J46595_10000506
490 JGI25151J46595_10000645
491 JGI25153J46596_10006251
492 JGI25153J46596_10026154
493 JGI25160J50197_1000042
494 JGI25161J50226_1000210
495 JGI25161J50226_1007117
496 Ga0055526_1000834
497 Ga0055526_1007675
498 Ga0055524_1011056
499 Ga0055536_1002660
500 Ga0055528_1014723
501 Ga0055528_1014921
502 Ga0055540_1008671
503 Ga0055531_10028477
504 Ga0058692_1003844
505 Ga0055543_1000123
506 Ga0055543_1000148
507 Ga0065165_1000174
508 Ga0065165_1012758
509 Ga0070697_100497193
510 Ga0075365_10001782
511 Ga0075362_10000427
512 Ga0075369_10008301
513 Ga0075369_10031430
514 Ga0075366_10017855
515 Ga0075366_10300393
516 Ga0075370_10103006
517 Ga0075370_10468011
518 Ga0075430_100088452
519 Ga0075431_100091771
520 Ga0075429_100361577
521 Ga0111539_10140812
522 Ga0157322_1000399
523 Ga0157314_1001492
524 Ga0157326_1015127
525 Ga0157380_10641032
526 Ga0228711_1005616
527 Ga0228710_1003183
528 Ga0209436_100140
529 Ga0207425_1000385
530 Ga0207425_1010466
531 Ga0209129_1000467
532 Ga0209129_1001535
533 Ga0209129_1028179
534 Ga0209673_1001721
535 Ga0209673_1007407
536 Ga0209130_1000075
537 Ga0209676_1016341
538 Ga0209025_1000097
539 Ga0209025_1000603
540 Ga0209025_1001974
541 Ga0209564_1000278
542 Ga0209564_1000966
543 Ga0209564_1019230
544 Ga0209758_1000714
545 Ga0209758_1002145
546 Ga0209758_1002343
547 Ga0209050_1006411
548 Ga0209256_1000411
549 Ga0209256_1005222
550 Ga0209256_1020620
551 Ga0207426_1000094
552 Ga0207426_1000163
553 Ga0209051_1000201
554 Ga0209051_1010915
555 Ga0209257_1003318
556 Ga0209257_1005317
557 Ga0209257_1030256
558 Ga0209257_1061964
559 Ga0207648_10732532
560 Ga0209281_1000590
561 Ga0209281_1000640
562 Ga0209371_1000930
563 Ga0209282_1000049
564 Ga0209813_10015463
565 Ga0268266_10002965
566 Ga0265337_1001354
567 Ga0265334_10015359
568 Ga0265318_10032033
569 Ga0265323_10041719
570 Ga0307515_10009985
571 Ga0265338_10407361
572 Ga0268256_1000585
573 Ga0265330_10008741
574 Ga0265330_10021797
575 Ga0265332_10037200
576 Ga0265328_10000060
577 Ga0265320_10111665
578 Ga0265325_10031853
579 Ga0265325_10049091
580 Ga0265325_10262423
581 Ga0265329_10048776
582 Ga0265329_10089105
583 Ga0265340_10027006
584 Ga0265340_10065720
585 Ga0265339_10041520
586 Ga0265339_10060852
587 Ga0265339_10206931
588 Ga0265316_10001220
589 Ga0265316_10028984
590 Ga0265316_10042087
591 Ga0265316_10147657
592 Ga0265316_10429252
593 Ga0307513_10081746
594 Ga0265313_10003411
595 Ga0265313_10007545
596 Ga0265313_10030568
597 Ga0265313_10240859
598 Ga0307508_10320896
599 Ga0265314_10121125
600 Ga0265342_10035108
601 Ga0265342_10047072
602 Ga0265342_10339100
603 Ga0307516_10059061
604 Ga0315914_1000005
605 Ga0315913_1001476
606 Ga0315915_1000004
607 Ga0373953_0011746
608 Ga0373954_0000084
609 Ga0373954_0177155
610 Ga0373956_0000384
611 Ga0373957_0017698
612 Ga0373960_0260586
613 Ga0373955_0001982
614 Ga0373961_0183387
615 Ga0373961_0192783
616 Ga0373924_0121964
617 Ga0373933_0002444
618 Ga0439465_0145192
619 Ga0451577_0008962
620 Ga0451577_0012047
621 Ga0453684_0000953
622 Ga0453684_0010320
623 Ga0451576_0001188
624 Ga0451576_0013305
625 Ga0451576_0055423
626 Ga0495592_0081249
627 Ga0495629_0006802
628 Ga0495629_0268737
629 Ga0495638_0000092
630 Ga0495651_0636826
631 Ga0495653_0018436
632 Ga0495605_0369703
633 Ga0495585_0013995
634 Ga0495596_0207426
635 Ga0495607_0122482
636 Ga0495583_0010657
637 Ga0495606_0029538
638 Ga0495610_0028909
639 Ga0495610_0038815
640 Ga0495616_0041550
641 Ga0495618_0091551
642 Ga0495620_0056349
643 Ga0495620_0072800
644 Ga0495628_0016804
645 Ga0495628_0119051
646 Ga0495631_0061837
647 Ga0495632_0028294
648 Ga0495637_0097073
649 Ga0495643_0002782
650 Ga0495643_0025687
651 Ga0495643_0084604
652 Ga0495654_0082548
653 Ga0495640_0008933
654 Ga0495609_0035407
655 Ga0495597_0051003
656 Ga0495645_0155560
657 Ga0495633_0008987
658 Ga0495667_0010607
659 Ga0495668_0024161
660 Ga0495668_0025983
661 Ga0495634_0007388
662 Ga0495611_0290058
663 Ga0495625_0032301
664 Ga0495625_0056009
665 Ga0495625_0258877
666 Ga0495635_0001844
667 Ga0495661_0039276
668 Ga0495657_0011319
669 Ga0495599_0003115
670 Ga0495623_0028476
671 Ga0495646_0004538
672 Ga0495670_0015046
673 Ga0495649_0294339
674 Ga0495600_0007977
675 Ga0495660_0078333
676 Ga0495660_0325727
677 Ga0495604_0006658
678 Ga0495636_0052655
679 Ga0495674_0033515
680 Ga0495672_0037238
681 Ga0495680_0115160
682 Ga0495680_0779041
683 Ga0495683_0010490
684 Ga0495687_013198
685 Ga0495679_040902
686 Ga0495681_0065126
687 Ga0495686_0027225
688 Ga0495686_0054633
689 Ga0495686_0714776
690 Ga0495593_0002656
691 Ga0495602_0001871
692 Ga0495615_0008567
693 Ga0495626_0053450
694 Ga0496113_0030706
695 Ga0496116_0001605
696 Ga0496117_0000033
697 Ga0496118_0000748
698 Ga0496119_0001309
699 Ga0496119_0191957
700 Ga0496120_0000509
701 Ga0496120_0353600
702 Ga0496122_0000365
703 Ga0496122_0003590
704 Ga0496122_0017448
705 Ga0496123_0000298
706 Ga0496123_0002846
707 Ga0496123_0011370
708 Ga0496124_0001649
709 Ga0496124_0002269
710 Ga0496125_0001442
711 Ga0496125_0032410
712 Ga0496126_0013056
713 Ga0495682_0042002
714 Ga0501034_0025963
715 Ga0501034_0881085
716 Ga0501046_0564473
717 Ga0501047_0215596
718 Ga0501067_0875929
719 Ga0501072_0018506
720 Ga0501073_0011816
721 Ga0501077_0590758
722 Ga0501236_054802
723 Ga0501080_0364576
724 Ga0501080_0875326
725 Ga0501083_0018236
726 Ga0501083_0052738
727 nmdc:mga03683_2838_c1
728 nmdc:mga03n38_77849_c1
729 nmdc:mga0yw44_6939_c1
730 nmdc:mga0k408_3431_c2
731 nmdc:mga06z11_265589_c1
732 nmdc:mga04h51_50024_c1
733 nmdc:mga09592_494950_c1
734 nmdc:mga0qj67_73375_c1
735 nmdc:mga0sz30_123656_c1
736 nmdc:mga0sz30_20626_c1
737 Ga0495601_0031759
738 Ga0495595_0010611
739 Ga0495619_0004437
740 Ga0500578_0308372
741 Ga0500578_0420474
742 Ga0500557_012734
743 Ga0500594_0001433
744 Ga0500618_000585
745 Ga0500618_002296
746 Ga0500568_0000460
747 Ga0500588_0136035
748 Ga0500616_0002470
749 Ga0500616_0007659
750 Ga0500616_0016527
751 Ga0500627_0316259
752 Ga0500636_0059190
753 Ga0501084_0276809
754 Ga0501084_0703523
755 Ga0590075_032359
756 Ga0501082_0042709
757 Ga0501082_0132121
758 Ga0501082_0238404
759 2510893994
760 2510899019
761 2511182019
762 2512974938
763 2513575574
764 2513585912
765 2513603727
766 2513632843
767 2513710429
768 2513987721
769 2514000602
770 2514004315
771 2515634864
772 2515656040
773 2515739288
774 2517040334
775 2517075826
776 2517567585
777 2524453799
778 2551681746
779 2551685242
780 2551690484
781 2551729237
782 2551732442
783 2585268680
784 2585324889
785 2585334530
786 2585395085
787 2585404206
788 2585528921
789 2585540184
790 2585820618
791 2585838382
792 2599605383
793 2600194549
794 2643803859
795 2644109650
796 2644312528
797 2644334230
798 2644376956
799 2644618258
800 2644672421
801 2692318930
802 2725951660
803 2739037823
804 2766063614
805 2792630348
806 2802718221
807 2802725984
808 2802731304
809 2802736502
810 2802744477
811 2802749934
812 2806048530
813 2806053627
814 2806060827
815 2806067702
816 2806072946
817 2819561679
818 2821130515
819 2838016739
820 2838693457
821 2838719445
822 2838724842
823 2838735150
824 2838741855
825 2838747999
826 2841845729
827 2841857567
828 2842111180
829 2842145433
830 2842162914
831 2842165218
832 2842175690
833 2842186556
834 2842192568
835 2842216899
836 2842220398
837 2842229583
838 2842235760
839 2842249088
840 2842263043
841 2842277936
842 2842309918
843 2842523591
844 2844454688
845 2847422564
846 2855830062
847 2855844953
848 2855875904
849 2857523354
850 2857535789
851 2858804671
852 2883296936
853 2883359720
854 2899805772
855 2899846065
856 2915986877
857 2915993978
858 2916010182
859 2916016303
860 2916040921
861 2916046203
862 2916063786
863 2916073547
864 2919469126
865 2921238131
866 2921247987
867 2921253468
868 2921286138
869 2921292758
870 2921304671
871 2924149761
872 2924153087
873 2924169745
874 2924203667
875 2924212392
876 2924221391
877 2924228151
878 2924231793
879 2926759781
880 2928526482
881 2933576353
882 2933587205
883 2935905163
884 2937003827
885 2937018890
886 2937035325
887 2937040088
888 2937053206
889 2937077791
890 2937079112
891 2937085029
892 2937095449
893 2937131377
894 2937131902
895 2937828015
896 2941505736
897 2957376165
898 2957391157
899 2957412189
900 2957420296
901 2957434476
902 2957440887
903 2957470037
904 2957477231
905 2957488316
906 2957501121
907 2957509837
908 2960586566
909 2960597540
910 2960606679
911 2960627752
912 2960636734
913 2960686238
914 2960696994
915 2964622017
916 2964648717
917 2964650687
918 2964656876
919 2964669500
920 2964684210
921 2964689655
922 2964697586
923 2964708260
924 2964712039
925 2967689851
926 2967700079
927 2967713513
928 2967719208
929 2967727419
930 2967733259
931 2967748561
932 2967750587
933 2967765504
934 2967772445
935 2970031429
936 2970044230
937 2970049771
938 2970055784
939 2970092434
940 2970115492
941 2970119435
942 2970127877
943 2970143003
944 2970147873
945 2970153448
946 2970166291
947 2970174845
948 2970191035
949 2977529355
950 2977536598
951 2977541269
952 2977548701
953 2977561532
954 2977574340
955 2977583154
956 2979103466
957 639647854
958 648740003
959 650741355
960 8004005126
961 8005314848
962 8005378579
963 8005575209
964 8023682030
965 8054007271
966 8056877900
967 8056879156
968 8057875711

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01613

Flavin_Reduct

Flavin reductase like domain

42

197

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3e4v-assembly1.cif.gz_B crystal structure of nadh:fmn oxidoreductase like protein in complex with fmn (yp_544701.1) from methylobacillus flagellatus kt at 1.40 a resolution 0.9689 2 177
3e4v-assembly1.cif.gz_B crystal structure of nadh:fmn oxidoreductase like protein in complex with fmn (yp_544701.1) from methylobacillus flagellatus kt at 1.40 a resolution 0.9479 2 177
3hmz-assembly1.cif.gz_A-2 crystal structure of a fmn-binding domain of flavin reductases-like enzyme (sbal_0626) from shewanella baltica os155 at 1.50 a resolution 0.9261 2 168
2d5m-assembly1.cif.gz_A-2 flavoredoxin of desulfovibrio vulgaris (miyazaki f) 0.9233 16 168
1i0s-assembly1.cif.gz_A archaeoglobus fulgidus ferric reductase complex with nadp+ 0.8824 17 148
ID Description Score Start End Superfamily
3e4vB01 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.9579 2 171 2.30.110.10
3e4vB01 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.9469 2 171 2.30.110.10
2d5mA00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.9233 16 168 2.30.110.10
af_P76121_1_188_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.9187 2 168 2.30.110.10
3hmzA00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.898 2 168 2.30.110.10
ID Description Score Start End GO Terms
AF-A0A4Q5QRB2-F1-model_v4 Flavin reductase family protein 0.9965 1 125 GO:0010181
GO:0016646
AF-A0A4Q5QRB2-F1-model_v4 Flavin reductase family protein 0.9886 1 125 GO:0010181
GO:0016646
AF-A0A258SKZ0-F1-model_v4 Flavin reductase 0.9871 2 142 GO:0010181
GO:0016646
AF-A0A847JCZ9-F1-model_v4 Flavin reductase family protein 0.9831 2 168 GO:0010181
GO:0016646
AF-A0A7W5PL62-F1-model_v4 deleted 0.9817 9 147

Map