F452953

General Info

Members Datasets Scaffolds Average Seq Length
484 222 483 471

Family's Representative Sequence

Representative Sequence 3300026142|Ga0207698_10169939|Ga0207698_101699392
Length 513
Sequence VKHAAELGAHTFGFVWSQDVVSTLEALAGAGFRLFQVLASPPHVDPFACPPAQRRRIRDVVAGCGGRIASVDLAASYYERIEQLNPRLNVYLSLTKDRALEHAAEVDATAAKGDPLPPLAGIPVGIKDVLVMRGAPSTAGSKILQGYEPPYDATVVSKLEAAGAVLLGKLNCDEFAMGSSNENSAYGPVLNPVDTGRVPGMAVATLGTDTGGSIRQPASFCGVVGVLPTYGRVSRYGLIAFASSLDRVGPFAANVRDAATMLGVIAGHDPMDATSSPVPVPDYAAESDKPVEGLRIGVPAEYFGEGLDPEVRANIEHGIGILKSAGCMVKPISLPHTRYAIPTYYLVATAEASANLARFDGVRYGYRSPASDTLSAMYSHSRDEGFGAEVKRRILLGTYALSAGYYDAYYLKAQQVRRLLAEEFIRMFAEVDAIVTPTAPTPAFKLGEKTGDPLAMYLADIYTVTASLAGICGVTVPCGTTRTGLPVGMQVLAAHMNEGTAFRVARAVEAGQK

Samples

Sample ID Description Type Environment
1 2884215851 Edaphobacter sp. 12200R-103 Isolate Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
32 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
33 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
38 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
39 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
41 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
42 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
43 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
44 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
45 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
49 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
56 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
57 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
58 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
59 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
65 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
66 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
67 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
68 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
69 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
104 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
105 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
106 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
107 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
108 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
109 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
110 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
111 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
112 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
113 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
114 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
115 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
116 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
117 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
118 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
119 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
120 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
121 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
122 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
123 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
124 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
125 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
126 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
127 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
128 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
129 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
130 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
131 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
132 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
133 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
134 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
135 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
136 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
137 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
138 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
139 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
140 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
141 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
142 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
143 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
144 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
145 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
146 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
147 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
148 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
149 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
150 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
151 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
152 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
153 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
154 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
155 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
156 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
157 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
158 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
159 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
160 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
161 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
162 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
163 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
164 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
165 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
166 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
167 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
168 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
169 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
170 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
171 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
172 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
173 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
174 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
175 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
176 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
177 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
178 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
179 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
180 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
181 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
182 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
183 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
184 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
185 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
186 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
187 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
188 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
189 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
190 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
203 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
204 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
205 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
206 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
207 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
208 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
209 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
210 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
213 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
214 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
215 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
216 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
217 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
218 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
219 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
220 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
221 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
222 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.79
Metatranscriptomes 0
Isolates 0.21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.83
Nodule 0
Rhizoplane 3.93
Rhizosphere 93.39
Stem 0
Stem Tuber 0
Unclassified 1.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10033281 3300003320 Bacteria 7193
2 Ga0070658_10000101 3300005327 Bacteria 75550
3 Ga0070658_10016181 3300005327 Bacteria 5966
4 Ga0070658_10018010 3300005327 Bacteria 5649
5 Ga0070683_100006870 3300005329 Bacteria 9563
6 Ga0070683_100009696 3300005329 Bacteria 8243
7 Ga0070683_100048922 3300005329 Bacteria 3909
8 Ga0068869_100001206 3300005334 Bacteria 15200
9 Ga0070666_10015665 3300005335 Bacteria 4839
10 Ga0070680_100071499 3300005336 Bacteria 2851
11 Ga0070680_100096035 3300005336 Bacteria 2457
12 Ga0068868_100013750 3300005338 Bacteria 5946
13 Ga0068868_100029154 3300005338 Bacteria 4226
14 Ga0068868_100031339 3300005338 Bacteria 4083
15 Ga0070660_100004584 3300005339 Bacteria 9551
16 Ga0070660_100105792 3300005339 Bacteria 2234
17 Ga0070661_100008544 3300005344 Bacteria 7081
18 Ga0070661_100023533 3300005344 Bacteria 4416
19 Ga0070671_100000235 3300005355 Bacteria 37235
20 Ga0070671_100001212 3300005355 Bacteria 19302
21 Ga0070671_100016792 3300005355 Bacteria 5920
22 Ga0070659_100001286 3300005366 Bacteria 18206
23 Ga0070659_100024272 3300005366 Bacteria 4647
24 Ga0070667_100017390 3300005367 Bacteria 5959
25 Ga0070667_100095609 3300005367 Bacteria 2562
26 Ga0070708_100008934 3300005445 Bacteria 8070
27 Ga0070663_100006615 3300005455 Bacteria 6986
28 Ga0070681_10065990 3300005458 Bacteria 3588
29 Ga0070681_10160006 3300005458 Bacteria 2175
30 Ga0068867_100097470 3300005459 Bacteria 2240
31 Ga0070706_100001749 3300005467 Bacteria 22543
32 Ga0070707_100153770 3300005468 Bacteria 2240
33 Ga0070684_100008565 3300005535 Bacteria 8007
34 Ga0070684_100256572 3300005535 Bacteria 1599
35 Ga0070697_100001488 3300005536 Bacteria 17819
36 Ga0068853_100000176 3300005539 Bacteria 44619
37 Ga0068853_100000912 3300005539 Bacteria 20646
38 Ga0068853_100068197 3300005539 Bacteria 3092
39 Ga0068853_100077211 3300005539 Bacteria 2909
40 Ga0070665_100022144 3300005548 Bacteria 6392
41 Ga0070665_100118489 3300005548 Bacteria 2650
42 Ga0068855_100001117 3300005563 Bacteria 33353
43 Ga0068855_100002330 3300005563 Bacteria 23450
44 Ga0068855_100003821 3300005563 Bacteria 18410
45 Ga0068855_100006977 3300005563 Bacteria 13713
46 Ga0068855_100007326 3300005563 Bacteria 13369
47 Ga0068855_100017028 3300005563 Bacteria 8743
48 Ga0068855_100038607 3300005563 Bacteria 5673
49 Ga0068855_100160641 3300005563 Bacteria 2551
50 Ga0068857_100002783 3300005577 Bacteria 14382
51 Ga0068857_100006312 3300005577 Bacteria 10148
52 Ga0068857_100081371 3300005577 Bacteria 2892
53 Ga0068854_100000019 3300005578 Bacteria 134145
54 Ga0068854_100079099 3300005578 Bacteria 2424
55 Ga0068854_100134345 3300005578 Bacteria 1892
56 Ga0068856_100005068 3300005614 Bacteria 13039
57 Ga0068856_100125656 3300005614 Bacteria 2568
58 Ga0068852_100000041 3300005616 Bacteria 92967
59 Ga0068852_100000338 3300005616 Bacteria 31806
60 Ga0068852_100047619 3300005616 Bacteria 3658
61 Ga0068852_100122451 3300005616 Bacteria 2384
62 Ga0068852_100129548 3300005616 Bacteria 2321
63 Ga0068859_100007032 3300005617 Bacteria 11425
64 Ga0068859_100087006 3300005617 Bacteria 3172
65 Ga0068864_100004120 3300005618 Bacteria 11930
66 Ga0068864_100013848 3300005618 Bacteria 6683
67 Ga0068866_10032413 3300005718 Bacteria 2526
68 Ga0068861_100072563 3300005719 Bacteria 2671
69 Ga0068851_10002984 3300005834 Bacteria 7475
70 Ga0068863_100003622 3300005841 Bacteria 15251
71 Ga0068858_100014464 3300005842 Bacteria 7436
72 Ga0068858_100226340 3300005842 Bacteria 1772
73 Ga0068860_100006785 3300005843 Bacteria 11476
74 Ga0068860_100076201 3300005843 Bacteria 3190
75 Ga0081455_10010679 3300005937 Bacteria 9288
76 Ga0070717_10006261 3300006028 Bacteria 8740
77 Ga0070717_10073518 3300006028 Bacteria 2857
78 Ga0097621_100000431 3300006237 Bacteria 29219
79 Ga0097621_100003942 3300006237 Bacteria 10281
80 Ga0097621_100005247 3300006237 Bacteria 9116
81 Ga0068871_100007776 3300006358 Bacteria 7676
82 Ga0068871_100026598 3300006358 Bacteria 4517
83 Ga0075431_100020179 3300006847 Bacteria 6806
84 Ga0075433_10045883 3300006852 Bacteria 3799
85 Ga0075434_100009362 3300006871 Bacteria 9132
86 Ga0075434_100032972 3300006871 Bacteria 5109
87 Ga0075429_100037311 3300006880 Bacteria 4230
88 Ga0097620_100007033 3300006931 Bacteria 11425
89 Ga0097620_100087006 3300006931 Bacteria 3172
90 Ga0105240_10000001 3300009093 Bacteria 2887840
91 Ga0105240_10000251 3300009093 Bacteria 106709
92 Ga0105240_10002247 3300009093 Bacteria 31362
93 Ga0105240_10003247 3300009093 Bacteria 25446
94 Ga0105240_10004439 3300009093 Bacteria 21395
95 Ga0105240_10009662 3300009093 Bacteria 13635
96 Ga0105240_10012023 3300009093 Bacteria 12000
97 Ga0105240_10014820 3300009093 Bacteria 10625
98 Ga0105240_10028134 3300009093 Bacteria 7348
99 Ga0105240_10079375 3300009093 Bacteria 4038
100 Ga0105240_10094351 3300009093 Bacteria 3650
101 Ga0105240_10116044 3300009093 Bacteria 3231
102 Ga0105240_10319098 3300009093 Bacteria 1771
103 Ga0105245_10001223 3300009098 Bacteria 23189
104 Ga0105245_10022781 3300009098 Bacteria 5497
105 Ga0105243_10038287 3300009148 Bacteria 3734
106 Ga0105241_10000259 3300009174 Bacteria 39609
107 Ga0105241_10000458 3300009174 Bacteria 30746
108 Ga0105241_10002080 3300009174 Bacteria 15115
109 Ga0105241_10003509 3300009174 Bacteria 11668
110 Ga0105241_10026834 3300009174 Bacteria 4287
111 Ga0105241_10119799 3300009174 Bacteria 2118
112 Ga0105248_10000003 3300009177 Bacteria 1019601
113 Ga0105248_10000639 3300009177 Bacteria 39796
114 Ga0105248_10011582 3300009177 Bacteria 9713
115 Ga0105248_10013518 3300009177 Bacteria 8986
116 Ga0105248_10089222 3300009177 Bacteria 3470
117 Ga0105237_10012532 3300009545 Bacteria 8930
118 Ga0105237_10013833 3300009545 Bacteria 8448
119 Ga0105237_10076180 3300009545 Bacteria 3345
120 Ga0105238_10001587 3300009551 Bacteria 22750
121 Ga0105238_10003727 3300009551 Bacteria 15156
122 Ga0105238_10005042 3300009551 Bacteria 13057
123 Ga0105238_10011748 3300009551 Bacteria 8826
124 Ga0105238_10025365 3300009551 Bacteria 6043
125 Ga0105238_10027097 3300009551 Bacteria 5841
126 Ga0105238_10034266 3300009551 Bacteria 5166
127 Ga0105238_10046566 3300009551 Bacteria 4375
128 Ga0105249_10024390 3300009553 Bacteria 5435
129 Ga0105249_10154245 3300009553 Bacteria 2214
130 Ga0105239_10005701 3300010375 Bacteria 14541
131 Ga0105239_10019794 3300010375 Bacteria 7428
132 Ga0105239_10030708 3300010375 Bacteria 5910
133 Ga0105246_10011258 3300011119 Bacteria 5548
134 Ga0157370_10000003 3300013104 Bacteria 367417
135 Ga0157370_10008814 3300013104 Bacteria 10840
136 Ga0157370_10018054 3300013104 Bacteria 7100
137 Ga0157370_10019232 3300013104 Bacteria 6860
138 Ga0157370_10065273 3300013104 Bacteria 3444
139 Ga0157370_10117578 3300013104 Bacteria 2483
140 Ga0157370_10186695 3300013104 Bacteria 1925
141 Ga0157369_10000094 3300013105 Bacteria 122205
142 Ga0157369_10001914 3300013105 Bacteria 25108
143 Ga0157369_10004449 3300013105 Bacteria 16511
144 Ga0157369_10005464 3300013105 Bacteria 14768
145 Ga0157369_10006412 3300013105 Bacteria 13641
146 Ga0157369_10009603 3300013105 Bacteria 11064
147 Ga0157369_10013036 3300013105 Bacteria 9415
148 Ga0157369_10018945 3300013105 Bacteria 7710
149 Ga0157369_10020243 3300013105 Bacteria 7438
150 Ga0157369_10026019 3300013105 Bacteria 6493
151 Ga0157369_10076362 3300013105 Bacteria 3591
152 Ga0157369_10098336 3300013105 Bacteria 3121
153 Ga0157369_10111837 3300013105 Bacteria 2903
154 Ga0157374_10001112 3300013296 Bacteria 23158
155 Ga0157374_10001439 3300013296 Bacteria 20113
156 Ga0157374_10014101 3300013296 Bacteria 6987
157 Ga0157374_10021624 3300013296 Bacteria 5728
158 Ga0157374_10067036 3300013296 Bacteria 3373
159 Ga0157374_10128877 3300013296 Bacteria 2447
160 Ga0157378_10001618 3300013297 Bacteria 20368
161 Ga0157378_10037375 3300013297 Bacteria 4300
162 Ga0157378_10096447 3300013297 Bacteria 2695
163 Ga0163162_10003588 3300013306 Bacteria 14852
164 Ga0163162_10008603 3300013306 Bacteria 9948
165 Ga0163162_10026765 3300013306 Bacteria 5702
166 Ga0163162_10079070 3300013306 Bacteria 3355
167 Ga0157372_10000074 3300013307 Bacteria 106584
168 Ga0157372_10003222 3300013307 Bacteria 17619
169 Ga0157372_10009997 3300013307 Bacteria 10091
170 Ga0157372_10012297 3300013307 Bacteria 9120
171 Ga0157372_10016588 3300013307 Bacteria 7903
172 Ga0157372_10041524 3300013307 Bacteria 5087
173 Ga0157372_10064349 3300013307 Bacteria 4115
174 Ga0157372_10114110 3300013307 Bacteria 3097
175 Ga0157372_10117059 3300013307 Bacteria 3056
176 Ga0157372_10341229 3300013307 Bacteria 1745
177 Ga0157375_10007374 3300013308 Bacteria 9627
178 Ga0157375_10088503 3300013308 Bacteria 3151
179 Ga0157375_10203218 3300013308 Bacteria 2137
180 Ga0163163_10002120 3300014325 Bacteria 16743
181 Ga0163163_10006725 3300014325 Bacteria 10078
182 Ga0163163_10008582 3300014325 Bacteria 9083
183 Ga0163163_10121686 3300014325 Bacteria 2644
184 Ga0157380_10012980 3300014326 Bacteria 6056
185 Ga0157379_10003213 3300014968 Bacteria 13849
186 Ga0157379_10032341 3300014968 Bacteria 4664
187 Ga0157379_10140398 3300014968 Bacteria 2178
188 Ga0157379_10178022 3300014968 Bacteria 1921
189 Ga0157376_10107844 3300014969 Bacteria 2445
190 Ga0157376_10274379 3300014969 Bacteria 1585
191 Ga0213872_10000315 3300021361 Bacteria 41197
192 Ga0209233_1004548 3300025261 Bacteria 4701
193 Ga0207656_10027950 3300025321 Bacteria 2311
194 Ga0207710_10003278 3300025900 Bacteria 7233
195 Ga0207647_10000811 3300025904 Bacteria 24230
196 Ga0207647_10021282 3300025904 Bacteria 4332
197 Ga0207705_10000109 3300025909 Bacteria 93256
198 Ga0207705_10015262 3300025909 Bacteria 5516
199 Ga0207705_10018509 3300025909 Bacteria 4980
200 Ga0207705_10034797 3300025909 Bacteria 3602
201 Ga0207705_10043952 3300025909 Bacteria 3210
202 Ga0207684_10009632 3300025910 Bacteria 8522
203 Ga0207654_10000229 3300025911 Bacteria 34372
204 Ga0207654_10000490 3300025911 Bacteria 22658
205 Ga0207654_10015746 3300025911 Bacteria 3930
206 Ga0207695_10000001 3300025913 Bacteria 2888630
207 Ga0207695_10000129 3300025913 Bacteria 225939
208 Ga0207695_10000194 3300025913 Bacteria 171422
209 Ga0207695_10000263 3300025913 Bacteria 132894
210 Ga0207695_10000428 3300025913 Bacteria 93076
211 Ga0207695_10006198 3300025913 Bacteria 15587
212 Ga0207695_10026639 3300025913 Bacteria 6451
213 Ga0207695_10028193 3300025913 Bacteria 6234
214 Ga0207695_10037309 3300025913 Bacteria 5244
215 Ga0207695_10085814 3300025913 Bacteria 3176
216 Ga0207695_10188942 3300025913 Bacteria 1978
217 Ga0207671_10003735 3300025914 Bacteria 15004
218 Ga0207671_10008200 3300025914 Bacteria 8903
219 Ga0207657_10026422 3300025919 Bacteria 5337
220 Ga0207657_10036348 3300025919 Bacteria 4409
221 Ga0207657_10109308 3300025919 Bacteria 2285
222 Ga0207652_10001776 3300025921 Bacteria 18778
223 Ga0207652_10108643 3300025921 Bacteria 2458
224 Ga0207652_10133250 3300025921 Bacteria 2217
225 Ga0207694_10000036 3300025924 Bacteria 194034
226 Ga0207694_10000749 3300025924 Bacteria 29171
227 Ga0207694_10002282 3300025924 Bacteria 15696
228 Ga0207694_10035178 3300025924 Bacteria 3842
229 Ga0207694_10159084 3300025924 Bacteria 1824
230 Ga0207650_10025866 3300025925 Bacteria 4183
231 Ga0207650_10098537 3300025925 Bacteria 2246
232 Ga0207687_10016331 3300025927 Bacteria 4874
233 Ga0207644_10001784 3300025931 Bacteria 13929
234 Ga0207644_10003780 3300025931 Bacteria 9806
235 Ga0207644_10011501 3300025931 Bacteria 5857
236 Ga0207690_10016176 3300025932 Bacteria 4535
237 Ga0207690_10019293 3300025932 Bacteria 4196
238 Ga0207706_10001880 3300025933 Bacteria 20583
239 Ga0207691_10006364 3300025940 Bacteria 11408
240 Ga0207711_10000013 3300025941 Bacteria 514850
241 Ga0207711_10005835 3300025941 Bacteria 10401
242 Ga0207711_10090756 3300025941 Bacteria 2686
243 Ga0207711_10102105 3300025941 Bacteria 2538
244 Ga0207711_10267166 3300025941 Bacteria 1573
245 Ga0207689_10001455 3300025942 Bacteria 22661
246 Ga0207689_10038719 3300025942 Bacteria 3947
247 Ga0207661_10005737 3300025944 Bacteria 8759
248 Ga0207661_10030746 3300025944 Bacteria 4139
249 Ga0207661_10035604 3300025944 Bacteria 3881
250 Ga0207667_10001622 3300025949 Bacteria 28296
251 Ga0207667_10003825 3300025949 Bacteria 18507
252 Ga0207667_10003877 3300025949 Bacteria 18393
253 Ga0207667_10007018 3300025949 Bacteria 13604
254 Ga0207667_10009690 3300025949 Bacteria 11331
255 Ga0207667_10018384 3300025949 Bacteria 7840
256 Ga0207667_10065243 3300025949 Bacteria 3798
257 Ga0207667_10080176 3300025949 Bacteria 3382
258 Ga0207667_10174954 3300025949 Bacteria 2206
259 Ga0207667_10306263 3300025949 Bacteria 1623
260 Ga0207712_10012352 3300025961 Bacteria 5455
261 Ga0207640_10000028 3300025981 Bacteria 135727
262 Ga0207640_10188603 3300025981 Bacteria 1552
263 Ga0207677_10029239 3300026023 Bacteria 3498
264 Ga0207677_10039222 3300026023 Bacteria 3112
265 Ga0207639_10000049 3300026041 Bacteria 124603
266 Ga0207639_10000094 3300026041 Bacteria 74921
267 Ga0207639_10012641 3300026041 Bacteria 5885
268 Ga0207678_10001052 3300026067 Bacteria 25258
269 Ga0207678_10033926 3300026067 Bacteria 4446
270 Ga0207702_10005190 3300026078 Bacteria 11452
271 Ga0207702_10046406 3300026078 Bacteria 3657
272 Ga0207702_10088920 3300026078 Bacteria 2700
273 Ga0207641_10005842 3300026088 Bacteria 10443
274 Ga0207676_10006227 3300026095 Bacteria 8424
275 Ga0207676_10008548 3300026095 Bacteria 7277
276 Ga0207676_10124742 3300026095 Bacteria 2179
277 Ga0207674_10004432 3300026116 Bacteria 16877
278 Ga0207674_10009962 3300026116 Bacteria 10814
279 Ga0207674_10016370 3300026116 Bacteria 8120
280 Ga0207683_10001144 3300026121 Bacteria 24107
281 Ga0207698_10000017 3300026142 Bacteria 178846
282 Ga0207698_10000037 3300026142 Bacteria 103991
283 Ga0207698_10014760 3300026142 Bacteria 5206
284 Ga0207698_10029357 3300026142 Bacteria 3938
285 Ga0207698_10169939 3300026142 Bacteria 1918
286 Ga0268266_10001982 3300028379 Bacteria 22957
287 Ga0268266_10024843 3300028379 Bacteria 5098
288 Ga0268266_10043681 3300028379 Bacteria 3831
289 Ga0268266_10094940 3300028379 Bacteria 2619
290 Ga0268266_10122836 3300028379 Bacteria 2312
291 Ga0268264_10001478 3300028381 Bacteria 21925
292 Ga0265318_10042503 3300028577 Bacteria 1724
293 Ga0265338_10001002 3300028800 Bacteria 47431
294 Ga0265338_10008925 3300028800 Bacteria 12066
295 Ga0265338_10033116 3300028800 Bacteria 5023
296 Ga0265338_10044107 3300028800 Bacteria 4123
297 Ga0265338_10094883 3300028800 Bacteria 2453
298 Ga0265330_10004955 3300031235 Bacteria 6704
299 Ga0265330_10005509 3300031235 Bacteria 6310
300 Ga0265330_10007824 3300031235 Bacteria 5185
301 Ga0265332_10014466 3300031238 Bacteria 3491
302 Ga0265328_10017154 3300031239 Bacteria 2808
303 Ga0265325_10001870 3300031241 Bacteria 14530
304 Ga0265325_10008972 3300031241 Bacteria 5872
305 Ga0265325_10015752 3300031241 Bacteria 4242
306 Ga0265325_10038597 3300031241 Bacteria 2520
307 Ga0265329_10021878 3300031242 Bacteria 2143
308 Ga0265340_10008321 3300031247 Bacteria 5604
309 Ga0265340_10017409 3300031247 Bacteria 3718
310 Ga0265340_10021649 3300031247 Bacteria 3296
311 Ga0265339_10000031 3300031249 Bacteria 133838
312 Ga0265339_10003764 3300031249 Bacteria 10576
313 Ga0265339_10017271 3300031249 Bacteria 4277
314 Ga0265339_10023013 3300031249 Bacteria 3604
315 Ga0265339_10045400 3300031249 Bacteria 2418
316 Ga0265331_10039611 3300031250 Bacteria 2297
317 Ga0265316_10001845 3300031344 Bacteria 22273
318 Ga0265316_10004137 3300031344 Bacteria 14519
319 Ga0265316_10015742 3300031344 Bacteria 6599
320 Ga0265316_10016178 3300031344 Bacteria 6483
321 Ga0265316_10017868 3300031344 Bacteria 6113
322 Ga0265316_10051787 3300031344 Bacteria 3223
323 Ga0265316_10052720 3300031344 Bacteria 3190
324 Ga0265316_10060927 3300031344 Bacteria 2932
325 Ga0307513_10003296 3300031456 Bacteria 21988
326 Ga0265313_10003041 3300031595 Bacteria 13938
327 Ga0265313_10003980 3300031595 Bacteria 11605
328 Ga0265313_10035957 3300031595 Bacteria 2489
329 Ga0265313_10068721 3300031595 Bacteria 1636
330 Ga0265314_10000025 3300031711 Bacteria 292548
331 Ga0265314_10014587 3300031711 Bacteria 6273
332 Ga0265342_10003478 3300031712 Bacteria 12900
333 Ga0265342_10005807 3300031712 Bacteria 9321
334 Ga0265342_10020339 3300031712 Bacteria 4261
335 Ga0265342_10033832 3300031712 Bacteria 3139
336 Ga0307410_10090497 3300031852 Bacteria 2170
337 Ga0307412_10072168 3300031911 Bacteria 2359
338 Ga0307510_10093615 3300033180 Bacteria 2835
339 Ga0373954_0011045 3300035118 Bacteria 3997
340 Ga0373931_0104973 3300035691 Bacteria 1595
341 Ga0373935_0047675 3300035692 Bacteria 2710
342 Ga0373937_0001874 3300036401 Bacteria 17662
343 Ga0373937_0072343 3300036401 Bacteria 3180
344 Ga0395900_0021561 3300037418 Bacteria 6587
345 Ga0395905_0027474 3300037471 Bacteria 5367
346 Ga0436360_1213990 3300039438 Bacteria 7244
347 Ga0436361_1020706 3300039447 Bacteria 66534
348 Ga0436363_0909993 3300039450 Bacteria 1712
349 Ga0436363_1143306 3300039450 Bacteria 3067
350 Ga0436362_0246260 3300039453 Bacteria 1838
351 Ga0451576_0167553 3300045051 Bacteria 2292
352 Ga0466967_0001557 3300045976 Bacteria 13448
353 Ga0466967_0060362 3300045976 Bacteria 3360
354 Ga0495603_0001318 3300046455 Bacteria 14383
355 Ga0495603_0129970 3300046455 Bacteria 1467
356 Ga0495629_0013741 3300046459 Bacteria 5841
357 Ga0495629_0063086 3300046459 Bacteria 2587
358 Ga0495653_0071108 3300046463 Bacteria 2602
359 Ga0495650_0000006 3300046471 Bacteria 721347
360 Ga0495580_0000247 3300046472 Bacteria 42646
361 Ga0495580_0004423 3300046472 Bacteria 11809
362 Ga0495582_0001535 3300046473 Bacteria 13032
363 Ga0495582_0021797 3300046473 Bacteria 3505
364 Ga0495639_0046569 3300046475 Bacteria 1963
365 Ga0495662_0000149 3300046476 Bacteria 27408
366 Ga0495585_0015790 3300046492 Bacteria 4385
367 Ga0495594_0000056 3300046499 Bacteria 49399
368 Ga0495594_0027531 3300046499 Bacteria 3063
369 Ga0495628_0021032 3300046516 Bacteria 5375
370 Ga0495631_0013524 3300046518 Bacteria 3960
371 Ga0495643_0001548 3300046522 Bacteria 20538
372 Ga0495644_0000013 3300046523 Bacteria 94729
373 Ga0495642_0042524 3300046528 Bacteria 1851
374 Ga0495642_0054162 3300046528 Bacteria 1654
375 Ga0495652_0065024 3300046529 Bacteria 3066
376 Ga0495665_0000998 3300046531 Bacteria 15022
377 Ga0495665_0010652 3300046531 Bacteria 4980
378 Ga0495665_0025258 3300046531 Bacteria 3192
379 Ga0495640_0056871 3300046533 Bacteria 2671
380 Ga0495645_0011643 3300046543 Bacteria 6195
381 Ga0495645_0012438 3300046543 Bacteria 5997
382 Ga0495645_0019106 3300046543 Bacteria 4932
383 Ga0495645_0088775 3300046543 Bacteria 2211
384 Ga0495622_0078398 3300046557 Bacteria 1521
385 Ga0495633_0007514 3300046558 Bacteria 6262
386 Ga0495667_0003258 3300046559 Bacteria 10879
387 Ga0495668_0012411 3300046616 Bacteria 5051
388 Ga0495634_0009865 3300046642 Bacteria 7025
389 Ga0495625_0000074 3300046660 Bacteria 164813
390 Ga0495625_0008798 3300046660 Bacteria 8548
391 Ga0495625_0012187 3300046660 Bacteria 6975
392 Ga0495625_0019939 3300046660 Bacteria 5187
393 Ga0495625_0056248 3300046660 Bacteria 2801
394 Ga0495635_0011174 3300046663 Bacteria 6294
395 Ga0495661_0004061 3300046665 Bacteria 10663
396 Ga0495599_0042764 3300046678 Bacteria 2843
397 Ga0495623_0022148 3300046679 Bacteria 4104
398 Ga0495623_0117006 3300046679 Bacteria 1610
399 Ga0495669_0040171 3300046684 Bacteria 2074
400 Ga0495613_0004679 3300046689 Bacteria 10269
401 Ga0495613_0044385 3300046689 Bacteria 3289
402 Ga0495613_0060607 3300046689 Bacteria 2771
403 Ga0495649_0009078 3300046694 Bacteria 5934
404 Ga0495600_0037248 3300046809 Bacteria 3161
405 Ga0495600_0045762 3300046809 Bacteria 2856
406 Ga0495581_0004161 3300047315 Bacteria 8341
407 Ga0495581_0017772 3300047315 Bacteria 4132
408 Ga0495604_0017504 3300047317 Bacteria 5738
409 Ga0495674_0169646 3300047319 Bacteria 1822
410 Ga0495672_0005044 3300047320 Bacteria 10557
411 Ga0495675_0033791 3300047444 Bacteria 3264
412 Ga0495686_0000009 3300047472 Bacteria 661643
413 Ga0495686_0000427 3300047472 Bacteria 66176
414 Ga0495686_0004566 3300047472 Bacteria 11335
415 Ga0495686_0013911 3300047472 Bacteria 5567
416 Ga0495593_0054699 3300047673 Bacteria 2103
417 Ga0495602_0075191 3300048088 Bacteria 2868
418 Ga0495614_0008850 3300048089 Bacteria 4468
419 Ga0495614_0013382 3300048089 Bacteria 3598
420 Ga0496100_0013016 3300048903 Bacteria 4787
421 Ga0496101_0095182 3300048904 Bacteria 2221
422 Ga0496101_0138983 3300048904 Bacteria 1850
423 Ga0496102_0055044 3300048905 Bacteria 3628
424 Ga0496104_0000626 3300048907 Bacteria 30277
425 Ga0496104_0010846 3300048907 Bacteria 8150
426 Ga0496104_0020078 3300048907 Bacteria 6120
427 Ga0496104_0081608 3300048907 Bacteria 3084
428 Ga0496104_0111911 3300048907 Bacteria 2618
429 Ga0496105_0005270 3300048908 Bacteria 9800
430 Ga0496106_0113356 3300048909 Bacteria 2113
431 Ga0496107_0094960 3300048910 Bacteria 2181
432 Ga0496108_0042848 3300048911 Bacteria 3779
433 Ga0496110_0059899 3300048913 Bacteria 3357
434 Ga0496112_0002331 3300048915 Bacteria 15237
435 Ga0496112_0176552 3300048915 Bacteria 2101
436 Ga0496113_0032103 3300048916 Bacteria 3814
437 Ga0496114_0062187 3300048917 Bacteria 3124
438 Ga0496115_0004604 3300048918 Bacteria 9987
439 Ga0496126_0000014 3300048929 Bacteria 686881
440 Ga0496126_0001162 3300048929 Bacteria 43477
441 Ga0496126_0009360 3300048929 Bacteria 10414
442 Ga0496126_0011405 3300048929 Bacteria 9205
443 Ga0495682_0056588 3300049460 Bacteria 1421
444 Ga0501031_0019770 3300049568 Bacteria 4388
445 Ga0501032_0004740 3300049569 Bacteria 10209
446 Ga0501034_0003911 3300049571 Bacteria 16735
447 Ga0501036_0001520 3300049572 Bacteria 17900
448 Ga0501037_0012395 3300049573 Bacteria 6277
449 Ga0501038_0002388 3300049574 Bacteria 17496
450 Ga0501038_0075578 3300049574 Bacteria 2847
451 Ga0501039_0093310 3300049575 Bacteria 2346
452 Ga0501042_0007140 3300049578 Bacteria 7307
453 Ga0501043_0057255 3300049579 Bacteria 3061
454 Ga0501043_0069963 3300049579 Bacteria 2756
455 Ga0501046_0000312 3300049580 Bacteria 48878
456 Ga0501047_0010439 3300049581 Bacteria 8789
457 Ga0501047_0156109 3300049581 Bacteria 2155
458 Ga0501048_0013788 3300049582 Bacteria 5996
459 Ga0501070_0156227 3300049586 Bacteria 1881
460 Ga0501071_0003412 3300049587 Bacteria 9928
461 Ga0501072_0005141 3300049588 Bacteria 9950
462 Ga0501073_0029827 3300049589 Bacteria 3897
463 Ga0501073_0097682 3300049589 Bacteria 2040
464 Ga0501074_0037309 3300049590 Bacteria 3523
465 Ga0501075_0000584 3300049591 Bacteria 22235
466 Ga0501080_0023595 3300049742 Bacteria 5699
467 Ga0501081_0001296 3300049743 Bacteria 15232
468 Ga0501035_0000664 3300049822 Bacteria 37957
469 Ga0501035_0040732 3300049822 Bacteria 4196
470 Ga0501044_0016063 3300049823 Bacteria 8050
471 Ga0501044_0197330 3300049823 Bacteria 1972
472 Ga0501045_0000331 3300049824 Bacteria 27828
473 nmdc:mga09592_6235_c1 3300050508 Bacteria 9708
474 nmdc:mga0n895_31830_c1 3300050512 Bacteria 5055
475 nmdc:mga0a205_28319_c1 3300050515 Bacteria 5356
476 Ga0495601_0111685 3300053077 Bacteria 1770
477 Ga0495619_0038992 3300053085 Bacteria 3101
478 Ga0500651_0000009 3300053093 Bacteria 270362
479 Ga0500595_000072 3300053119 Bacteria 71795
480 Ga0500595_026538 3300053119 Bacteria 1995
481 Ga0501084_0003678 3300054114 Bacteria 12445
482 Ga0501082_0000595 3300060353 Bacteria 31876
483 Ga0530510_0007175 3300061734 Bacteria 7755

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009174 Ga0105241_10003509 Ga0105241_1000350914 379
2 3300049460 Ga0495682_0056588 Ga0495682_0056588_23_1288 408
3 3300031456 Ga0307513_10003296 Ga0307513_1000329613 410
4 3300049823 Ga0501044_0016063 Ga0501044_0016063_12_1319 423
5 3300028800 Ga0265338_10094883 Ga0265338_100948833 433
6 3300021361 Ga0213872_10000315 Ga0213872_100003158 434
7 3300039447 Ga0436361_1020706 Ga0436361_1020706_6121_7476 434
8 3300005937 Ga0081455_10010679 Ga0081455_100106793 437
9 3300006847 Ga0075431_100020179 Ga0075431_1000201792 438
10 3300006880 Ga0075429_100037311 Ga0075429_1000373112 438
11 3300050508 nmdc:mga09592_6235_c1 nmdc:mga09592_6235_c1_4508_5872 438
12 3300006852 Ga0075433_10045883 Ga0075433_100458833 439
13 3300006871 Ga0075434_100009362 Ga0075434_1000093622 439
14 3300045051 Ga0451576_0167553 Ga0451576_0167553_468_1832 439
15 3300050515 nmdc:mga0a205_28319_c1 nmdc:mga0a205_28319_c1_175_1539 439
16 3300039453 Ga0436362_0246260 Ga0436362_0246260_183_1550 440
17 3300005843 Ga0068860_100076201 Ga0068860_1000762013 441
18 3300013306 Ga0163162_10026765 Ga0163162_100267654 441
19 3300046528 Ga0495642_0042524 Ga0495642_0042524_23_1390 444
20 3300025933 Ga0207706_10001880 Ga0207706_1000188018 446
21 3300049574 Ga0501038_0075578 Ga0501038_0075578_524_1924 446
22 3300049579 Ga0501043_0057255 Ga0501043_0057255_1589_2989 446
23 3300049587 Ga0501071_0003412 Ga0501071_0003412_1187_2587 446
24 3300049591 Ga0501075_0000584 Ga0501075_0000584_3065_4465 446
25 3300049824 Ga0501045_0000331 Ga0501045_0000331_8632_10032 446
26 3300054114 Ga0501084_0003678 Ga0501084_0003678_6996_8396 446
27 3300060353 Ga0501082_0000595 Ga0501082_0000595_29776_31176 446
28 3300061734 Ga0530510_0007175 Ga0530510_0007175_3695_5095 446
29 3300031852 Ga0307410_10090497 Ga0307410_100904972 449
30 3300031911 Ga0307412_10072168 Ga0307412_100721682 449
31 3300014326 Ga0157380_10012980 Ga0157380_100129803 454
32 3300031238 Ga0265332_10014466 Ga0265332_100144664 454
33 3300031247 Ga0265340_10008321 Ga0265340_100083214 454
34 3300031344 Ga0265316_10004137 Ga0265316_100041379 454
35 3300031595 Ga0265313_10003041 Ga0265313_100030414 454
36 3300046455 Ga0495603_0129970 Ga0495603_0129970_14_1414 454
37 3300048929 Ga0496126_0011405 Ga0496126_0011405_174_1595 455
38 3300005563 Ga0068855_100038607 Ga0068855_1000386075 456
39 3300025909 Ga0207705_10015262 Ga0207705_100152621 456
40 3300025949 Ga0207667_10018384 Ga0207667_1001838410 456
41 3300048903 Ga0496100_0013016 Ga0496100_0013016_2401_3825 457
42 3300048904 Ga0496101_0095182 Ga0496101_0095182_12_1436 457
43 3300048905 Ga0496102_0055044 Ga0496102_0055044_837_2261 457
44 3300048911 Ga0496108_0042848 Ga0496108_0042848_1780_3204 457
45 3300048913 Ga0496110_0059899 Ga0496110_0059899_1863_3287 457
46 3300048916 Ga0496113_0032103 Ga0496113_0032103_2197_3621 457
47 3300005327 Ga0070658_10000101 Ga0070658_1000010137 458
48 3300005563 Ga0068855_100001117 Ga0068855_10000111722 458
49 3300013104 Ga0157370_10019232 Ga0157370_100192324 458
50 3300025909 Ga0207705_10000109 Ga0207705_1000010956 458
51 3300025949 Ga0207667_10001622 Ga0207667_1000162212 458
52 3300005339 Ga0070660_100105792 Ga0070660_1001057921 460
53 3300005344 Ga0070661_100008544 Ga0070661_1000085444 460
54 3300005563 Ga0068855_100002330 Ga0068855_1000023303 460
55 3300005563 Ga0068855_100160641 Ga0068855_1001606413 460
56 3300006871 Ga0075434_100032972 Ga0075434_1000329724 460
57 3300009093 Ga0105240_10014820 Ga0105240_1001482010 460
58 3300009551 Ga0105238_10025365 Ga0105238_100253651 460
59 3300009551 Ga0105238_10027097 Ga0105238_100270978 460
60 3300013307 Ga0157372_10041524 Ga0157372_100415245 460
61 3300025909 Ga0207705_10018509 Ga0207705_100185091 460
62 3300025913 Ga0207695_10000263 Ga0207695_100002639 460
63 3300025919 Ga0207657_10109308 Ga0207657_101093083 460
64 3300025924 Ga0207694_10159084 Ga0207694_101590842 460
65 3300025949 Ga0207667_10007018 Ga0207667_100070187 460
66 3300025949 Ga0207667_10174954 Ga0207667_101749543 460
67 3300026142 Ga0207698_10029357 Ga0207698_100293574 460
68 3300046528 Ga0495642_0054162 Ga0495642_0054162_55_1506 460
69 3300050512 nmdc:mga0n895_31830_c1 nmdc:mga0n895_31830_c1_2364_3797 460
70 3300045976 Ga0466967_0060362 Ga0466967_0060362_868_2307 461
71 3300046557 Ga0495622_0078398 Ga0495622_0078398_31_1461 461
72 3300047320 Ga0495672_0005044 Ga0495672_0005044_5656_7074 461
73 3300037471 Ga0395905_0027474 Ga0395905_0027474_1620_3077 462
74 3300047472 Ga0495686_0013911 Ga0495686_0013911_2106_3569 462
75 3300013296 Ga0157374_10128877 Ga0157374_101288772 463
76 3300013307 Ga0157372_10012297 Ga0157372_100122978 463
77 3300025913 Ga0207695_10026639 Ga0207695_100266394 463
78 3300046455 Ga0495603_0001318 Ga0495603_0001318_11881_13305 463
79 3300046492 Ga0495585_0015790 Ga0495585_0015790_365_1789 463
80 3300046499 Ga0495594_0000056 Ga0495594_0000056_25691_27115 463
81 3300046499 Ga0495594_0027531 Ga0495594_0027531_1617_3044 463
82 3300046518 Ga0495631_0013524 Ga0495631_0013524_937_2361 463
83 3300046523 Ga0495644_0000013 Ga0495644_0000013_28667_30091 463
84 3300046558 Ga0495633_0007514 Ga0495633_0007514_3561_4985 463
85 3300046616 Ga0495668_0012411 Ga0495668_0012411_2636_4060 463
86 3300046660 Ga0495625_0012187 Ga0495625_0012187_4203_5627 463
87 3300047472 Ga0495686_0004566 Ga0495686_0004566_1785_3266 463
88 3300053077 Ga0495601_0111685 Ga0495601_0111685_56_1489 463
89 3300005455 Ga0070663_100006615 Ga0070663_1000066154 464
90 3300009093 Ga0105240_10028134 Ga0105240_1002813410 464
91 3300009174 Ga0105241_10119799 Ga0105241_101197991 464
92 3300009553 Ga0105249_10024390 Ga0105249_100243902 464
93 3300010375 Ga0105239_10030708 Ga0105239_100307082 464
94 3300013104 Ga0157370_10018054 Ga0157370_100180549 464
95 3300013105 Ga0157369_10098336 Ga0157369_100983364 464
96 3300013307 Ga0157372_10114110 Ga0157372_101141103 464
97 3300014968 Ga0157379_10032341 Ga0157379_100323414 464
98 3300025261 Ga0209233_1004548 Ga0209233_10045483 464
99 3300025909 Ga0207705_10043952 Ga0207705_100439523 464
100 3300025961 Ga0207712_10012352 Ga0207712_100123522 464
101 3300026067 Ga0207678_10001052 Ga0207678_1000105218 464
102 3300046522 Ga0495643_0001548 Ga0495643_0001548_13018_14469 464
103 3300005336 Ga0070680_100096035 Ga0070680_1000960351 465
104 3300005366 Ga0070659_100024272 Ga0070659_1000242722 465
105 3300005458 Ga0070681_10065990 Ga0070681_100659903 465
106 3300005578 Ga0068854_100134345 Ga0068854_1001343451 465
107 3300009148 Ga0105243_10038287 Ga0105243_100382872 465
108 3300009545 Ga0105237_10076180 Ga0105237_100761802 465
109 3300013104 Ga0157370_10186695 Ga0157370_101866951 465
110 3300025919 Ga0207657_10026422 Ga0207657_100264222 465
111 3300025921 Ga0207652_10133250 Ga0207652_101332501 465
112 3300025932 Ga0207690_10019293 Ga0207690_100192933 465
113 3300026067 Ga0207678_10033926 Ga0207678_100339263 465
114 3300046665 Ga0495661_0004061 Ga0495661_0004061_4376_5848 465
115 3300048907 Ga0496104_0020078 Ga0496104_0020078_2441_3886 465
116 3300048915 Ga0496112_0002331 Ga0496112_0002331_4512_5957 465
117 3300049578 Ga0501042_0007140 Ga0501042_0007140_3146_4606 465
118 3300049581 Ga0501047_0156109 Ga0501047_0156109_534_1979 465
119 3300049582 Ga0501048_0013788 Ga0501048_0013788_2809_4269 465
120 3300049586 Ga0501070_0156227 Ga0501070_0156227_202_1647 465
121 3300049588 Ga0501072_0005141 Ga0501072_0005141_31_1491 465
122 3300049589 Ga0501073_0097682 Ga0501073_0097682_408_1853 465
123 3300049743 Ga0501081_0001296 Ga0501081_0001296_1196_2656 465
124 3300049822 Ga0501035_0040732 Ga0501035_0040732_2197_3672 465
125 3300049823 Ga0501044_0197330 Ga0501044_0197330_57_1502 465
126 3300053093 Ga0500651_0000009 Ga0500651_0000009_12013_13485 465
127 3300005338 Ga0068868_100029154 Ga0068868_1000291544 466
128 3300005445 Ga0070708_100008934 Ga0070708_1000089346 466
129 3300005459 Ga0068867_100097470 Ga0068867_1000974702 466
130 3300005467 Ga0070706_100001749 Ga0070706_1000017492 466
131 3300005468 Ga0070707_100153770 Ga0070707_1001537703 466
132 3300005536 Ga0070697_100001488 Ga0070697_1000014889 466
133 3300005548 Ga0070665_100022144 Ga0070665_1000221443 466
134 3300005548 Ga0070665_100118489 Ga0070665_1001184892 466
135 3300005718 Ga0068866_10032413 Ga0068866_100324133 466
136 3300005719 Ga0068861_100072563 Ga0068861_1000725632 466
137 3300005842 Ga0068858_100226340 Ga0068858_1002263402 466
138 3300006028 Ga0070717_10073518 Ga0070717_100735183 466
139 3300006237 Ga0097621_100000431 Ga0097621_10000043121 466
140 3300006358 Ga0068871_100026598 Ga0068871_1000265982 466
141 3300009093 Ga0105240_10000001 Ga0105240_100000012427 466
142 3300009098 Ga0105245_10001223 Ga0105245_1000122314 466
143 3300009177 Ga0105248_10089222 Ga0105248_100892224 466
144 3300013105 Ga0157369_10026019 Ga0157369_100260192 466
145 3300013296 Ga0157374_10021624 Ga0157374_100216243 466
146 3300013297 Ga0157378_10001618 Ga0157378_1000161815 466
147 3300013306 Ga0163162_10079070 Ga0163162_100790702 466
148 3300014325 Ga0163163_10008582 Ga0163163_100085828 466
149 3300014325 Ga0163163_10121686 Ga0163163_101216863 466
150 3300025904 Ga0207647_10000811 Ga0207647_100008118 466
151 3300025904 Ga0207647_10021282 Ga0207647_100212822 466
152 3300025910 Ga0207684_10009632 Ga0207684_100096323 466
153 3300025911 Ga0207654_10015746 Ga0207654_100157464 466
154 3300025913 Ga0207695_10000001 Ga0207695_100000012430 466
155 3300025913 Ga0207695_10028193 Ga0207695_100281935 466
156 3300025927 Ga0207687_10016331 Ga0207687_100163311 466
157 3300025981 Ga0207640_10188603 Ga0207640_101886031 466
158 3300026023 Ga0207677_10039222 Ga0207677_100392221 466
159 3300028379 Ga0268266_10043681 Ga0268266_100436813 466
160 3300028379 Ga0268266_10094940 Ga0268266_100949401 466
161 3300033180 Ga0307510_10093615 Ga0307510_100936152 466
162 3300035118 Ga0373954_0011045 Ga0373954_0011045_1071_2504 466
163 3300035692 Ga0373935_0047675 Ga0373935_0047675_205_1638 466
164 3300036401 Ga0373937_0072343 Ga0373937_0072343_601_2034 466
165 3300039450 Ga0436363_1143306 Ga0436363_1143306_1163_2620 466
166 3300046471 Ga0495650_0000006 Ga0495650_0000006_99723_101162 466
167 3300046472 Ga0495580_0000247 Ga0495580_0000247_981_2414 466
168 3300046472 Ga0495580_0004423 Ga0495580_0004423_4941_6374 466
169 3300046531 Ga0495665_0025258 Ga0495665_0025258_1560_2993 466
170 3300046660 Ga0495625_0019939 Ga0495625_0019939_273_1712 466
171 3300046694 Ga0495649_0009078 Ga0495649_0009078_854_2290 466
172 3300047319 Ga0495674_0169646 Ga0495674_0169646_207_1640 466
173 3300047444 Ga0495675_0033791 Ga0495675_0033791_1725_3158 466
174 3300048907 Ga0496104_0111911 Ga0496104_0111911_95_1528 466
175 3300048918 Ga0496115_0004604 Ga0496115_0004604_3962_5395 466
176 3300048929 Ga0496126_0000014 Ga0496126_0000014_457611_459047 466
177 3300005327 Ga0070658_10016181 Ga0070658_100161814 467
178 3300005335 Ga0070666_10015665 Ga0070666_100156652 467
179 3300005339 Ga0070660_100004584 Ga0070660_1000045849 467
180 3300005355 Ga0070671_100000235 Ga0070671_1000002357 467
181 3300005366 Ga0070659_100001286 Ga0070659_1000012864 467
182 3300005367 Ga0070667_100095609 Ga0070667_1000956093 467
183 3300005539 Ga0068853_100000176 Ga0068853_10000017621 467
184 3300005563 Ga0068855_100017028 Ga0068855_1000170288 467
185 3300005578 Ga0068854_100000019 Ga0068854_10000001931 467
186 3300005618 Ga0068864_100013848 Ga0068864_1000138483 467
187 3300009093 Ga0105240_10003247 Ga0105240_1000324720 467
188 3300009093 Ga0105240_10079375 Ga0105240_100793752 467
189 3300009177 Ga0105248_10000639 Ga0105248_1000063921 467
190 3300009545 Ga0105237_10013833 Ga0105237_100138333 467
191 3300009551 Ga0105238_10011748 Ga0105238_100117488 467
192 3300013104 Ga0157370_10008814 Ga0157370_100088143 467
193 3300013105 Ga0157369_10001914 Ga0157369_100019147 467
194 3300013105 Ga0157369_10013036 Ga0157369_100130367 467
195 3300013105 Ga0157369_10076362 Ga0157369_100763624 467
196 3300013296 Ga0157374_10001439 Ga0157374_100014392 467
197 3300013306 Ga0163162_10008603 Ga0163162_100086033 467
198 3300013307 Ga0157372_10016588 Ga0157372_100165888 467
199 3300014325 Ga0163163_10002120 Ga0163163_100021204 467
200 3300025909 Ga0207705_10034797 Ga0207705_100347973 467
201 3300025919 Ga0207657_10036348 Ga0207657_100363482 467
202 3300025921 Ga0207652_10001776 Ga0207652_1000177614 467
203 3300025924 Ga0207694_10035178 Ga0207694_100351784 467
204 3300025931 Ga0207644_10003780 Ga0207644_100037802 467
205 3300025932 Ga0207690_10016176 Ga0207690_100161764 467
206 3300025941 Ga0207711_10267166 Ga0207711_102671661 467
207 3300025949 Ga0207667_10080176 Ga0207667_100801761 467
208 3300025981 Ga0207640_10000028 Ga0207640_1000002885 467
209 3300026041 Ga0207639_10000094 Ga0207639_1000009417 467
210 3300026095 Ga0207676_10006227 Ga0207676_100062274 467
211 3300028379 Ga0268266_10001982 Ga0268266_1000198214 467
212 3300028379 Ga0268266_10024843 Ga0268266_100248434 467
213 3300046459 Ga0495629_0063086 Ga0495629_0063086_312_1763 467
214 3300046463 Ga0495653_0071108 Ga0495653_0071108_27_1478 467
215 3300046473 Ga0495582_0001535 Ga0495582_0001535_10440_11891 467
216 3300046473 Ga0495582_0021797 Ga0495582_0021797_962_2413 467
217 3300046476 Ga0495662_0000149 Ga0495662_0000149_16861_18312 467
218 3300046531 Ga0495665_0000998 Ga0495665_0000998_4646_6097 467
219 3300046543 Ga0495645_0019106 Ga0495645_0019106_1396_2847 467
220 3300046543 Ga0495645_0088775 Ga0495645_0088775_745_2184 467
221 3300046559 Ga0495667_0003258 Ga0495667_0003258_8988_10439 467
222 3300046642 Ga0495634_0009865 Ga0495634_0009865_4099_5550 467
223 3300046660 Ga0495625_0000074 Ga0495625_0000074_53269_54735 467
224 3300046660 Ga0495625_0008798 Ga0495625_0008798_2300_3751 467
225 3300046660 Ga0495625_0056248 Ga0495625_0056248_996_2441 467
226 3300046663 Ga0495635_0011174 Ga0495635_0011174_2780_4231 467
227 3300046678 Ga0495599_0042764 Ga0495599_0042764_973_2424 467
228 3300046689 Ga0495613_0004679 Ga0495613_0004679_730_2181 467
229 3300046809 Ga0495600_0037248 Ga0495600_0037248_225_1676 467
230 3300047315 Ga0495581_0004161 Ga0495581_0004161_6666_8117 467
231 3300047472 Ga0495686_0000009 Ga0495686_0000009_503070_504524 467
232 3300047472 Ga0495686_0000427 Ga0495686_0000427_56964_58415 467
233 3300047673 Ga0495593_0054699 Ga0495593_0054699_31_1482 467
234 3300048089 Ga0495614_0008850 Ga0495614_0008850_185_1636 467
235 3300048089 Ga0495614_0013382 Ga0495614_0013382_1486_2937 467
236 3300048907 Ga0496104_0000626 Ga0496104_0000626_6325_7779 467
237 3300048915 Ga0496112_0176552 Ga0496112_0176552_417_1859 467
238 3300048929 Ga0496126_0001162 Ga0496126_0001162_31179_32624 467
239 3300048929 Ga0496126_0009360 Ga0496126_0009360_4039_5487 467
240 3300049568 Ga0501031_0019770 Ga0501031_0019770_1125_2576 467
241 3300049569 Ga0501032_0004740 Ga0501032_0004740_8646_10097 467
242 3300049571 Ga0501034_0003911 Ga0501034_0003911_13001_14452 467
243 3300049572 Ga0501036_0001520 Ga0501036_0001520_8294_9745 467
244 3300049573 Ga0501037_0012395 Ga0501037_0012395_3923_5374 467
245 3300049574 Ga0501038_0002388 Ga0501038_0002388_1798_3249 467
246 3300049575 Ga0501039_0093310 Ga0501039_0093310_237_1688 467
247 3300049579 Ga0501043_0069963 Ga0501043_0069963_487_1938 467
248 3300049580 Ga0501046_0000312 Ga0501046_0000312_8373_9824 467
249 3300049581 Ga0501047_0010439 Ga0501047_0010439_3259_4710 467
250 3300049589 Ga0501073_0029827 Ga0501073_0029827_536_1987 467
251 3300049590 Ga0501074_0037309 Ga0501074_0037309_1735_3186 467
252 3300049742 Ga0501080_0023595 Ga0501080_0023595_3597_5048 467
253 3300049822 Ga0501035_0000664 Ga0501035_0000664_24158_25609 467
254 3300053119 Ga0500595_000072 Ga0500595_000072_67015_68454 467
255 3300053119 Ga0500595_026538 Ga0500595_026538_243_1688 467
256 3300005355 Ga0070671_100001212 Ga0070671_10000121211 468
257 3300005616 Ga0068852_100122451 Ga0068852_1001224512 468
258 3300009174 Ga0105241_10000458 Ga0105241_1000045812 468
259 3300013104 Ga0157370_10065273 Ga0157370_100652732 468
260 3300013104 Ga0157370_10117578 Ga0157370_101175783 468
261 3300013105 Ga0157369_10009603 Ga0157369_100096038 468
262 3300013105 Ga0157369_10020243 Ga0157369_100202432 468
263 3300013307 Ga0157372_10009997 Ga0157372_100099977 468
264 3300025911 Ga0207654_10000229 Ga0207654_1000022922 468
265 3300025931 Ga0207644_10001784 Ga0207644_100017847 468
266 3300031595 Ga0265313_10035957 Ga0265313_100359572 468
267 3300039450 Ga0436363_0909993 Ga0436363_0909993_189_1628 468
268 3300046475 Ga0495639_0046569 Ga0495639_0046569_193_1638 468
269 3300046516 Ga0495628_0021032 Ga0495628_0021032_1141_2601 468
270 3300046529 Ga0495652_0065024 Ga0495652_0065024_596_2056 468
271 3300046531 Ga0495665_0010652 Ga0495665_0010652_1736_3241 468
272 3300046543 Ga0495645_0012438 Ga0495645_0012438_2067_3527 468
273 3300046679 Ga0495623_0022148 Ga0495623_0022148_1997_3457 468
274 3300046684 Ga0495669_0040171 Ga0495669_0040171_549_1994 468
275 3300047315 Ga0495581_0017772 Ga0495581_0017772_1887_3392 468
276 3300047317 Ga0495604_0017504 Ga0495604_0017504_2216_3676 468
277 3300053085 Ga0495619_0038992 Ga0495619_0038992_1321_2766 468
278 iso_pu_bacteria 2884215851 2884219018 468
279 3300013307 Ga0157372_10117059 Ga0157372_101170592 469
280 3300028379 Ga0268266_10122836 Ga0268266_101228362 469
281 3300037418 Ga0395900_0021561 Ga0395900_0021561_3224_4681 469
282 3300039438 Ga0436360_1213990 Ga0436360_1213990_1518_2969 469
283 3300005329 Ga0070683_100009696 Ga0070683_1000096963 471
284 3300005334 Ga0068869_100001206 Ga0068869_1000012069 471
285 3300005338 Ga0068868_100031339 Ga0068868_1000313391 471
286 3300005355 Ga0070671_100016792 Ga0070671_1000167929 471
287 3300005367 Ga0070667_100017390 Ga0070667_1000173901 471
288 3300005535 Ga0070684_100008565 Ga0070684_1000085651 471
289 3300005563 Ga0068855_100007326 Ga0068855_1000073267 471
290 3300005577 Ga0068857_100002783 Ga0068857_10000278310 471
291 3300005614 Ga0068856_100005068 Ga0068856_1000050684 471
292 3300005614 Ga0068856_100125656 Ga0068856_1001256562 471
293 3300005616 Ga0068852_100129548 Ga0068852_1001295482 471
294 3300005617 Ga0068859_100007032 Ga0068859_1000070327 471
295 3300005618 Ga0068864_100004120 Ga0068864_1000041205 471
296 3300005841 Ga0068863_100003622 Ga0068863_1000036229 471
297 3300005842 Ga0068858_100014464 Ga0068858_1000144643 471
298 3300005843 Ga0068860_100006785 Ga0068860_1000067855 471
299 3300006237 Ga0097621_100005247 Ga0097621_1000052473 471
300 3300006358 Ga0068871_100007776 Ga0068871_1000077763 471
301 3300006931 Ga0097620_100007033 Ga0097620_1000070337 471
302 3300009093 Ga0105240_10004439 Ga0105240_100044394 471
303 3300009174 Ga0105241_10002080 Ga0105241_1000208010 471
304 3300009177 Ga0105248_10000003 Ga0105248_10000003523 471
305 3300009177 Ga0105248_10011582 Ga0105248_100115823 471
306 3300009545 Ga0105237_10012532 Ga0105237_100125324 471
307 3300009551 Ga0105238_10003727 Ga0105238_100037278 471
308 3300009553 Ga0105249_10154245 Ga0105249_101542452 471
309 3300011119 Ga0105246_10011258 Ga0105246_100112584 471
310 3300013105 Ga0157369_10018945 Ga0157369_100189452 471
311 3300013296 Ga0157374_10067036 Ga0157374_100670364 471
312 3300013306 Ga0163162_10003588 Ga0163162_1000358816 471
313 3300013308 Ga0157375_10007374 Ga0157375_100073744 471
314 3300014325 Ga0163163_10006725 Ga0163163_100067253 471
315 3300014968 Ga0157379_10003213 Ga0157379_100032136 471
316 3300014968 Ga0157379_10140398 Ga0157379_101403981 471
317 3300014969 Ga0157376_10107844 Ga0157376_101078443 471
318 3300014969 Ga0157376_10274379 Ga0157376_102743791 471
319 3300025900 Ga0207710_10003278 Ga0207710_100032783 471
320 3300025913 Ga0207695_10006198 Ga0207695_100061982 471
321 3300025914 Ga0207671_10003735 Ga0207671_1000373514 471
322 3300025924 Ga0207694_10000749 Ga0207694_1000074913 471
323 3300025925 Ga0207650_10025866 Ga0207650_100258663 471
324 3300025931 Ga0207644_10011501 Ga0207644_100115018 471
325 3300025941 Ga0207711_10102105 Ga0207711_101021052 471
326 3300025942 Ga0207689_10001455 Ga0207689_100014556 471
327 3300025944 Ga0207661_10030746 Ga0207661_100307464 471
328 3300025949 Ga0207667_10009690 Ga0207667_100096909 471
329 3300025949 Ga0207667_10306263 Ga0207667_103062631 471
330 3300026023 Ga0207677_10029239 Ga0207677_100292392 471
331 3300026078 Ga0207702_10046406 Ga0207702_100464062 471
332 3300026078 Ga0207702_10088920 Ga0207702_100889202 471
333 3300026088 Ga0207641_10005842 Ga0207641_100058427 471
334 3300026095 Ga0207676_10008548 Ga0207676_100085484 471
335 3300026116 Ga0207674_10009962 Ga0207674_100099625 471
336 3300026142 Ga0207698_10014760 Ga0207698_100147606 471
337 3300028381 Ga0268264_10001478 Ga0268264_100014786 471
338 3300031250 Ga0265331_10039611 Ga0265331_100396111 471
339 3300031712 Ga0265342_10033832 Ga0265342_100338323 471
340 3300046689 Ga0495613_0044385 Ga0495613_0044385_157_1605 471
341 3300048904 Ga0496101_0138983 Ga0496101_0138983_192_1640 471
342 3300048907 Ga0496104_0010846 Ga0496104_0010846_5864_7312 471
343 3300048908 Ga0496105_0005270 Ga0496105_0005270_8057_9505 471
344 3300048909 Ga0496106_0113356 Ga0496106_0113356_418_1866 471
345 3300048910 Ga0496107_0094960 Ga0496107_0094960_245_1693 471
346 3300048917 Ga0496114_0062187 Ga0496114_0062187_876_2324 471
347 3300005338 Ga0068868_100013750 Ga0068868_1000137503 472
348 3300009093 Ga0105240_10012023 Ga0105240_100120238 472
349 3300009551 Ga0105238_10034266 Ga0105238_100342663 472
350 3300010375 Ga0105239_10019794 Ga0105239_100197943 472
351 3300013105 Ga0157369_10111837 Ga0157369_101118373 472
352 3300013307 Ga0157372_10341229 Ga0157372_103412292 472
353 3300013308 Ga0157375_10088503 Ga0157375_100885033 472
354 3300025321 Ga0207656_10027950 Ga0207656_100279503 472
355 3300026041 Ga0207639_10012641 Ga0207639_100126413 472
356 3300028800 Ga0265338_10008925 Ga0265338_100089254 472
357 3300031239 Ga0265328_10017154 Ga0265328_100171541 472
358 3300031249 Ga0265339_10023013 Ga0265339_100230134 472
359 3300031344 Ga0265316_10017868 Ga0265316_100178684 472
360 3300026116 Ga0207674_10016370 Ga0207674_100163704 473
361 3300005327 Ga0070658_10018010 Ga0070658_100180103 474
362 3300005329 Ga0070683_100048922 Ga0070683_1000489221 474
363 3300005344 Ga0070661_100023533 Ga0070661_1000235332 474
364 3300005539 Ga0068853_100000912 Ga0068853_1000009125 474
365 3300005539 Ga0068853_100077211 Ga0068853_1000772113 474
366 3300005563 Ga0068855_100003821 Ga0068855_1000038218 474
367 3300005563 Ga0068855_100006977 Ga0068855_1000069772 474
368 3300005577 Ga0068857_100081371 Ga0068857_1000813712 474
369 3300005578 Ga0068854_100079099 Ga0068854_1000790993 474
370 3300005616 Ga0068852_100000041 Ga0068852_10000004172 474
371 3300005616 Ga0068852_100000338 Ga0068852_10000033820 474
372 3300005834 Ga0068851_10002984 Ga0068851_100029847 474
373 3300009093 Ga0105240_10000251 Ga0105240_1000025120 474
374 3300009093 Ga0105240_10116044 Ga0105240_101160443 474
375 3300009093 Ga0105240_10319098 Ga0105240_103190982 474
376 3300009174 Ga0105241_10000259 Ga0105241_1000025920 474
377 3300009551 Ga0105238_10001587 Ga0105238_1000158712 474
378 3300013104 Ga0157370_10000003 Ga0157370_10000003201 474
379 3300013105 Ga0157369_10000094 Ga0157369_1000009420 474
380 3300013105 Ga0157369_10004449 Ga0157369_1000444916 474
381 3300013296 Ga0157374_10001112 Ga0157374_1000111214 474
382 3300013307 Ga0157372_10000074 Ga0157372_1000007420 474
383 3300013307 Ga0157372_10064349 Ga0157372_100643493 474
384 3300014968 Ga0157379_10178022 Ga0157379_101780222 474
385 3300025911 Ga0207654_10000490 Ga0207654_100004905 474
386 3300025913 Ga0207695_10000129 Ga0207695_10000129133 474
387 3300025913 Ga0207695_10000428 Ga0207695_100004285 474
388 3300025914 Ga0207671_10008200 Ga0207671_100082005 474
389 3300025924 Ga0207694_10000036 Ga0207694_10000036156 474
390 3300025925 Ga0207650_10098537 Ga0207650_100985372 474
391 3300025940 Ga0207691_10006364 Ga0207691_1000636410 474
392 3300025941 Ga0207711_10090756 Ga0207711_100907562 474
393 3300025942 Ga0207689_10038719 Ga0207689_100387192 474
394 3300025944 Ga0207661_10035604 Ga0207661_100356042 474
395 3300025949 Ga0207667_10003825 Ga0207667_1000382513 474
396 3300025949 Ga0207667_10003877 Ga0207667_100038776 474
397 3300026041 Ga0207639_10000049 Ga0207639_1000004928 474
398 3300026078 Ga0207702_10005190 Ga0207702_100051908 474
399 3300026095 Ga0207676_10124742 Ga0207676_101247421 474
400 3300026121 Ga0207683_10001144 Ga0207683_100011443 474
401 3300026142 Ga0207698_10000017 Ga0207698_1000001721 474
402 3300026142 Ga0207698_10000037 Ga0207698_1000003714 474
403 3300026142 Ga0207698_10169939 Ga0207698_101699392 474
404 3300031241 Ga0265325_10015752 Ga0265325_100157524 474
405 3300031249 Ga0265339_10000031 Ga0265339_10000031130 474
406 3300031249 Ga0265339_10003764 Ga0265339_1000376412 474
407 3300035691 Ga0373931_0104973 Ga0373931_0104973_67_1533 474
408 3300036401 Ga0373937_0001874 Ga0373937_0001874_8818_10284 474
409 3300045976 Ga0466967_0001557 Ga0466967_0001557_8062_9528 474
410 3300048907 Ga0496104_0081608 Ga0496104_0081608_180_1646 474
411 3300005617 Ga0068859_100087006 Ga0068859_1000870063 475
412 3300006028 Ga0070717_10006261 Ga0070717_100062613 475
413 3300006237 Ga0097621_100003942 Ga0097621_10000394211 475
414 3300006931 Ga0097620_100087006 Ga0097620_1000870063 475
415 3300009093 Ga0105240_10002247 Ga0105240_1000224718 475
416 3300009093 Ga0105240_10009662 Ga0105240_100096629 475
417 3300009098 Ga0105245_10022781 Ga0105245_100227813 475
418 3300009174 Ga0105241_10026834 Ga0105241_100268343 475
419 3300009177 Ga0105248_10013518 Ga0105248_100135183 475
420 3300009551 Ga0105238_10005042 Ga0105238_100050424 475
421 3300010375 Ga0105239_10005701 Ga0105239_1000570112 475
422 3300013105 Ga0157369_10005464 Ga0157369_1000546416 475
423 3300013296 Ga0157374_10014101 Ga0157374_100141013 475
424 3300013297 Ga0157378_10037375 Ga0157378_100373755 475
425 3300013297 Ga0157378_10096447 Ga0157378_100964472 475
426 3300013307 Ga0157372_10003222 Ga0157372_100032224 475
427 3300025913 Ga0207695_10000194 Ga0207695_1000019459 475
428 3300025913 Ga0207695_10037309 Ga0207695_100373094 475
429 3300025924 Ga0207694_10002282 Ga0207694_1000228210 475
430 3300025941 Ga0207711_10005835 Ga0207711_100058354 475
431 3300031235 Ga0265330_10004955 Ga0265330_100049552 475
432 3300031235 Ga0265330_10005509 Ga0265330_100055096 475
433 3300031344 Ga0265316_10001845 Ga0265316_100018459 475
434 3300031712 Ga0265342_10003478 Ga0265342_100034782 475
435 3300013308 Ga0157375_10203218 Ga0157375_102032182 476
436 3300025913 Ga0207695_10188942 Ga0207695_101889422 476
437 3300025949 Ga0207667_10065243 Ga0207667_100652433 476
438 3300031241 Ga0265325_10008972 Ga0265325_100089724 476
439 3300031247 Ga0265340_10017409 Ga0265340_100174093 476
440 3300031344 Ga0265316_10015742 Ga0265316_100157427 476
441 3300031344 Ga0265316_10016178 Ga0265316_100161783 476
442 3300031344 Ga0265316_10060927 Ga0265316_100609272 476
443 3300031595 Ga0265313_10003980 Ga0265313_100039806 476
444 3300046459 Ga0495629_0013741 Ga0495629_0013741_1159_2625 476
445 3300046533 Ga0495640_0056871 Ga0495640_0056871_831_2297 476
446 3300046543 Ga0495645_0011643 Ga0495645_0011643_415_1881 476
447 3300046679 Ga0495623_0117006 Ga0495623_0117006_57_1544 476
448 3300046689 Ga0495613_0060607 Ga0495613_0060607_16_1482 476
449 3300046809 Ga0495600_0045762 Ga0495600_0045762_1010_2476 476
450 3300048088 Ga0495602_0075191 Ga0495602_0075191_974_2440 476
451 3300005329 Ga0070683_100006870 Ga0070683_1000068702 477
452 3300005336 Ga0070680_100071499 Ga0070680_1000714992 477
453 3300005458 Ga0070681_10160006 Ga0070681_101600062 477
454 3300005535 Ga0070684_100256572 Ga0070684_1002565721 477
455 3300005539 Ga0068853_100068197 Ga0068853_1000681971 477
456 3300005577 Ga0068857_100006312 Ga0068857_1000063124 477
457 3300005616 Ga0068852_100047619 Ga0068852_1000476193 477
458 3300009093 Ga0105240_10094351 Ga0105240_100943511 477
459 3300009551 Ga0105238_10046566 Ga0105238_100465662 477
460 3300013105 Ga0157369_10006412 Ga0157369_100064124 477
461 3300025921 Ga0207652_10108643 Ga0207652_101086432 477
462 3300025941 Ga0207711_10000013 Ga0207711_1000001399 477
463 3300025944 Ga0207661_10005737 Ga0207661_100057373 477
464 3300026116 Ga0207674_10004432 Ga0207674_1000443210 477
465 3300028577 Ga0265318_10042503 Ga0265318_100425031 477
466 3300028800 Ga0265338_10001002 Ga0265338_100010024 477
467 3300028800 Ga0265338_10033116 Ga0265338_100331164 477
468 3300028800 Ga0265338_10044107 Ga0265338_100441073 477
469 3300031235 Ga0265330_10007824 Ga0265330_100078245 477
470 3300031241 Ga0265325_10001870 Ga0265325_100018706 477
471 3300031241 Ga0265325_10038597 Ga0265325_100385971 477
472 3300031242 Ga0265329_10021878 Ga0265329_100218782 477
473 3300031247 Ga0265340_10021649 Ga0265340_100216492 477
474 3300031249 Ga0265339_10017271 Ga0265339_100172712 477
475 3300031249 Ga0265339_10045400 Ga0265339_100454002 477
476 3300031344 Ga0265316_10051787 Ga0265316_100517871 477
477 3300031344 Ga0265316_10052720 Ga0265316_100527202 477
478 3300031595 Ga0265313_10068721 Ga0265313_100687212 477
479 3300031711 Ga0265314_10000025 Ga0265314_1000002588 477
480 3300031711 Ga0265314_10014587 Ga0265314_100145873 477
481 3300031712 Ga0265342_10005807 Ga0265342_100058078 477
482 3300031712 Ga0265342_10020339 Ga0265342_100203392 477
483 3300025913 Ga0207695_10085814 Ga0207695_100858143 478
484 3300003320 rootH2_10033281 rootH2_100332814 479

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01425

Amidase

Amidase

72

502

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ip4-assembly1.cif.gz_A the high resolution structure of gatcab 0.8897 16 474
4wj3-assembly2.cif.gz_D crystal structure of the asparagine transamidosome from pseudomonas aeruginosa 0.8865 16 474
3kfu-assembly1.cif.gz_H crystal structure of the transamidosome 0.8651 18 478
3h0r-assembly7.cif.gz_S structure of trna-dependent amidotransferase gatcab from aquifex aeolicus 0.8645 16 478
6c62-assembly1.cif.gz_A an unexpected vestigial protein complex reveals the evolutionary origins of an s-triazine catabolic enzyme. 0.8621 16 474
ID Description Score Start End Superfamily
2dqnA00 Alpha Beta;Alpha-Beta Complex;Amidase signature (AS) enzymes;Amidase signature (AS) domain 0.8901 16 474 3.90.1300.10
4wj3D00 Alpha Beta;Alpha-Beta Complex;Amidase signature (AS) enzymes;Amidase signature (AS) domain 0.8865 16 474 3.90.1300.10
af_Q9LI77_43_527_3.90.1300.10 Alpha Beta;Alpha-Beta Complex;Amidase signature (AS) enzymes;Amidase signature (AS) domain 0.8847 15 474 3.90.1300.10
af_Q58560_2_434_3.90.1300.10 Alpha Beta;Alpha-Beta Complex;Amidase signature (AS) enzymes;Amidase signature (AS) domain 0.8771 33 475 3.90.1300.10
af_Q5FWT5_3_499_3.90.1300.10 Alpha Beta;Alpha-Beta Complex;Amidase signature (AS) enzymes;Amidase signature (AS) domain 0.8755 15 474 3.90.1300.10
ID Description Score Start End GO Terms
AF-A0A2T1CIC8-F1-model_v4 Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatA 0.9627 15 231 GO:0016740
AF-A0A6I1IQD4-F1-model_v4 deleted 0.9621 164 294
AF-A0A7C6WBK3-F1-model_v4 Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatA (EC 6.3.5.7) 0.9601 16 268 GO:0016740
GO:0050567
AF-A0A3C0SA14-F1-model_v4 Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatA 0.959 16 243 GO:0016740
AF-A0A7K0YX71-F1-model_v4 deleted 0.9574 16 156

Feature Viewer

pLDDT pTM Quality
85.91 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map