F452945

General Info

Members Datasets Scaffolds Average Seq Length
484 279 467 142

Family's Representative Sequence

Representative Sequence 3300014968|Ga0157379_10042070|Ga0157379_100420703
Length 167
Sequence MGGREGEWAGTAPVSASLKQAIGEAMIRRVDDRISVSPQIFPGDVGELAEAGFTMVINNRPDGEEPGQPEGASIGEAARTAGMDYVAIPVTHAGFSANQVEAMAAALARAPGPVFAYCRSGTRSCNLWALAQASTGVAPDELIVKGADAGYDLSGLRPLLETLSGKA

Samples

Sample ID Description Type Environment
1 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
2 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
3 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
4 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
5 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
6 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
7 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
8 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere
9 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
10 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
11 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
12 2946787523 Sphingomonas faeni W4I17 Isolate Rhizosphere
13 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
14 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
15 2990265787 Sphingomonas sp. SORGH_AS802 Isolate Aerial Root
16 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root
17 2993693658 Sphingomonas sp. SORGH_AS438 Isolate Aerial Root
18 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
19 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
20 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
21 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
22 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
23 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
24 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
25 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
26 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
27 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
28 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
29 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
30 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
31 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
32 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
33 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
34 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
35 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
36 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
37 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
38 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
39 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
40 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
41 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
42 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
43 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
44 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
45 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
46 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
47 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
48 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
49 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
50 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
51 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
52 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
53 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
54 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
55 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
56 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
57 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
58 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
59 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
60 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
61 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
62 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
63 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
64 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
65 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
66 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
67 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
68 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
69 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
70 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
71 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
72 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
73 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
74 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
76 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
87 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
90 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
91 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
92 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
98 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
99 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
100 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
101 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
102 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
105 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
106 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
107 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
110 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
111 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
113 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
114 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
116 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
117 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
118 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
120 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
121 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
165 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
166 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
167 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
168 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
169 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
170 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
171 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
172 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
173 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
174 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
175 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
176 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
177 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
178 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
179 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
180 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
181 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
182 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
183 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
184 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
185 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
186 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
187 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
188 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
189 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
190 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
191 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
192 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
193 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
194 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
195 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
196 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
197 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
198 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
199 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
200 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
201 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
202 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
203 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
204 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
205 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
206 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
207 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
208 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
209 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
210 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
211 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
212 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
213 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
214 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
215 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
216 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
217 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
218 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
219 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
220 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
221 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
222 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
223 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
224 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
225 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
226 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
227 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
228 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
229 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
230 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
231 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
232 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
233 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
234 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
235 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
236 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
237 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
238 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
239 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
240 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
241 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
242 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
243 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
244 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
245 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
246 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
247 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
248 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
249 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
250 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
251 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
252 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
253 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
254 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
255 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
256 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
257 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
258 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
259 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
260 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
261 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
262 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
263 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
264 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
265 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
266 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
267 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
268 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
269 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
270 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
271 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
272 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
273 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
274 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
275 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
276 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
277 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
278 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
279 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.49
Metatranscriptomes 0
Isolates 3.51

Biome Distribution

Category Percentage (%)
Aerial Root 1.03
Bulb 0
Endosphere 20.45
Nodule 0
Rhizoplane 3.93
Rhizosphere 64.88
Stem 0
Stem Tuber 0
Unclassified 9.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 2214764952 2209111006 Bacteria 821
2 ARcpr5oldR_c001975 3300000041 Bacteria 1961
3 ARcpr5yngRDRAFT_c002293 3300000043 Bacteria 1998
4 JGI24741J21665_1001037 3300001915 Bacteria 8347
5 JGI24747J21853_1006358 3300001978 Bacteria 1116
6 JGI24740J21852_10035356 3300001979 Bacteria 1563
7 JGI24740J21852_10041971 3300001979 Bacteria 1374
8 JGI24739J22299_10019515 3300001989 Bacteria 2426
9 JGI24737J22298_10018204 3300001990 Bacteria 2256
10 JGI24742J22300_10005645 3300002244 Bacteria 2057
11 JGI25150J39212_1000367 3300002774 Bacteria 21803
12 JGI25151J46595_10008355 3300003187 Bacteria 4985
13 JGI25165J46597_1000010 3300003214 Bacteria 442113
14 JGI25153J46596_10000034 3300003215 Bacteria 192215
15 JGI25153J46596_10000125 3300003215 Bacteria 86065
16 JGI25153J46596_10001909 3300003215 Bacteria 12362
17 rootH1_10055037 3300003316 Bacteria 2236
18 rootH2_10034531 3300003320 Bacteria 1430
19 rootH2_10226221 3300003320 Bacteria 1195
20 Ga0055525_1000139 3300003759 Bacteria 102623
21 Ga0055542_1000012 3300003762 Bacteria 391808
22 Ga0055529_1000004 3300003763 Bacteria 433331
23 Ga0055526_1001906 3300003771 Bacteria 14450
24 Ga0055537_1000882 3300003773 Bacteria 14287
25 Ga0055537_1040344 3300003773 Bacteria 561
26 Ga0055524_1000210 3300003775 Bacteria 62927
27 Ga0055536_1010766 3300003781 Bacteria 3584
28 Ga0055530_10000117 3300003791 Bacteria 69120
29 Ga0055530_10019040 3300003791 Bacteria 2092
30 Ga0055540_1000868 3300003792 Bacteria 20036
31 Ga0055531_10000180 3300003794 Bacteria 71821
32 Ga0055531_10003447 3300003794 Bacteria 10076
33 Ga0065165_1002232 3300005262 Bacteria 17225
34 Ga0065165_1017247 3300005262 Bacteria 2668
35 Ga0065165_1031606 3300005262 Bacteria 1671
36 Ga0065165_1043112 3300005262 Bacteria 1327
37 Ga0065165_1068411 3300005262 Bacteria 950
38 Ga0070658_10003871 3300005327 Bacteria 12276
39 Ga0070658_10730939 3300005327 Bacteria 860
40 Ga0070676_11186020 3300005328 Bacteria 580
41 Ga0070683_100244443 3300005329 Bacteria 1707
42 Ga0070670_100211613 3300005331 Bacteria 1686
43 Ga0068869_100454667 3300005334 Bacteria 1062
44 Ga0068868_100327284 3300005338 Bacteria 1307
45 Ga0070660_100038665 3300005339 Bacteria 3623
46 Ga0070660_100087301 3300005339 Bacteria 2455
47 Ga0070661_100003965 3300005344 Bacteria 10183
48 Ga0070661_100428030 3300005344 Bacteria 1050
49 Ga0070661_100531244 3300005344 Bacteria 944
50 Ga0070661_101007108 3300005344 Bacteria 691
51 Ga0070668_101686427 3300005347 Bacteria 582
52 Ga0070671_101637773 3300005355 Bacteria 571
53 Ga0070674_100000483 3300005356 Bacteria 20099
54 Ga0070674_100086878 3300005356 Bacteria 2247
55 Ga0070659_100050935 3300005366 Bacteria 3255
56 Ga0070659_100063615 3300005366 Bacteria 2919
57 Ga0070659_100117442 3300005366 Bacteria 2151
58 Ga0070667_100238940 3300005367 Bacteria 1621
59 Ga0070663_100049312 3300005455 Bacteria 2989
60 Ga0070678_100004211 3300005456 Bacteria 8124
61 Ga0070678_100108844 3300005456 Bacteria 2164
62 Ga0070678_100273225 3300005456 Bacteria 1426
63 Ga0070678_101352011 3300005456 Bacteria 664
64 Ga0070662_100115170 3300005457 Bacteria 2053
65 Ga0068867_100115551 3300005459 Bacteria 2067
66 Ga0068867_100132478 3300005459 Bacteria 1939
67 Ga0070679_101992915 3300005530 Bacteria 530
68 Ga0068853_100767331 3300005539 Bacteria 922
69 Ga0070672_100156798 3300005543 Bacteria 1886
70 Ga0070665_100000043 3300005548 Bacteria 279774
71 Ga0070665_100311406 3300005548 Bacteria 1578
72 Ga0068855_100325359 3300005563 Bacteria 1698
73 Ga0068855_100436673 3300005563 Bacteria 1430
74 Ga0068855_102128447 3300005563 Bacteria 564
75 Ga0070664_100901876 3300005564 Bacteria 829
76 Ga0068857_100048238 3300005577 Bacteria 3781
77 Ga0068857_100100095 3300005577 Bacteria 2600
78 Ga0068854_100096803 3300005578 Bacteria 2205
79 Ga0068854_100139995 3300005578 Bacteria 1856
80 Ga0068854_100750605 3300005578 Bacteria 846
81 Ga0068854_102049875 3300005578 Bacteria 528
82 Ga0068852_100319506 3300005616 Bacteria 1507
83 Ga0068852_100489233 3300005616 Bacteria 1224
84 Ga0068859_100000682 3300005617 Bacteria 34086
85 Ga0068859_101452576 3300005617 Bacteria 757
86 Ga0068864_100000218 3300005618 Bacteria 51909
87 Ga0068861_100001233 3300005719 Bacteria 15929
88 Ga0068861_100968811 3300005719 Bacteria 810
89 Ga0068851_10021055 3300005834 Bacteria 3163
90 Ga0068851_10022913 3300005834 Bacteria 3048
91 Ga0068858_100000274 3300005842 Bacteria 55319
92 Ga0068858_100000352 3300005842 Bacteria 48455
93 Ga0097621_100121999 3300006237 Bacteria 2211
94 Ga0075370_10122412 3300006353 Bacteria 1515
95 Ga0068871_100043237 3300006358 Bacteria 3619
96 Ga0068865_100082347 3300006881 Bacteria 2313
97 Ga0097620_100000682 3300006931 Bacteria 34086
98 Ga0097620_101452660 3300006931 Bacteria 757
99 Ga0105240_10159458 3300009093 Bacteria 2681
100 Ga0105245_10001591 3300009098 Bacteria 20657
101 Ga0105247_10746383 3300009101 Bacteria 741
102 Ga0105243_10001132 3300009148 Bacteria 24182
103 Ga0105243_10035358 3300009148 Bacteria 3872
104 Ga0105243_10205024 3300009148 Bacteria 1732
105 Ga0105243_10546331 3300009148 Bacteria 1106
106 Ga0105241_10025406 3300009174 Bacteria 4401
107 Ga0105242_10842927 3300009176 Bacteria 911
108 Ga0105248_10000824 3300009177 Bacteria 34827
109 Ga0105248_10007725 3300009177 Bacteria 11809
110 Ga0105248_10524296 3300009177 Bacteria 1336
111 Ga0105237_10030488 3300009545 Bacteria 5477
112 Ga0105237_10112806 3300009545 Bacteria 2711
113 Ga0105237_10181683 3300009545 Bacteria 2104
114 Ga0105238_10021033 3300009551 Bacteria 6648
115 Ga0105238_10101907 3300009551 Bacteria 2853
116 Ga0105238_11026046 3300009551 Bacteria 846
117 Ga0105239_10156374 3300010375 Bacteria 2546
118 Ga0105239_10166967 3300010375 Bacteria 2461
119 Ga0157373_10857052 3300013100 Bacteria 672
120 Ga0157373_11482274 3300013100 Bacteria 517
121 Ga0157371_10000452 3300013102 Bacteria 50337
122 Ga0157371_10106670 3300013102 Bacteria 1988
123 Ga0157370_10201818 3300013104 Bacteria 1844
124 Ga0157370_10620030 3300013104 Bacteria 990
125 Ga0157369_10199690 3300013105 Bacteria 2099
126 Ga0157369_10294973 3300013105 Bacteria 1687
127 Ga0157369_11110291 3300013105 Bacteria 808
128 Ga0157369_11551939 3300013105 Bacteria 673
129 Ga0157378_10047209 3300013297 Bacteria 3828
130 Ga0157378_10094168 3300013297 Bacteria 2727
131 Ga0157378_11856412 3300013297 Bacteria 651
132 Ga0163162_10094977 3300013306 Bacteria 3068
133 Ga0163162_10240400 3300013306 Bacteria 1942
134 Ga0163162_10302405 3300013306 Bacteria 1732
135 Ga0157372_10121806 3300013307 Bacteria 2997
136 Ga0157372_10361685 3300013307 Bacteria 1691
137 Ga0157372_10866186 3300013307 Bacteria 1048
138 Ga0163163_13104451 3300014325 Bacteria 518
139 Ga0157380_10656433 3300014326 Bacteria 1047
140 Ga0157377_11060791 3300014745 Bacteria 618
141 Ga0157379_10042070 3300014968 Bacteria 4078
142 Ga0183363_1003 3300015690 Bacteria 421263
143 Ga0163161_10132775 3300017792 Bacteria 1879
144 Ga0163161_11286317 3300017792 Bacteria 635
145 Ga0209674_105609 3300025226 Bacteria 1822
146 Ga0209563_100070 3300025230 Bacteria 249779
147 Ga0209437_106401 3300025233 Bacteria 1962
148 Ga0207425_1000005 3300025245 Bacteria 900502
149 Ga0207425_1005496 3300025245 Bacteria 3603
150 Ga0209026_1040758 3300025250 Bacteria 673
151 Ga0209677_106606 3300025253 Bacteria 2704
152 Ga0209148_1000008 3300025254 Bacteria 1504371
153 Ga0209233_1000044 3300025261 Bacteria 489783
154 Ga0209233_1010300 3300025261 Bacteria 2808
155 Ga0209565_1000029 3300025263 Bacteria 340335
156 Ga0209565_1000052 3300025263 Bacteria 212056
157 Ga0209565_1019148 3300025263 Bacteria 1467
158 Ga0209455_1000002 3300025272 Bacteria 1505459
159 Ga0209455_1005248 3300025272 Bacteria 4049
160 Ga0209673_1000754 3300025273 Bacteria 44111
161 Ga0209675_1016418 3300025291 Bacteria 2157
162 Ga0209676_1021738 3300025292 Bacteria 2144
163 Ga0209025_1001791 3300025294 Bacteria 25501
164 Ga0209564_1000783 3300025295 Bacteria 44071
165 Ga0209564_1015450 3300025295 Bacteria 3102
166 Ga0209564_1041407 3300025295 Bacteria 1236
167 Ga0209758_1000002 3300025297 Bacteria 1400310
168 Ga0209758_1000007 3300025297 Bacteria 1270410
169 Ga0209758_1001653 3300025297 Bacteria 25273
170 Ga0209758_1027348 3300025297 Bacteria 2439
171 Ga0209050_1000001 3300025298 Bacteria 3563507
172 Ga0209050_1000131 3300025298 Bacteria 186028
173 Ga0209050_1001214 3300025298 Bacteria 30169
174 Ga0209050_1007441 3300025298 Bacteria 6136
175 Ga0209050_1023685 3300025298 Bacteria 2151
176 Ga0209050_1027964 3300025298 Bacteria 1842
177 Ga0209256_1000008 3300025299 Bacteria 975723
178 Ga0207426_1057715 3300025302 Bacteria 1129
179 Ga0209051_1000297 3300025303 Bacteria 79062
180 Ga0209257_1000028 3300025304 Bacteria 699493
181 Ga0209257_1000801 3300025304 Bacteria 45834
182 Ga0209257_1008441 3300025304 Bacteria 5855
183 Ga0209257_1018820 3300025304 Bacteria 2634
184 Ga0209257_1018821 3300025304 Bacteria 2634
185 Ga0207656_10003039 3300025321 Bacteria 5734
186 Ga0207647_10027042 3300025904 Bacteria 3744
187 Ga0207647_10209511 3300025904 Bacteria 1126
188 Ga0207645_10666246 3300025907 Bacteria 707
189 Ga0207705_10000512 3300025909 Bacteria 33029
190 Ga0207654_10001799 3300025911 Bacteria 11138
191 Ga0207695_10050658 3300025913 Bacteria 4366
192 Ga0207695_10060432 3300025913 Bacteria 3923
193 Ga0207671_10014397 3300025914 Bacteria 6253
194 Ga0207671_10031513 3300025914 Bacteria 3951
195 Ga0207657_10155420 3300025919 Bacteria 1860
196 Ga0207657_10247438 3300025919 Bacteria 1422
197 Ga0207649_10000581 3300025920 Bacteria 25005
198 Ga0207652_10472069 3300025921 Bacteria 1130
199 Ga0207681_10050109 3300025923 Bacteria 2825
200 Ga0207694_10101828 3300025924 Bacteria 2276
201 Ga0207694_10713603 3300025924 Bacteria 846
202 Ga0207694_10763156 3300025924 Bacteria 816
203 Ga0207659_11245659 3300025926 Bacteria 639
204 Ga0207687_10010108 3300025927 Bacteria 6169
205 Ga0207644_10558906 3300025931 Bacteria 948
206 Ga0207690_10000666 3300025932 Bacteria 21974
207 Ga0207690_10029320 3300025932 Bacteria 3497
208 Ga0207690_10105812 3300025932 Bacteria 2018
209 Ga0207706_10047066 3300025933 Bacteria 3817
210 Ga0207709_10000005 3300025935 Bacteria 806813
211 Ga0207709_10105650 3300025935 Bacteria 1871
212 Ga0207709_10196209 3300025935 Bacteria 1438
213 Ga0207709_10389566 3300025935 Bacteria 1062
214 Ga0207669_10000607 3300025937 Bacteria 15563
215 Ga0207669_10878970 3300025937 Bacteria 747
216 Ga0207704_10137580 3300025938 Bacteria 1703
217 Ga0207711_10013055 3300025941 Bacteria 6900
218 Ga0207711_10328448 3300025941 Bacteria 1414
219 Ga0207711_11334279 3300025941 Bacteria 660
220 Ga0207689_10529023 3300025942 Bacteria 989
221 Ga0207661_10134147 3300025944 Bacteria 2125
222 Ga0207679_10260740 3300025945 Bacteria 1478
223 Ga0207667_10000001 3300025949 Bacteria 1178522
224 Ga0207667_10090135 3300025949 Bacteria 3169
225 Ga0207651_11242778 3300025960 Bacteria 669
226 Ga0207668_10493352 3300025972 Bacteria 1052
227 Ga0207640_10003976 3300025981 Bacteria 7980
228 Ga0207640_10023159 3300025981 Bacteria 3729
229 Ga0207640_10028908 3300025981 Bacteria 3396
230 Ga0207640_10065785 3300025981 Bacteria 2420
231 Ga0207640_10352925 3300025981 Bacteria 1182
232 Ga0207658_10139584 3300025986 Bacteria 1959
233 Ga0207677_11743015 3300026023 Bacteria 578
234 Ga0207703_10001826 3300026035 Bacteria 18987
235 Ga0207639_10007166 3300026041 Bacteria 7596
236 Ga0207639_10702290 3300026041 Bacteria 938
237 Ga0207678_10014108 3300026067 Bacteria 7027
238 Ga0207678_10162048 3300026067 Bacteria 1910
239 Ga0207702_10009429 3300026078 Bacteria 8199
240 Ga0207648_10087828 3300026089 Bacteria 2714
241 Ga0207648_10131163 3300026089 Bacteria 2206
242 Ga0207676_10000169 3300026095 Bacteria 57208
243 Ga0207676_10845413 3300026095 Bacteria 895
244 Ga0207674_10007790 3300026116 Bacteria 12459
245 Ga0207674_10195341 3300026116 Bacteria 1973
246 Ga0207674_11713350 3300026116 Bacteria 596
247 Ga0207675_100000077 3300026118 Bacteria 75568
248 Ga0207675_101063197 3300026118 Bacteria 829
249 Ga0207683_10002829 3300026121 Bacteria 15160
250 Ga0207683_10417523 3300026121 Bacteria 1235
251 Ga0207698_10046963 3300026142 Bacteria 3266
252 Ga0268266_10000002 3300028379 Bacteria 3059047
253 Ga0307517_10020599 3300028786 Bacteria 8391
254 Ga0307517_10064728 3300028786 Bacteria 3394
255 Ga0307517_10093351 3300028786 Bacteria 2440
256 Ga0307513_10011763 3300031456 Bacteria 10849
257 Ga0307513_10012633 3300031456 Bacteria 10408
258 Ga0307513_10097112 3300031456 Bacteria 2982
259 Ga0307508_10000011 3300031616 Bacteria 248001
260 Ga0307413_10036577 3300031824 Bacteria 2828
261 Ga0307413_11347478 3300031824 Bacteria 626
262 Ga0307412_10000523 3300031911 Bacteria 22843
263 Ga0307412_10268733 3300031911 Bacteria 1333
264 Ga0307409_101523831 3300031995 Bacteria 696
265 Ga0307510_10000535 3300033180 Bacteria 37905
266 Ga0307510_10322422 3300033180 Bacteria 1001
267 Ga0395905_0433764 3300037471 Bacteria 1211
268 Ga0395905_0603114 3300037471 Bacteria 1000
269 Ga0436365_1179012 3300039437 Bacteria 1037
270 Ga0439436_0004924 3300041404 Bacteria 4097
271 Ga0439436_0021710 3300041404 Bacteria 1905
272 Ga0439461_0000494 3300041410 Bacteria 5687
273 Ga0439461_0009648 3300041410 Bacteria 1754
274 Ga0439466_0174820 3300041411 Bacteria 655
275 Ga0439465_0003876 3300041413 Bacteria 4880
276 Ga0439465_0007136 3300041413 Bacteria 3550
277 Ga0451787_688902 3300041441 Bacteria 756
278 Ga0451793_1479815 3300041452 Bacteria 635
279 Ga0451793_1907358 3300041452 Bacteria 749
280 Ga0451833_0200970 3300041491 Bacteria 825
281 Ga0451855_1658094 3300041511 Bacteria 827
282 Ga0451853_1252397 3300041512 Bacteria 827
283 Ga0451853_1898434 3300041512 Bacteria 555
284 Ga0439431_0007681 3300041997 Bacteria 2407
285 Ga0439431_0059390 3300041997 Bacteria 1003
286 Ga0439431_0179081 3300041997 Bacteria 611
287 Ga0439442_000994 3300042002 Bacteria 5727
288 Ga0439445_0001563 3300042004 Bacteria 4983
289 Ga0439445_0069498 3300042004 Bacteria 972
290 Ga0439432_000286 3300042006 Bacteria 18148
291 Ga0439449_0023480 3300042007 Bacteria 2306
292 Ga0439452_008215 3300042010 Bacteria 3154
293 Ga0439462_0000295 3300042015 Bacteria 9215
294 Ga0439462_0006929 3300042015 Bacteria 2829
295 Ga0439446_0025535 3300042156 Bacteria 1688
296 Ga0439446_0058046 3300042156 Bacteria 1166
297 Ga0439434_0019262 3300042435 Bacteria 2046
298 Ga0439434_0022966 3300042435 Bacteria 1876
299 Ga0451576_0427441 3300045051 Bacteria 1390
300 Ga0495617_255617 3300046452 Bacteria 539
301 Ga0495627_015112 3300046453 Bacteria 2672
302 Ga0495590_0108462 3300046457 Bacteria 990
303 Ga0495638_0000741 3300046460 Bacteria 35061
304 Ga0495638_0062533 3300046460 Bacteria 2298
305 Ga0495638_0179226 3300046460 Bacteria 1210
306 Ga0495638_0216801 3300046460 Bacteria 1072
307 Ga0495638_0339179 3300046460 Bacteria 797
308 Ga0495650_0000364 3300046471 Bacteria 79811
309 Ga0495650_0096857 3300046471 Bacteria 1113
310 Ga0495584_0104337 3300046491 Bacteria 1433
311 Ga0495585_0002083 3300046492 Bacteria 14646
312 Ga0495585_0089949 3300046492 Bacteria 1654
313 Ga0495585_0110405 3300046492 Bacteria 1463
314 Ga0495585_0309928 3300046492 Bacteria 774
315 Ga0495596_0010949 3300046500 Bacteria 3929
316 Ga0495607_0004446 3300046501 Bacteria 10302
317 Ga0495607_0069546 3300046501 Bacteria 1970
318 Ga0495583_0000311 3300046506 Bacteria 76925
319 Ga0495583_0002358 3300046506 Bacteria 16323
320 Ga0495583_0004958 3300046506 Bacteria 9239
321 Ga0495583_0019657 3300046506 Bacteria 3519
322 Ga0495583_0032927 3300046506 Bacteria 2497
323 Ga0495583_0085345 3300046506 Bacteria 1367
324 Ga0495606_0007432 3300046507 Bacteria 9812
325 Ga0495606_0130650 3300046507 Bacteria 1493
326 Ga0495606_0359260 3300046507 Bacteria 770
327 Ga0495631_0046391 3300046518 Bacteria 1910
328 Ga0495631_0125300 3300046518 Bacteria 1104
329 Ga0495632_0064791 3300046519 Bacteria 1766
330 Ga0495637_0239056 3300046520 Bacteria 656
331 Ga0495637_0278492 3300046520 Bacteria 597
332 Ga0495643_0002504 3300046522 Bacteria 14435
333 Ga0495643_0006895 3300046522 Bacteria 7397
334 Ga0495643_0021584 3300046522 Bacteria 3692
335 Ga0495643_0030846 3300046522 Bacteria 2989
336 Ga0495648_0002467 3300046524 Bacteria 17023
337 Ga0495648_0022564 3300046524 Bacteria 4329
338 Ga0495648_0081074 3300046524 Bacteria 1847
339 Ga0495648_0136988 3300046524 Bacteria 1293
340 Ga0495663_0007585 3300046525 Bacteria 3002
341 Ga0495642_0010068 3300046528 Bacteria 3620
342 Ga0495587_0091468 3300046536 Bacteria 1757
343 Ga0495597_0021751 3300046542 Bacteria 2981
344 Ga0495597_0085495 3300046542 Bacteria 1344
345 Ga0495633_0000538 3300046558 Bacteria 37829
346 Ga0495633_0214185 3300046558 Bacteria 882
347 Ga0495668_0000468 3300046616 Bacteria 51229
348 Ga0495668_0052903 3300046616 Bacteria 2246
349 Ga0495668_0117262 3300046616 Bacteria 1456
350 Ga0495611_0078787 3300046648 Bacteria 1513
351 Ga0495611_0127920 3300046648 Bacteria 1185
352 Ga0495611_0140317 3300046648 Bacteria 1128
353 Ga0495625_0000094 3300046660 Bacteria 144517
354 Ga0495625_0002092 3300046660 Bacteria 22304
355 Ga0495625_0004408 3300046660 Bacteria 13336
356 Ga0495625_0013920 3300046660 Bacteria 6441
357 Ga0495625_0058142 3300046660 Bacteria 2748
358 Ga0495625_0069936 3300046660 Bacteria 2465
359 Ga0495625_0087752 3300046660 Bacteria 2156
360 Ga0495625_0103986 3300046660 Bacteria 1947
361 Ga0495625_0382443 3300046660 Bacteria 883
362 Ga0495625_0391707 3300046660 Bacteria 870
363 Ga0495625_0505788 3300046660 Bacteria 738
364 Ga0495625_0568627 3300046660 Bacteria 684
365 Ga0495659_0134409 3300046664 Bacteria 983
366 Ga0495661_0366057 3300046665 Bacteria 707
367 Ga0495669_0000118 3300046684 Bacteria 51189
368 Ga0495670_0000016 3300046691 Bacteria 128045
369 Ga0495670_0094286 3300046691 Bacteria 1535
370 Ga0495670_0194123 3300046691 Bacteria 1074
371 Ga0495670_0257935 3300046691 Bacteria 930
372 Ga0495670_0466979 3300046691 Bacteria 684
373 Ga0495649_0281752 3300046694 Bacteria 849
374 Ga0495600_0095013 3300046809 Bacteria 1943
375 Ga0495660_0036323 3300046810 Bacteria 2749
376 Ga0495660_0251114 3300046810 Bacteria 820
377 Ga0495683_0002062 3300047323 Bacteria 12448
378 Ga0495683_0073643 3300047323 Bacteria 1675
379 Ga0495687_000436 3300047443 Bacteria 51636
380 Ga0495687_000499 3300047443 Bacteria 47300
381 Ga0495677_0008604 3300047445 Bacteria 3788
382 Ga0495677_0086351 3300047445 Bacteria 1179
383 Ga0495673_0090418 3300047469 Bacteria 1252
384 Ga0495681_0020245 3300047470 Bacteria 3613
385 Ga0495681_0067416 3300047470 Bacteria 1631
386 Ga0495681_0070647 3300047470 Bacteria 1582
387 Ga0495686_0000770 3300047472 Bacteria 42285
388 Ga0495686_0141818 3300047472 Bacteria 1417
389 Ga0495686_0194132 3300047472 Bacteria 1168
390 Ga0495615_0262377 3300048090 Bacteria 550
391 Ga0496100_0431225 3300048903 Bacteria 1008
392 Ga0496102_0000022 3300048905 Bacteria 246314
393 Ga0496102_0225611 3300048905 Bacteria 1766
394 Ga0496103_0000075 3300048906 Bacteria 114569
395 Ga0496104_0008397 3300048907 Bacteria 9180
396 Ga0496105_0007696 3300048908 Bacteria 8356
397 Ga0496106_0666866 3300048909 Bacteria 830
398 Ga0496107_0185331 3300048910 Bacteria 1546
399 Ga0496108_1192481 3300048911 Bacteria 644
400 Ga0496110_0004080 3300048913 Bacteria 11274
401 Ga0496111_0012054 3300048914 Bacteria 5845
402 Ga0496114_0015131 3300048917 Bacteria 6203
403 Ga0496115_0000384 3300048918 Bacteria 36457
404 Ga0496115_0002587 3300048918 Bacteria 12980
405 Ga0496116_0004132 3300048919 Bacteria 13988
406 Ga0496116_0109146 3300048919 Bacteria 1631
407 Ga0496117_0000439 3300048920 Bacteria 69213
408 Ga0496118_0000039 3300048921 Bacteria 305458
409 Ga0496119_0032028 3300048922 Bacteria 3511
410 Ga0496120_0026163 3300048923 Bacteria 3608
411 Ga0496121_0000123 3300048924 Bacteria 172448
412 Ga0496121_0000269 3300048924 Bacteria 108869
413 Ga0496121_0005688 3300048924 Bacteria 15848
414 Ga0496121_0669626 3300048924 Bacteria 629
415 Ga0496122_0026436 3300048925 Bacteria 5004
416 Ga0496122_0034059 3300048925 Bacteria 4176
417 Ga0496122_0434458 3300048925 Bacteria 656
418 Ga0496123_0042135 3300048926 Bacteria 3155
419 Ga0496123_0211888 3300048926 Bacteria 984
420 Ga0496123_0431213 3300048926 Bacteria 592
421 Ga0496124_0000076 3300048927 Bacteria 215767
422 Ga0496124_0002034 3300048927 Bacteria 27476
423 Ga0496124_0005038 3300048927 Bacteria 15097
424 Ga0496124_0559212 3300048927 Bacteria 753
425 Ga0496125_0021645 3300048928 Bacteria 5991
426 Ga0496125_0102259 3300048928 Bacteria 2106
427 Ga0496125_0735880 3300048928 Bacteria 519
428 Ga0496126_0001584 3300048929 Bacteria 34722
429 Ga0501033_0196851 3300049570 Bacteria 1441
430 Ga0501047_0946779 3300049581 Bacteria 674
431 Ga0501263_044485 3300049760 Bacteria 660
432 Ga0501044_0159686 3300049823 Bacteria 2232
433 nmdc:mga0k408_96648_c1 3300050493 Bacteria 1739
434 nmdc:mga07m45_634572_c1 3300050496 Bacteria 616
435 Ga0500610_0000255 3300053079 Bacteria 16041
436 Ga0500610_0440273 3300053079 Bacteria 514
437 Ga0500643_002602 3300053087 Bacteria 9155
438 Ga0500643_008252 3300053087 Bacteria 4109
439 Ga0500566_0017677 3300053094 Bacteria 4188
440 Ga0500641_0003136 3300053096 Bacteria 5852
441 Ga0500641_0069152 3300053096 Bacteria 1483
442 Ga0500562_007045 3300053108 Bacteria 2838
443 Ga0500562_039021 3300053108 Bacteria 1262
444 Ga0500595_001071 3300053119 Bacteria 15187
445 Ga0500595_007007 3300053119 Bacteria 4721
446 Ga0500595_027923 3300053119 Bacteria 1928
447 Ga0500642_0015946 3300053130 Bacteria 2841
448 Ga0500652_062903 3300053131 Bacteria 1531
449 Ga0500652_295239 3300053131 Bacteria 629
450 Ga0500658_0001088 3300053134 Bacteria 11124
451 Ga0500658_0009230 3300053134 Bacteria 3637
452 Ga0500559_0002452 3300053136 Bacteria 9597
453 Ga0500559_0066627 3300053136 Bacteria 1615
454 Ga0500559_0216852 3300053136 Bacteria 903
455 Ga0500568_0017469 3300053139 Bacteria 3167
456 Ga0500568_0025662 3300053139 Bacteria 2483
457 Ga0500588_0261558 3300053146 Bacteria 651
458 Ga0500604_0062250 3300053151 Bacteria 1174
459 Ga0500604_0187004 3300053151 Bacteria 711
460 Ga0500616_0032282 3300053153 Bacteria 2863
461 Ga0500619_113790 3300053154 Bacteria 921
462 Ga0500622_0226961 3300053156 Bacteria 834
463 Ga0500636_0004237 3300053177 Bacteria 8126
464 Ga0500645_000003 3300053730 Bacteria 305887
465 Ga0500645_000924 3300053730 Bacteria 16899
466 Ga0500596_000783 3300053735 Bacteria 6263
467 Ga0500661_033171 3300055283 Bacteria 911

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025907 Ga0207645_10666246 Ga0207645_106662462 129
2 3300005262 Ga0065165_1031606 Ga0065165_10316062 135
3 3300025304 Ga0209257_1008441 Ga0209257_10084415 135
4 3300031824 Ga0307413_10036577 Ga0307413_100365773 136
5 iso_pu_bacteria 2599185359 2600227025 137
6 iso_pu_bacteria 2818991466 2819715524 137
7 iso_pu_bacteria 2879163058 2879163225 137
8 iso_pu_bacteria 2928526807 2928529542 137
9 iso_pu_bacteria 2928968154 2928970971 137
10 3300045051 Ga0451576_0427441 Ga0451576_0427441_718_1149 138
11 iso_pu_bacteria 2599185354 2600202388 138
12 iso_pu_bacteria 2643221622 2644127583 138
13 iso_pu_bacteria 2751185897 2753766004 138
14 iso_pu_bacteria 2928027323 2928031062 138
15 iso_pu_bacteria 2946787523 2946790300 138
16 iso_pu_bacteria 2984555340 2984556942 138
17 iso_pu_bacteria 2984564862 2984568751 138
18 iso_pu_bacteria 2993356040 2993359742 138
19 3300013307 Ga0157372_10866186 Ga0157372_108661862 139
20 iso_pu_bacteria 2885429604 2885432664 139
21 3300006353 Ga0075370_10122412 Ga0075370_101224123 140
22 3300041512 Ga0451853_1898434 Ga0451853_1898434_55_486 140
23 3300050496 nmdc:mga07m45_634572_c1 nmdc:mga07m45_634572_c1_79_501 140
24 iso_pu_bacteria 2990265787 2990267929 140
25 iso_pu_bacteria 2993693658 2993697053 140
26 iso_pu_bacteria 8057101203 8057105516 140
27 3300003214 JGI25165J46597_1000010 JGI25165J46597_1000010164 141
28 3300003320 rootH2_10034531 rootH2_100345312 141
29 3300005328 Ga0070676_11186020 Ga0070676_111860201 141
30 3300005334 Ga0068869_100454667 Ga0068869_1004546671 141
31 3300005355 Ga0070671_101637773 Ga0070671_1016377731 141
32 3300005456 Ga0070678_101352011 Ga0070678_1013520112 141
33 3300005459 Ga0068867_100132478 Ga0068867_1001324782 141
34 3300005530 Ga0070679_101992915 Ga0070679_1019929151 141
35 3300005539 Ga0068853_100767331 Ga0068853_1007673311 141
36 3300005548 Ga0070665_100311406 Ga0070665_1003114063 141
37 3300005577 Ga0068857_100048238 Ga0068857_1000482383 141
38 3300005578 Ga0068854_100096803 Ga0068854_1000968032 141
39 3300005578 Ga0068854_100139995 Ga0068854_1001399953 141
40 3300005719 Ga0068861_100968811 Ga0068861_1009688111 141
41 3300005842 Ga0068858_100000274 Ga0068858_10000027446 141
42 3300009098 Ga0105245_10001591 Ga0105245_100015912 141
43 3300009101 Ga0105247_10746383 Ga0105247_107463832 141
44 3300009148 Ga0105243_10035358 Ga0105243_100353584 141
45 3300009177 Ga0105248_10524296 Ga0105248_105242962 141
46 3300009545 Ga0105237_10030488 Ga0105237_100304885 141
47 3300009551 Ga0105238_10021033 Ga0105238_100210339 141
48 3300009551 Ga0105238_11026046 Ga0105238_110260462 141
49 3300013105 Ga0157369_11551939 Ga0157369_115519391 141
50 3300013297 Ga0157378_10094168 Ga0157378_100941682 141
51 3300013306 Ga0163162_10240400 Ga0163162_102404002 141
52 3300014745 Ga0157377_11060791 Ga0157377_110607912 141
53 3300025233 Ga0209437_106401 Ga0209437_1064013 141
54 3300025250 Ga0209026_1040758 Ga0209026_10407582 141
55 3300025261 Ga0209233_1000044 Ga0209233_1000044319 141
56 3300025272 Ga0209455_1005248 Ga0209455_10052483 141
57 3300025914 Ga0207671_10014397 Ga0207671_100143978 141
58 3300025921 Ga0207652_10472069 Ga0207652_104720692 141
59 3300025923 Ga0207681_10050109 Ga0207681_100501094 141
60 3300025924 Ga0207694_10101828 Ga0207694_101018283 141
61 3300025924 Ga0207694_10713603 Ga0207694_107136032 141
62 3300025927 Ga0207687_10010108 Ga0207687_100101086 141
63 3300025931 Ga0207644_10558906 Ga0207644_105589062 141
64 3300025935 Ga0207709_10105650 Ga0207709_101056503 141
65 3300025941 Ga0207711_11334279 Ga0207711_113342791 141
66 3300025942 Ga0207689_10529023 Ga0207689_105290233 141
67 3300025981 Ga0207640_10028908 Ga0207640_100289082 141
68 3300025981 Ga0207640_10352925 Ga0207640_103529252 141
69 3300026023 Ga0207677_11743015 Ga0207677_117430151 141
70 3300026035 Ga0207703_10001826 Ga0207703_1000182610 141
71 3300026041 Ga0207639_10702290 Ga0207639_107022902 141
72 3300026089 Ga0207648_10131163 Ga0207648_101311633 141
73 3300026116 Ga0207674_10007790 Ga0207674_100077906 141
74 3300026118 Ga0207675_101063197 Ga0207675_1010631972 141
75 3300031456 Ga0307513_10097112 Ga0307513_100971123 141
76 3300031616 Ga0307508_10000011 Ga0307508_1000001175 141
77 3300031911 Ga0307412_10000523 Ga0307412_100005236 141
78 3300039437 Ga0436365_1179012 Ga0436365_1179012_194_631 141
79 3300046452 Ga0495617_255617 Ga0495617_255617_96_527 141
80 3300046460 Ga0495638_0000741 Ga0495638_0000741_17480_17908 141
81 3300046492 Ga0495585_0110405 Ga0495585_0110405_963_1391 141
82 3300046507 Ga0495606_0359260 Ga0495606_0359260_60_488 141
83 3300046520 Ga0495637_0278492 Ga0495637_0278492_132_560 141
84 3300046522 Ga0495643_0030846 Ga0495643_0030846_1848_2276 141
85 3300046524 Ga0495648_0022564 Ga0495648_0022564_2459_2890 141
86 3300046542 Ga0495597_0085495 Ga0495597_0085495_603_1031 141
87 3300046660 Ga0495625_0000094 Ga0495625_0000094_17426_17854 141
88 3300046660 Ga0495625_0058142 Ga0495625_0058142_358_786 141
89 3300046691 Ga0495670_0257935 Ga0495670_0257935_192_620 141
90 3300046691 Ga0495670_0466979 Ga0495670_0466979_230_661 141
91 3300047472 Ga0495686_0141818 Ga0495686_0141818_304_735 141
92 3300048924 Ga0496121_0005688 Ga0496121_0005688_12695_13123 141
93 3300048924 Ga0496121_0669626 Ga0496121_0669626_111_536 141
94 3300048925 Ga0496122_0034059 Ga0496122_0034059_1787_2212 141
95 3300048926 Ga0496123_0431213 Ga0496123_0431213_87_515 141
96 3300048927 Ga0496124_0002034 Ga0496124_0002034_3868_4293 141
97 3300048927 Ga0496124_0005038 Ga0496124_0005038_13637_14062 141
98 3300048927 Ga0496124_0559212 Ga0496124_0559212_67_492 141
99 3300048928 Ga0496125_0735880 Ga0496125_0735880_61_486 141
100 3300049570 Ga0501033_0196851 Ga0501033_0196851_945_1376 141
101 3300049581 Ga0501047_0946779 Ga0501047_0946779_142_570 141
102 3300049823 Ga0501044_0159686 Ga0501044_0159686_1775_2203 141
103 3300053096 Ga0500641_0069152 Ga0500641_0069152_616_1044 141
104 3300053108 Ga0500562_007045 Ga0500562_007045_199_627 141
105 3300053134 Ga0500658_0001088 Ga0500658_0001088_7840_8268 141
106 3300053136 Ga0500559_0002452 Ga0500559_0002452_8378_8806 141
107 3300053136 Ga0500559_0066627 Ga0500559_0066627_595_1023 141
108 3300053139 Ga0500568_0025662 Ga0500568_0025662_736_1164 141
109 3300053151 Ga0500604_0187004 Ga0500604_0187004_77_505 141
110 3300053153 Ga0500616_0032282 Ga0500616_0032282_1794_2222 141
111 2209111006 2214764952 2213781925 142
112 3300000041 ARcpr5oldR_c001975 ARcpr5oldR_0019753 142
113 3300000043 ARcpr5yngRDRAFT_c002293 ARcpr5yngRDRAFT_0022933 142
114 3300001915 JGI24741J21665_1001037 JGI24741J21665_10010376 142
115 3300001978 JGI24747J21853_1006358 JGI24747J21853_10063582 142
116 3300001979 JGI24740J21852_10035356 JGI24740J21852_100353562 142
117 3300001979 JGI24740J21852_10041971 JGI24740J21852_100419711 142
118 3300001989 JGI24739J22299_10019515 JGI24739J22299_100195152 142
119 3300001990 JGI24737J22298_10018204 JGI24737J22298_100182042 142
120 3300002244 JGI24742J22300_10005645 JGI24742J22300_100056452 142
121 3300002774 JGI25150J39212_1000367 JGI25150J39212_100036720 142
122 3300003187 JGI25151J46595_10008355 JGI25151J46595_100083553 142
123 3300003215 JGI25153J46596_10000034 JGI25153J46596_10000034175 142
124 3300003215 JGI25153J46596_10000125 JGI25153J46596_1000012511 142
125 3300003215 JGI25153J46596_10001909 JGI25153J46596_100019099 142
126 3300003316 rootH1_10055037 rootH1_100550373 142
127 3300003320 rootH2_10226221 rootH2_102262213 142
128 3300003759 Ga0055525_1000139 Ga0055525_100013916 142
129 3300003762 Ga0055542_1000012 Ga0055542_100001274 142
130 3300003763 Ga0055529_1000004 Ga0055529_1000004217 142
131 3300003771 Ga0055526_1001906 Ga0055526_100190611 142
132 3300003773 Ga0055537_1000882 Ga0055537_100088212 142
133 3300003773 Ga0055537_1040344 Ga0055537_10403441 142
134 3300003775 Ga0055524_1000210 Ga0055524_100021032 142
135 3300003781 Ga0055536_1010766 Ga0055536_10107663 142
136 3300003791 Ga0055530_10000117 Ga0055530_1000011729 142
137 3300003791 Ga0055530_10019040 Ga0055530_100190401 142
138 3300003792 Ga0055540_1000868 Ga0055540_10008689 142
139 3300003794 Ga0055531_10000180 Ga0055531_1000018030 142
140 3300003794 Ga0055531_10003447 Ga0055531_100034477 142
141 3300005262 Ga0065165_1002232 Ga0065165_10022324 142
142 3300005262 Ga0065165_1017247 Ga0065165_10172473 142
143 3300005262 Ga0065165_1043112 Ga0065165_10431123 142
144 3300005262 Ga0065165_1068411 Ga0065165_10684112 142
145 3300005327 Ga0070658_10003871 Ga0070658_1000387110 142
146 3300005327 Ga0070658_10730939 Ga0070658_107309391 142
147 3300005329 Ga0070683_100244443 Ga0070683_1002444433 142
148 3300005331 Ga0070670_100211613 Ga0070670_1002116133 142
149 3300005338 Ga0068868_100327284 Ga0068868_1003272842 142
150 3300005339 Ga0070660_100038665 Ga0070660_1000386652 142
151 3300005339 Ga0070660_100087301 Ga0070660_1000873013 142
152 3300005344 Ga0070661_100003965 Ga0070661_10000396515 142
153 3300005344 Ga0070661_100428030 Ga0070661_1004280302 142
154 3300005344 Ga0070661_100531244 Ga0070661_1005312442 142
155 3300005344 Ga0070661_101007108 Ga0070661_1010071082 142
156 3300005347 Ga0070668_101686427 Ga0070668_1016864271 142
157 3300005356 Ga0070674_100000483 Ga0070674_10000048316 142
158 3300005356 Ga0070674_100086878 Ga0070674_1000868783 142
159 3300005366 Ga0070659_100050935 Ga0070659_1000509352 142
160 3300005366 Ga0070659_100063615 Ga0070659_1000636152 142
161 3300005366 Ga0070659_100117442 Ga0070659_1001174423 142
162 3300005367 Ga0070667_100238940 Ga0070667_1002389402 142
163 3300005455 Ga0070663_100049312 Ga0070663_1000493123 142
164 3300005456 Ga0070678_100004211 Ga0070678_1000042114 142
165 3300005456 Ga0070678_100108844 Ga0070678_1001088442 142
166 3300005456 Ga0070678_100273225 Ga0070678_1002732252 142
167 3300005457 Ga0070662_100115170 Ga0070662_1001151703 142
168 3300005459 Ga0068867_100115551 Ga0068867_1001155512 142
169 3300005543 Ga0070672_100156798 Ga0070672_1001567982 142
170 3300005548 Ga0070665_100000043 Ga0070665_10000004384 142
171 3300005563 Ga0068855_100325359 Ga0068855_1003253592 142
172 3300005563 Ga0068855_100436673 Ga0068855_1004366732 142
173 3300005563 Ga0068855_102128447 Ga0068855_1021284472 142
174 3300005564 Ga0070664_100901876 Ga0070664_1009018762 142
175 3300005577 Ga0068857_100100095 Ga0068857_1001000953 142
176 3300005578 Ga0068854_100750605 Ga0068854_1007506051 142
177 3300005578 Ga0068854_102049875 Ga0068854_1020498751 142
178 3300005616 Ga0068852_100319506 Ga0068852_1003195062 142
179 3300005616 Ga0068852_100489233 Ga0068852_1004892332 142
180 3300005617 Ga0068859_100000682 Ga0068859_10000068229 142
181 3300005617 Ga0068859_101452576 Ga0068859_1014525761 142
182 3300005618 Ga0068864_100000218 Ga0068864_10000021841 142
183 3300005719 Ga0068861_100001233 Ga0068861_1000012332 142
184 3300005834 Ga0068851_10021055 Ga0068851_100210552 142
185 3300005834 Ga0068851_10022913 Ga0068851_100229133 142
186 3300005842 Ga0068858_100000352 Ga0068858_10000035231 142
187 3300006237 Ga0097621_100121999 Ga0097621_1001219992 142
188 3300006358 Ga0068871_100043237 Ga0068871_1000432372 142
189 3300006881 Ga0068865_100082347 Ga0068865_1000823474 142
190 3300006931 Ga0097620_100000682 Ga0097620_10000068229 142
191 3300006931 Ga0097620_101452660 Ga0097620_1014526601 142
192 3300009093 Ga0105240_10159458 Ga0105240_101594582 142
193 3300009148 Ga0105243_10001132 Ga0105243_1000113215 142
194 3300009148 Ga0105243_10205024 Ga0105243_102050243 142
195 3300009148 Ga0105243_10546331 Ga0105243_105463312 142
196 3300009174 Ga0105241_10025406 Ga0105241_100254064 142
197 3300009176 Ga0105242_10842927 Ga0105242_108429272 142
198 3300009177 Ga0105248_10000824 Ga0105248_1000082420 142
199 3300009177 Ga0105248_10007725 Ga0105248_100077253 142
200 3300009545 Ga0105237_10112806 Ga0105237_101128063 142
201 3300009545 Ga0105237_10181683 Ga0105237_101816832 142
202 3300009551 Ga0105238_10101907 Ga0105238_101019072 142
203 3300010375 Ga0105239_10156374 Ga0105239_101563742 142
204 3300010375 Ga0105239_10166967 Ga0105239_101669672 142
205 3300013100 Ga0157373_10857052 Ga0157373_108570521 142
206 3300013100 Ga0157373_11482274 Ga0157373_114822741 142
207 3300013102 Ga0157371_10000452 Ga0157371_1000045244 142
208 3300013102 Ga0157371_10106670 Ga0157371_101066702 142
209 3300013104 Ga0157370_10201818 Ga0157370_102018183 142
210 3300013104 Ga0157370_10620030 Ga0157370_106200302 142
211 3300013105 Ga0157369_10199690 Ga0157369_101996903 142
212 3300013105 Ga0157369_10294973 Ga0157369_102949732 142
213 3300013105 Ga0157369_11110291 Ga0157369_111102912 142
214 3300013297 Ga0157378_10047209 Ga0157378_100472092 142
215 3300013297 Ga0157378_11856412 Ga0157378_118564122 142
216 3300013306 Ga0163162_10094977 Ga0163162_100949774 142
217 3300013306 Ga0163162_10302405 Ga0163162_103024051 142
218 3300013307 Ga0157372_10121806 Ga0157372_101218062 142
219 3300013307 Ga0157372_10361685 Ga0157372_103616852 142
220 3300014325 Ga0163163_13104451 Ga0163163_131044511 142
221 3300014326 Ga0157380_10656433 Ga0157380_106564332 142
222 3300014968 Ga0157379_10042070 Ga0157379_100420703 142
223 3300015690 Ga0183363_1003 Ga0183363_1003138 142
224 3300017792 Ga0163161_10132775 Ga0163161_101327752 142
225 3300017792 Ga0163161_11286317 Ga0163161_112863172 142
226 3300025226 Ga0209674_105609 Ga0209674_1056092 142
227 3300025230 Ga0209563_100070 Ga0209563_100070167 142
228 3300025245 Ga0207425_1000005 Ga0207425_1000005902 142
229 3300025245 Ga0207425_1005496 Ga0207425_10054964 142
230 3300025253 Ga0209677_106606 Ga0209677_1066063 142
231 3300025254 Ga0209148_1000008 Ga0209148_1000008707 142
232 3300025261 Ga0209233_1010300 Ga0209233_10103003 142
233 3300025263 Ga0209565_1000029 Ga0209565_100002938 142
234 3300025263 Ga0209565_1000052 Ga0209565_1000052149 142
235 3300025263 Ga0209565_1019148 Ga0209565_10191483 142
236 3300025272 Ga0209455_1000002 Ga0209455_1000002717 142
237 3300025273 Ga0209673_1000754 Ga0209673_100075435 142
238 3300025291 Ga0209675_1016418 Ga0209675_10164182 142
239 3300025292 Ga0209676_1021738 Ga0209676_10217384 142
240 3300025294 Ga0209025_1001791 Ga0209025_100179126 142
241 3300025295 Ga0209564_1000783 Ga0209564_100078324 142
242 3300025295 Ga0209564_1015450 Ga0209564_10154503 142
243 3300025295 Ga0209564_1041407 Ga0209564_10414072 142
244 3300025297 Ga0209758_1000002 Ga0209758_1000002443 142
245 3300025297 Ga0209758_1000007 Ga0209758_1000007645 142
246 3300025297 Ga0209758_1001653 Ga0209758_100165314 142
247 3300025297 Ga0209758_1027348 Ga0209758_10273483 142
248 3300025298 Ga0209050_1000001 Ga0209050_1000001389 142
249 3300025298 Ga0209050_1000131 Ga0209050_100013195 142
250 3300025298 Ga0209050_1001214 Ga0209050_100121432 142
251 3300025298 Ga0209050_1007441 Ga0209050_10074416 142
252 3300025298 Ga0209050_1023685 Ga0209050_10236853 142
253 3300025298 Ga0209050_1027964 Ga0209050_10279643 142
254 3300025299 Ga0209256_1000008 Ga0209256_1000008647 142
255 3300025302 Ga0207426_1057715 Ga0207426_10577152 142
256 3300025303 Ga0209051_1000297 Ga0209051_100029745 142
257 3300025304 Ga0209257_1000028 Ga0209257_1000028461 142
258 3300025304 Ga0209257_1000801 Ga0209257_100080138 142
259 3300025304 Ga0209257_1018820 Ga0209257_10188203 142
260 3300025304 Ga0209257_1018821 Ga0209257_10188213 142
261 3300025321 Ga0207656_10003039 Ga0207656_100030394 142
262 3300025904 Ga0207647_10027042 Ga0207647_100270422 142
263 3300025904 Ga0207647_10209511 Ga0207647_102095112 142
264 3300025909 Ga0207705_10000512 Ga0207705_1000051213 142
265 3300025911 Ga0207654_10001799 Ga0207654_100017994 142
266 3300025913 Ga0207695_10050658 Ga0207695_100506584 142
267 3300025913 Ga0207695_10060432 Ga0207695_100604323 142
268 3300025914 Ga0207671_10031513 Ga0207671_100315134 142
269 3300025919 Ga0207657_10155420 Ga0207657_101554203 142
270 3300025919 Ga0207657_10247438 Ga0207657_102474382 142
271 3300025920 Ga0207649_10000581 Ga0207649_1000058132 142
272 3300025924 Ga0207694_10763156 Ga0207694_107631562 142
273 3300025926 Ga0207659_11245659 Ga0207659_112456592 142
274 3300025932 Ga0207690_10000666 Ga0207690_100006662 142
275 3300025932 Ga0207690_10029320 Ga0207690_100293204 142
276 3300025932 Ga0207690_10105812 Ga0207690_101058123 142
277 3300025933 Ga0207706_10047066 Ga0207706_100470664 142
278 3300025935 Ga0207709_10000005 Ga0207709_10000005390 142
279 3300025935 Ga0207709_10196209 Ga0207709_101962093 142
280 3300025935 Ga0207709_10389566 Ga0207709_103895662 142
281 3300025937 Ga0207669_10000607 Ga0207669_1000060710 142
282 3300025937 Ga0207669_10878970 Ga0207669_108789702 142
283 3300025938 Ga0207704_10137580 Ga0207704_101375802 142
284 3300025941 Ga0207711_10013055 Ga0207711_100130552 142
285 3300025941 Ga0207711_10328448 Ga0207711_103284482 142
286 3300025944 Ga0207661_10134147 Ga0207661_101341471 142
287 3300025945 Ga0207679_10260740 Ga0207679_102607403 142
288 3300025949 Ga0207667_10000001 Ga0207667_10000001917 142
289 3300025949 Ga0207667_10090135 Ga0207667_100901354 142
290 3300025960 Ga0207651_11242778 Ga0207651_112427782 142
291 3300025972 Ga0207668_10493352 Ga0207668_104933522 142
292 3300025981 Ga0207640_10003976 Ga0207640_100039762 142
293 3300025981 Ga0207640_10023159 Ga0207640_100231594 142
294 3300025981 Ga0207640_10065785 Ga0207640_100657851 142
295 3300025986 Ga0207658_10139584 Ga0207658_101395843 142
296 3300026041 Ga0207639_10007166 Ga0207639_100071664 142
297 3300026067 Ga0207678_10014108 Ga0207678_100141087 142
298 3300026067 Ga0207678_10162048 Ga0207678_101620483 142
299 3300026078 Ga0207702_10009429 Ga0207702_100094294 142
300 3300026089 Ga0207648_10087828 Ga0207648_100878282 142
301 3300026095 Ga0207676_10000169 Ga0207676_1000016941 142
302 3300026095 Ga0207676_10845413 Ga0207676_108454131 142
303 3300026116 Ga0207674_10195341 Ga0207674_101953412 142
304 3300026116 Ga0207674_11713350 Ga0207674_117133501 142
305 3300026118 Ga0207675_100000077 Ga0207675_10000007752 142
306 3300026121 Ga0207683_10002829 Ga0207683_1000282910 142
307 3300026121 Ga0207683_10417523 Ga0207683_104175232 142
308 3300026142 Ga0207698_10046963 Ga0207698_100469634 142
309 3300028379 Ga0268266_10000002 Ga0268266_10000002506 142
310 3300028786 Ga0307517_10020599 Ga0307517_100205996 142
311 3300028786 Ga0307517_10064728 Ga0307517_100647282 142
312 3300028786 Ga0307517_10093351 Ga0307517_100933513 142
313 3300031456 Ga0307513_10011763 Ga0307513_100117633 142
314 3300031456 Ga0307513_10012633 Ga0307513_100126337 142
315 3300031824 Ga0307413_11347478 Ga0307413_113474781 142
316 3300031911 Ga0307412_10268733 Ga0307412_102687333 142
317 3300031995 Ga0307409_101523831 Ga0307409_1015238312 142
318 3300033180 Ga0307510_10000535 Ga0307510_1000053515 142
319 3300033180 Ga0307510_10322422 Ga0307510_103224222 142
320 3300037471 Ga0395905_0433764 Ga0395905_0433764_275_703 142
321 3300037471 Ga0395905_0603114 Ga0395905_0603114_546_974 142
322 3300041404 Ga0439436_0004924 Ga0439436_0004924_1606_2034 142
323 3300041404 Ga0439436_0021710 Ga0439436_0021710_1088_1516 142
324 3300041410 Ga0439461_0000494 Ga0439461_0000494_4755_5183 142
325 3300041410 Ga0439461_0009648 Ga0439461_0009648_594_1022 142
326 3300041411 Ga0439466_0174820 Ga0439466_0174820_169_597 142
327 3300041413 Ga0439465_0003876 Ga0439465_0003876_871_1299 142
328 3300041413 Ga0439465_0007136 Ga0439465_0007136_201_629 142
329 3300041441 Ga0451787_688902 Ga0451787_688902_263_691 142
330 3300041452 Ga0451793_1479815 Ga0451793_1479815_180_608 142
331 3300041452 Ga0451793_1907358 Ga0451793_1907358_60_488 142
332 3300041491 Ga0451833_0200970 Ga0451833_0200970_138_566 142
333 3300041511 Ga0451855_1658094 Ga0451855_1658094_260_688 142
334 3300041512 Ga0451853_1252397 Ga0451853_1252397_103_531 142
335 3300041997 Ga0439431_0007681 Ga0439431_0007681_1865_2293 142
336 3300041997 Ga0439431_0059390 Ga0439431_0059390_27_455 142
337 3300041997 Ga0439431_0179081 Ga0439431_0179081_154_582 142
338 3300042002 Ga0439442_000994 Ga0439442_000994_409_837 142
339 3300042004 Ga0439445_0001563 Ga0439445_0001563_3913_4341 142
340 3300042004 Ga0439445_0069498 Ga0439445_0069498_518_946 142
341 3300042006 Ga0439432_000286 Ga0439432_000286_6825_7253 142
342 3300042007 Ga0439449_0023480 Ga0439449_0023480_273_701 142
343 3300042010 Ga0439452_008215 Ga0439452_008215_2054_2482 142
344 3300042015 Ga0439462_0000295 Ga0439462_0000295_3583_4011 142
345 3300042015 Ga0439462_0006929 Ga0439462_0006929_1861_2289 142
346 3300042156 Ga0439446_0025535 Ga0439446_0025535_779_1207 142
347 3300042156 Ga0439446_0058046 Ga0439446_0058046_676_1104 142
348 3300042435 Ga0439434_0019262 Ga0439434_0019262_1225_1653 142
349 3300042435 Ga0439434_0022966 Ga0439434_0022966_777_1205 142
350 3300046453 Ga0495627_015112 Ga0495627_015112_850_1278 142
351 3300046457 Ga0495590_0108462 Ga0495590_0108462_367_795 142
352 3300046460 Ga0495638_0062533 Ga0495638_0062533_1762_2199 142
353 3300046460 Ga0495638_0179226 Ga0495638_0179226_327_755 142
354 3300046460 Ga0495638_0216801 Ga0495638_0216801_87_515 142
355 3300046460 Ga0495638_0339179 Ga0495638_0339179_351_779 142
356 3300046471 Ga0495650_0000364 Ga0495650_0000364_74159_74665 142
357 3300046471 Ga0495650_0096857 Ga0495650_0096857_613_1041 142
358 3300046491 Ga0495584_0104337 Ga0495584_0104337_631_1059 142
359 3300046492 Ga0495585_0002083 Ga0495585_0002083_3218_3646 142
360 3300046492 Ga0495585_0089949 Ga0495585_0089949_858_1286 142
361 3300046492 Ga0495585_0309928 Ga0495585_0309928_25_453 142
362 3300046500 Ga0495596_0010949 Ga0495596_0010949_400_828 142
363 3300046501 Ga0495607_0004446 Ga0495607_0004446_6052_6480 142
364 3300046501 Ga0495607_0069546 Ga0495607_0069546_793_1221 142
365 3300046506 Ga0495583_0000311 Ga0495583_0000311_12923_13351 142
366 3300046506 Ga0495583_0002358 Ga0495583_0002358_11866_12294 142
367 3300046506 Ga0495583_0004958 Ga0495583_0004958_8280_8717 142
368 3300046506 Ga0495583_0019657 Ga0495583_0019657_993_1421 142
369 3300046506 Ga0495583_0032927 Ga0495583_0032927_1430_1858 142
370 3300046506 Ga0495583_0085345 Ga0495583_0085345_853_1281 142
371 3300046507 Ga0495606_0007432 Ga0495606_0007432_8359_8787 142
372 3300046507 Ga0495606_0130650 Ga0495606_0130650_210_638 142
373 3300046518 Ga0495631_0046391 Ga0495631_0046391_756_1184 142
374 3300046518 Ga0495631_0125300 Ga0495631_0125300_526_954 142
375 3300046519 Ga0495632_0064791 Ga0495632_0064791_450_878 142
376 3300046520 Ga0495637_0239056 Ga0495637_0239056_31_459 142
377 3300046522 Ga0495643_0002504 Ga0495643_0002504_9497_9925 142
378 3300046522 Ga0495643_0006895 Ga0495643_0006895_1856_2284 142
379 3300046522 Ga0495643_0021584 Ga0495643_0021584_1016_1444 142
380 3300046524 Ga0495648_0002467 Ga0495648_0002467_12209_12637 142
381 3300046524 Ga0495648_0081074 Ga0495648_0081074_880_1308 142
382 3300046524 Ga0495648_0136988 Ga0495648_0136988_754_1188 142
383 3300046525 Ga0495663_0007585 Ga0495663_0007585_1545_1973 142
384 3300046528 Ga0495642_0010068 Ga0495642_0010068_2351_2779 142
385 3300046536 Ga0495587_0091468 Ga0495587_0091468_934_1362 142
386 3300046542 Ga0495597_0021751 Ga0495597_0021751_785_1213 142
387 3300046558 Ga0495633_0000538 Ga0495633_0000538_27428_27856 142
388 3300046558 Ga0495633_0214185 Ga0495633_0214185_186_614 142
389 3300046616 Ga0495668_0000468 Ga0495668_0000468_12139_12567 142
390 3300046616 Ga0495668_0052903 Ga0495668_0052903_1576_2013 142
391 3300046616 Ga0495668_0117262 Ga0495668_0117262_237_665 142
392 3300046648 Ga0495611_0078787 Ga0495611_0078787_115_621 142
393 3300046648 Ga0495611_0127920 Ga0495611_0127920_189_617 142
394 3300046648 Ga0495611_0140317 Ga0495611_0140317_549_977 142
395 3300046660 Ga0495625_0002092 Ga0495625_0002092_9208_9636 142
396 3300046660 Ga0495625_0004408 Ga0495625_0004408_10039_10476 142
397 3300046660 Ga0495625_0013920 Ga0495625_0013920_4649_5077 142
398 3300046660 Ga0495625_0069936 Ga0495625_0069936_2004_2432 142
399 3300046660 Ga0495625_0087752 Ga0495625_0087752_1121_1549 142
400 3300046660 Ga0495625_0103986 Ga0495625_0103986_607_1035 142
401 3300046660 Ga0495625_0382443 Ga0495625_0382443_304_732 142
402 3300046660 Ga0495625_0391707 Ga0495625_0391707_29_457 142
403 3300046660 Ga0495625_0505788 Ga0495625_0505788_62_499 142
404 3300046660 Ga0495625_0568627 Ga0495625_0568627_241_669 142
405 3300046664 Ga0495659_0134409 Ga0495659_0134409_391_819 142
406 3300046665 Ga0495661_0366057 Ga0495661_0366057_143_571 142
407 3300046684 Ga0495669_0000118 Ga0495669_0000118_38184_38612 142
408 3300046691 Ga0495670_0000016 Ga0495670_0000016_19255_19704 142
409 3300046691 Ga0495670_0094286 Ga0495670_0094286_408_836 142
410 3300046691 Ga0495670_0194123 Ga0495670_0194123_392_820 142
411 3300046694 Ga0495649_0281752 Ga0495649_0281752_344_772 142
412 3300046809 Ga0495600_0095013 Ga0495600_0095013_705_1133 142
413 3300046810 Ga0495660_0036323 Ga0495660_0036323_1355_1783 142
414 3300046810 Ga0495660_0251114 Ga0495660_0251114_129_557 142
415 3300047323 Ga0495683_0002062 Ga0495683_0002062_9984_10412 142
416 3300047323 Ga0495683_0073643 Ga0495683_0073643_764_1192 142
417 3300047443 Ga0495687_000436 Ga0495687_000436_9030_9458 142
418 3300047443 Ga0495687_000499 Ga0495687_000499_35873_36301 142
419 3300047445 Ga0495677_0008604 Ga0495677_0008604_2222_2650 142
420 3300047445 Ga0495677_0086351 Ga0495677_0086351_117_554 142
421 3300047469 Ga0495673_0090418 Ga0495673_0090418_512_940 142
422 3300047470 Ga0495681_0020245 Ga0495681_0020245_3136_3564 142
423 3300047470 Ga0495681_0067416 Ga0495681_0067416_794_1222 142
424 3300047470 Ga0495681_0070647 Ga0495681_0070647_679_1107 142
425 3300047472 Ga0495686_0000770 Ga0495686_0000770_15913_16344 142
426 3300047472 Ga0495686_0194132 Ga0495686_0194132_543_971 142
427 3300048090 Ga0495615_0262377 Ga0495615_0262377_83_511 142
428 3300048903 Ga0496100_0431225 Ga0496100_0431225_277_708 142
429 3300048905 Ga0496102_0000022 Ga0496102_0000022_10133_10561 142
430 3300048905 Ga0496102_0225611 Ga0496102_0225611_230_661 142
431 3300048906 Ga0496103_0000075 Ga0496103_0000075_10377_10805 142
432 3300048907 Ga0496104_0008397 Ga0496104_0008397_1243_1671 142
433 3300048908 Ga0496105_0007696 Ga0496105_0007696_3075_3503 142
434 3300048909 Ga0496106_0666866 Ga0496106_0666866_83_511 142
435 3300048910 Ga0496107_0185331 Ga0496107_0185331_448_876 142
436 3300048911 Ga0496108_1192481 Ga0496108_1192481_43_471 142
437 3300048913 Ga0496110_0004080 Ga0496110_0004080_4358_4786 142
438 3300048914 Ga0496111_0012054 Ga0496111_0012054_3392_3820 142
439 3300048917 Ga0496114_0015131 Ga0496114_0015131_4876_5304 142
440 3300048918 Ga0496115_0000384 Ga0496115_0000384_4919_5347 142
441 3300048918 Ga0496115_0002587 Ga0496115_0002587_2455_2886 142
442 3300048919 Ga0496116_0004132 Ga0496116_0004132_4925_5353 142
443 3300048919 Ga0496116_0109146 Ga0496116_0109146_744_1178 142
444 3300048920 Ga0496117_0000439 Ga0496117_0000439_66751_67179 142
445 3300048921 Ga0496118_0000039 Ga0496118_0000039_101032_101460 142
446 3300048922 Ga0496119_0032028 Ga0496119_0032028_970_1398 142
447 3300048923 Ga0496120_0026163 Ga0496120_0026163_1291_1719 142
448 3300048924 Ga0496121_0000123 Ga0496121_0000123_115726_116157 142
449 3300048924 Ga0496121_0000269 Ga0496121_0000269_4923_5351 142
450 3300048925 Ga0496122_0026436 Ga0496122_0026436_3500_3928 142
451 3300048925 Ga0496122_0434458 Ga0496122_0434458_71_505 142
452 3300048926 Ga0496123_0042135 Ga0496123_0042135_444_872 142
453 3300048926 Ga0496123_0211888 Ga0496123_0211888_164_598 142
454 3300048927 Ga0496124_0000076 Ga0496124_0000076_204908_205336 142
455 3300048928 Ga0496125_0021645 Ga0496125_0021645_3250_3678 142
456 3300048928 Ga0496125_0102259 Ga0496125_0102259_1619_2047 142
457 3300048929 Ga0496126_0001584 Ga0496126_0001584_29359_29787 142
458 3300049760 Ga0501263_044485 Ga0501263_044485_55_486 142
459 3300050493 nmdc:mga0k408_96648_c1 nmdc:mga0k408_96648_c1_313_741 142
460 3300053079 Ga0500610_0000255 Ga0500610_0000255_11137_11565 142
461 3300053079 Ga0500610_0440273 Ga0500610_0440273_51_479 142
462 3300053087 Ga0500643_002602 Ga0500643_002602_2207_2644 142
463 3300053087 Ga0500643_008252 Ga0500643_008252_2020_2448 142
464 3300053094 Ga0500566_0017677 Ga0500566_0017677_1535_1966 142
465 3300053096 Ga0500641_0003136 Ga0500641_0003136_416_850 142
466 3300053108 Ga0500562_039021 Ga0500562_039021_113_541 142
467 3300053119 Ga0500595_001071 Ga0500595_001071_10223_10651 142
468 3300053119 Ga0500595_007007 Ga0500595_007007_456_884 142
469 3300053119 Ga0500595_027923 Ga0500595_027923_1419_1850 142
470 3300053130 Ga0500642_0015946 Ga0500642_0015946_509_937 142
471 3300053131 Ga0500652_062903 Ga0500652_062903_1040_1477 142
472 3300053131 Ga0500652_295239 Ga0500652_295239_30_458 142
473 3300053134 Ga0500658_0009230 Ga0500658_0009230_2796_3224 142
474 3300053136 Ga0500559_0216852 Ga0500559_0216852_213_641 142
475 3300053139 Ga0500568_0017469 Ga0500568_0017469_1204_1632 142
476 3300053146 Ga0500588_0261558 Ga0500588_0261558_80_511 142
477 3300053151 Ga0500604_0062250 Ga0500604_0062250_126_554 142
478 3300053154 Ga0500619_113790 Ga0500619_113790_294_722 142
479 3300053156 Ga0500622_0226961 Ga0500622_0226961_118_546 142
480 3300053177 Ga0500636_0004237 Ga0500636_0004237_4670_5098 142
481 3300053730 Ga0500645_000003 Ga0500645_000003_9948_10376 142
482 3300053730 Ga0500645_000924 Ga0500645_000924_6703_7134 142
483 3300053735 Ga0500596_000783 Ga0500596_000783_4758_5186 142
484 3300055283 Ga0500661_033171 Ga0500661_033171_435_863 142

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04273

BLH_phosphatase

Beta-lactamase hydrolase-like protein, phosphatase-like domain

26

135

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2f46-assembly2.cif.gz_B crystal structure of a putative phosphatase (nma1982) from neisseria meningitidis z2491 at 1.41 a resolution 0.8502 2 138
2i6i-assembly1.cif.gz_A crystal structures of the archaeal sulfolobus ptp-fold phosphatase 0.8008 3 140
3f81-assembly1.cif.gz_A interaction of vhr with sa3 0.7843 2 141
4kyq-assembly1.cif.gz_A structure of a product bound plant phosphatase 0.783 1 135
2i6i-assembly1.cif.gz_A crystal structures of the archaeal sulfolobus ptp-fold phosphatase 0.7764 3 140
ID Description Score Start End Superfamily
2f46B00 Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Protein tyrosine phosphatase superfamily 0.8462 1 138 3.90.190.10
2f46B00 Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Protein tyrosine phosphatase superfamily 0.825 1 138 3.90.190.10
2dxpA00 Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Protein tyrosine phosphatase superfamily 0.8107 7 141 3.90.190.10
af_Q9UAX0_81_234_3.90.190.10 Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Protein tyrosine phosphatase superfamily 0.7914 11 139 3.90.190.10
af_A0A0R4IVA4_191_359_3.90.190.10 Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Protein tyrosine phosphatase superfamily 0.7881 2 140 3.90.190.10
ID Description Score Start End GO Terms
AF-A0A1V2ETE1-F1-model_v4 Beta-lactamase hydrolase-like protein (EC 3.-.-.-) 0.9936 2 139 GO:0016787
AF-A0A1S1H8K8-F1-model_v4 Beta-lactamase hydrolase-like protein (EC 3.-.-.-) 0.9916 1 134 GO:0016787
AF-A0A3D2LKG1-F1-model_v4 deleted 0.9889 1 106
AF-A0A520HMF0-F1-model_v4 TIGR01244 family phosphatase 0.9888 1 124 GO:0016787
AF-A0A4R0PIV2-F1-model_v4 TIGR01244 family phosphatase 0.9863 2 106 GO:0016787

Feature Viewer

pLDDT pTM Quality
96.81 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map