F452909
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 484 | 268 | 483 | 140 |
Family's Representative Sequence
| Representative Sequence | 3300006844|Ga0075428_100365174|Ga0075428_1003651742 |
| Length | 152 |
| Sequence | MPEEDGVSQTKPRRRPDGEVISQRAAEAVGPYPHARRAGSLLFVSGIGPRKRGTKEIPGATLDSQGKVVSYDIDAQCRSVFENLRYILEDAGTSWDKIVDVTAFLTNMDDFAAYNKVYAEHFPDNRPARTTVEVNRLPTPIAVELKVIATLD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2671180531 | Gemmata sp. SH-PL17 | Isolate | Unclassified |
| 2 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 5 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 6 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 7 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 8 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 9 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 10 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 11 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 20 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 23 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 36 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 50 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 54 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 62 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 64 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 65 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 66 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 68 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 69 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 70 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 71 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 72 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 73 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 74 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 75 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 76 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 77 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 78 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 79 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 80 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 81 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 82 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 84 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 85 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 86 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 87 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 88 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 90 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 115 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 182 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 183 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 184 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 185 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 186 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 187 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 188 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 189 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 190 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 191 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 192 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 193 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 194 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 195 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 196 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 197 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 198 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 199 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 200 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 201 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 202 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 203 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 204 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 205 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 206 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 207 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 208 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 209 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 210 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 211 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 212 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 213 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 214 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 215 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 216 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 217 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 218 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 219 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 220 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 221 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 222 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 223 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 224 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 242 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 243 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 244 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 245 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 246 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 247 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 248 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 249 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 250 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 251 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 252 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 253 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 254 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 255 | 3300049672 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought | Metagenome | Rhizosphere |
| 256 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 257 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 258 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 259 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 260 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 261 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 262 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 263 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 264 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 265 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 266 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 267 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.79 |
| Metatranscriptomes | 0 |
| Isolates | 0.21 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 3.31 |
| Rhizosphere | 95.66 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.03 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24747J21853_1001606 | 3300001978 | Bacteria | 1724 |
| 2 | JGI24739J22299_10083034 | 3300001989 | Bacteria | 982 |
| 3 | JGI24737J22298_10014448 | 3300001990 | Bacteria | 2563 |
| 4 | JGI24748J21848_1000717 | 3300002074 | Bacteria | 3581 |
| 5 | JGI24749J21850_1001969 | 3300002076 | Bacteria | 2899 |
| 6 | JGI24744J21845_10011636 | 3300002077 | Bacteria | 1797 |
| 7 | JGI24034J26672_10000720 | 3300002239 | Bacteria | 4257 |
| 8 | JGI25404J52841_10004682 | 3300003659 | Bacteria | 2789 |
| 9 | Ga0065712_10141030 | 3300005290 | Bacteria | 1450 |
| 10 | Ga0065715_10162607 | 3300005293 | Bacteria | 1615 |
| 11 | Ga0065707_10173559 | 3300005295 | Bacteria | 1467 |
| 12 | Ga0070658_10001254 | 3300005327 | Bacteria | 21751 |
| 13 | Ga0070658_10111228 | 3300005327 | Bacteria | 2270 |
| 14 | Ga0070676_10003356 | 3300005328 | Bacteria | 8331 |
| 15 | Ga0070676_10023647 | 3300005328 | Bacteria | 3455 |
| 16 | Ga0070683_100001622 | 3300005329 | Bacteria | 17399 |
| 17 | Ga0070683_100191096 | 3300005329 | Bacteria | 1944 |
| 18 | Ga0070690_100000327 | 3300005330 | Bacteria | 24351 |
| 19 | Ga0070670_100013423 | 3300005331 | Bacteria | 7016 |
| 20 | Ga0070670_100823608 | 3300005331 | Unclassified | 839 |
| 21 | Ga0070670_101511527 | 3300005331 | Bacteria | 617 |
| 22 | Ga0070677_10000209 | 3300005333 | Bacteria | 20187 |
| 23 | Ga0070677_10004018 | 3300005333 | Unclassified | 4777 |
| 24 | Ga0068869_100000286 | 3300005334 | Bacteria | 26923 |
| 25 | Ga0068869_100783364 | 3300005334 | Bacteria | 818 |
| 26 | Ga0070666_10000805 | 3300005335 | Bacteria | 19067 |
| 27 | Ga0070680_100002873 | 3300005336 | Bacteria | 12792 |
| 28 | Ga0070680_101118957 | 3300005336 | Bacteria | 681 |
| 29 | Ga0068868_100000557 | 3300005338 | Bacteria | 24976 |
| 30 | Ga0068868_100002964 | 3300005338 | Bacteria | 11784 |
| 31 | Ga0068868_100654478 | 3300005338 | Unclassified | 936 |
| 32 | Ga0070660_100000479 | 3300005339 | Bacteria | 26732 |
| 33 | Ga0070660_101111525 | 3300005339 | Unclassified | 669 |
| 34 | Ga0070689_100000344 | 3300005340 | Bacteria | 27203 |
| 35 | Ga0070689_100061892 | 3300005340 | Bacteria | 2911 |
| 36 | Ga0070689_100394678 | 3300005340 | Bacteria | 1168 |
| 37 | Ga0070691_10043824 | 3300005341 | Bacteria | 2120 |
| 38 | Ga0070687_100000032 | 3300005343 | Bacteria | 43649 |
| 39 | Ga0070661_100000412 | 3300005344 | Bacteria | 33114 |
| 40 | Ga0070661_100001964 | 3300005344 | Bacteria | 14204 |
| 41 | Ga0070661_100537879 | 3300005344 | Bacteria | 939 |
| 42 | Ga0070661_100756225 | 3300005344 | Bacteria | 795 |
| 43 | Ga0070692_10013772 | 3300005345 | Bacteria | 3780 |
| 44 | Ga0070668_100000345 | 3300005347 | Bacteria | 30655 |
| 45 | Ga0070669_100000307 | 3300005353 | Bacteria | 38485 |
| 46 | Ga0070675_100001155 | 3300005354 | Bacteria | 19067 |
| 47 | Ga0070675_100003395 | 3300005354 | Bacteria | 12063 |
| 48 | Ga0070671_100003430 | 3300005355 | Bacteria | 12374 |
| 49 | Ga0070671_100014228 | 3300005355 | Bacteria | 6425 |
| 50 | Ga0070674_100000600 | 3300005356 | Bacteria | 18217 |
| 51 | Ga0070673_100001765 | 3300005364 | Bacteria | 12883 |
| 52 | Ga0070673_100130339 | 3300005364 | Bacteria | 2109 |
| 53 | Ga0070673_100370496 | 3300005364 | Bacteria | 1275 |
| 54 | Ga0070688_100000122 | 3300005365 | Bacteria | 41175 |
| 55 | Ga0070688_100006427 | 3300005365 | Bacteria | 6282 |
| 56 | Ga0070659_100000635 | 3300005366 | Bacteria | 25714 |
| 57 | Ga0070667_100008888 | 3300005367 | Bacteria | 8315 |
| 58 | Ga0070667_100064873 | 3300005367 | Bacteria | 3099 |
| 59 | Ga0070667_100669535 | 3300005367 | Bacteria | 959 |
| 60 | Ga0070714_100001058 | 3300005435 | Bacteria | 19666 |
| 61 | Ga0070714_100367459 | 3300005435 | Bacteria | 1354 |
| 62 | Ga0070713_100333705 | 3300005436 | Bacteria | 1403 |
| 63 | Ga0070701_10013876 | 3300005438 | Bacteria | 3677 |
| 64 | Ga0070711_100213767 | 3300005439 | Bacteria | 1495 |
| 65 | Ga0070705_100000279 | 3300005440 | Bacteria | 30554 |
| 66 | Ga0070705_100195785 | 3300005440 | Bacteria | 1381 |
| 67 | Ga0070700_100271301 | 3300005441 | Unclassified | 1226 |
| 68 | Ga0070694_100026838 | 3300005444 | Bacteria | 3736 |
| 69 | Ga0070694_100295778 | 3300005444 | Bacteria | 1239 |
| 70 | Ga0070663_100000597 | 3300005455 | Bacteria | 19230 |
| 71 | Ga0070663_101234806 | 3300005455 | Bacteria | 658 |
| 72 | Ga0070678_100002705 | 3300005456 | Bacteria | 9783 |
| 73 | Ga0070678_100070930 | 3300005456 | Bacteria | 2607 |
| 74 | Ga0070678_100110605 | 3300005456 | Bacteria | 2149 |
| 75 | Ga0070678_100143443 | 3300005456 | Bacteria | 1914 |
| 76 | Ga0070662_100000190 | 3300005457 | Bacteria | 35766 |
| 77 | Ga0070662_100366060 | 3300005457 | Unclassified | 1184 |
| 78 | Ga0070662_100897507 | 3300005457 | Bacteria | 756 |
| 79 | Ga0070681_10033955 | 3300005458 | Bacteria | 5122 |
| 80 | Ga0070681_10395984 | 3300005458 | Bacteria | 1292 |
| 81 | Ga0068867_100003036 | 3300005459 | Bacteria | 11838 |
| 82 | Ga0068867_100702639 | 3300005459 | Bacteria | 892 |
| 83 | Ga0070685_10000369 | 3300005466 | Bacteria | 27325 |
| 84 | Ga0070685_10003127 | 3300005466 | Bacteria | 8418 |
| 85 | Ga0070685_10110872 | 3300005466 | Bacteria | 1689 |
| 86 | Ga0070679_100525456 | 3300005530 | Bacteria | 1127 |
| 87 | Ga0070684_100014406 | 3300005535 | Bacteria | 6407 |
| 88 | Ga0070684_100115556 | 3300005535 | Bacteria | 2410 |
| 89 | Ga0070684_100117499 | 3300005535 | Bacteria | 2390 |
| 90 | Ga0068853_100000259 | 3300005539 | Bacteria | 37244 |
| 91 | Ga0068853_100020356 | 3300005539 | Bacteria | 5517 |
| 92 | Ga0068853_100020783 | 3300005539 | Bacteria | 5462 |
| 93 | Ga0070672_100000406 | 3300005543 | Bacteria | 24976 |
| 94 | Ga0070672_100254736 | 3300005543 | Bacteria | 1479 |
| 95 | Ga0070672_100608040 | 3300005543 | Bacteria | 953 |
| 96 | Ga0070686_100000081 | 3300005544 | Bacteria | 69623 |
| 97 | Ga0070686_100192419 | 3300005544 | Unclassified | 1457 |
| 98 | Ga0070695_100221738 | 3300005545 | Bacteria | 1363 |
| 99 | Ga0070695_100275547 | 3300005545 | Bacteria | 1234 |
| 100 | Ga0070696_100523859 | 3300005546 | Bacteria | 946 |
| 101 | Ga0070693_100010235 | 3300005547 | Bacteria | 4692 |
| 102 | Ga0070665_100010946 | 3300005548 | Bacteria | 9174 |
| 103 | Ga0070704_100039510 | 3300005549 | Bacteria | 3240 |
| 104 | Ga0070704_101784141 | 3300005549 | Unclassified | 569 |
| 105 | Ga0068855_100001159 | 3300005563 | Bacteria | 32670 |
| 106 | Ga0068855_100218694 | 3300005563 | Bacteria | 2137 |
| 107 | Ga0070664_100001026 | 3300005564 | Bacteria | 21934 |
| 108 | Ga0070664_100001532 | 3300005564 | Bacteria | 18458 |
| 109 | Ga0070664_100081494 | 3300005564 | Bacteria | 2789 |
| 110 | Ga0070664_100081850 | 3300005564 | Bacteria | 2783 |
| 111 | Ga0070664_100147350 | 3300005564 | Bacteria | 2076 |
| 112 | Ga0070664_100161764 | 3300005564 | Bacteria | 1981 |
| 113 | Ga0070664_100211844 | 3300005564 | Bacteria | 1732 |
| 114 | Ga0070664_100818572 | 3300005564 | Unclassified | 871 |
| 115 | Ga0068857_100001061 | 3300005577 | Bacteria | 21266 |
| 116 | Ga0068857_100002895 | 3300005577 | Bacteria | 14124 |
| 117 | Ga0068857_100003310 | 3300005577 | Bacteria | 13395 |
| 118 | Ga0068854_100000223 | 3300005578 | Bacteria | 38461 |
| 119 | Ga0068854_100198645 | 3300005578 | Bacteria | 1575 |
| 120 | Ga0068854_100410763 | 3300005578 | Bacteria | 1122 |
| 121 | Ga0068854_100414154 | 3300005578 | Bacteria | 1118 |
| 122 | Ga0068856_100005028 | 3300005614 | Bacteria | 13094 |
| 123 | Ga0070702_100000849 | 3300005615 | Bacteria | 11781 |
| 124 | Ga0070702_100037042 | 3300005615 | Bacteria | 2707 |
| 125 | Ga0068852_100000420 | 3300005616 | Bacteria | 28321 |
| 126 | Ga0068859_100006848 | 3300005617 | Bacteria | 11576 |
| 127 | Ga0068859_100010357 | 3300005617 | Bacteria | 9379 |
| 128 | Ga0068859_101316544 | 3300005617 | Bacteria | 796 |
| 129 | Ga0068864_100004095 | 3300005618 | Bacteria | 11973 |
| 130 | Ga0068864_100543608 | 3300005618 | Bacteria | 1122 |
| 131 | Ga0068864_100657632 | 3300005618 | Unclassified | 1021 |
| 132 | Ga0068866_10000018 | 3300005718 | Bacteria | 65387 |
| 133 | Ga0068861_100000738 | 3300005719 | Bacteria | 19593 |
| 134 | Ga0068861_100507398 | 3300005719 | Bacteria | 1091 |
| 135 | Ga0068861_101015914 | 3300005719 | Bacteria | 792 |
| 136 | Ga0068851_10000206 | 3300005834 | Bacteria | 28472 |
| 137 | Ga0068870_10000033 | 3300005840 | Bacteria | 44161 |
| 138 | Ga0068863_100000937 | 3300005841 | Bacteria | 29293 |
| 139 | Ga0068863_100197632 | 3300005841 | Bacteria | 1933 |
| 140 | Ga0068863_100970094 | 3300005841 | Unclassified | 852 |
| 141 | Ga0068858_100009300 | 3300005842 | Bacteria | 9379 |
| 142 | Ga0068858_100535078 | 3300005842 | Bacteria | 1134 |
| 143 | Ga0068860_100002378 | 3300005843 | Bacteria | 19763 |
| 144 | Ga0068860_101926977 | 3300005843 | Unclassified | 612 |
| 145 | Ga0068862_100000659 | 3300005844 | Bacteria | 35380 |
| 146 | Ga0081455_10250594 | 3300005937 | Bacteria | 1295 |
| 147 | Ga0081540_1000141 | 3300005983 | Bacteria | 75070 |
| 148 | Ga0081540_1000258 | 3300005983 | Bacteria | 55927 |
| 149 | Ga0081540_1003160 | 3300005983 | Bacteria | 13144 |
| 150 | Ga0070716_100062423 | 3300006173 | Bacteria | 2160 |
| 151 | Ga0070712_100675148 | 3300006175 | Bacteria | 879 |
| 152 | Ga0097621_100000812 | 3300006237 | Bacteria | 22030 |
| 153 | Ga0097621_100030223 | 3300006237 | Bacteria | 4286 |
| 154 | Ga0097621_100072090 | 3300006237 | Bacteria | 2857 |
| 155 | Ga0068871_100000098 | 3300006358 | Bacteria | 51943 |
| 156 | Ga0068871_100135927 | 3300006358 | Bacteria | 2088 |
| 157 | Ga0068871_100739222 | 3300006358 | Bacteria | 904 |
| 158 | Ga0075428_100104825 | 3300006844 | Bacteria | 3084 |
| 159 | Ga0075428_100132211 | 3300006844 | Bacteria | 2714 |
| 160 | Ga0075428_100365174 | 3300006844 | Bacteria | 1548 |
| 161 | Ga0075428_102410331 | 3300006844 | Bacteria | 540 |
| 162 | Ga0075430_100042980 | 3300006846 | Bacteria | 3821 |
| 163 | Ga0075430_100658664 | 3300006846 | Bacteria | 863 |
| 164 | Ga0075431_100082748 | 3300006847 | Bacteria | 3314 |
| 165 | Ga0075431_100111246 | 3300006847 | Bacteria | 2827 |
| 166 | Ga0068865_100000442 | 3300006881 | Bacteria | 23069 |
| 167 | Ga0068865_100002265 | 3300006881 | Bacteria | 11321 |
| 168 | Ga0068865_100600064 | 3300006881 | Bacteria | 930 |
| 169 | Ga0097620_100006848 | 3300006931 | Bacteria | 11576 |
| 170 | Ga0097620_100010356 | 3300006931 | Bacteria | 9379 |
| 171 | Ga0097620_101316710 | 3300006931 | Bacteria | 796 |
| 172 | Ga0075435_100172002 | 3300007076 | Bacteria | 1828 |
| 173 | Ga0105251_10403807 | 3300009011 | Bacteria | 628 |
| 174 | Ga0111539_10067497 | 3300009094 | Bacteria | 4223 |
| 175 | Ga0111539_10486995 | 3300009094 | Bacteria | 1437 |
| 176 | Ga0111539_10734943 | 3300009094 | Bacteria | 1149 |
| 177 | Ga0105247_10001005 | 3300009101 | Bacteria | 21321 |
| 178 | Ga0105247_10150749 | 3300009101 | Unclassified | 1532 |
| 179 | Ga0105243_10876152 | 3300009148 | Bacteria | 891 |
| 180 | Ga0105241_10063266 | 3300009174 | Bacteria | 2854 |
| 181 | Ga0105241_11443901 | 3300009174 | Bacteria | 660 |
| 182 | Ga0105242_10013836 | 3300009176 | Bacteria | 6245 |
| 183 | Ga0105242_10078050 | 3300009176 | Bacteria | 2764 |
| 184 | Ga0105248_11661553 | 3300009177 | Unclassified | 724 |
| 185 | Ga0105249_10187736 | 3300009553 | Unclassified | 2015 |
| 186 | Ga0105239_10130361 | 3300010375 | Bacteria | 2796 |
| 187 | Ga0157373_11297372 | 3300013100 | Bacteria | 551 |
| 188 | Ga0157371_10306352 | 3300013102 | Bacteria | 1150 |
| 189 | Ga0157370_10552174 | 3300013104 | Bacteria | 1056 |
| 190 | Ga0157370_11787658 | 3300013104 | Unclassified | 552 |
| 191 | Ga0157369_10039346 | 3300013105 | Bacteria | 5168 |
| 192 | Ga0157374_10042545 | 3300013296 | Bacteria | 4190 |
| 193 | Ga0157378_10038348 | 3300013297 | Bacteria | 4246 |
| 194 | Ga0157378_10676549 | 3300013297 | Bacteria | 1050 |
| 195 | Ga0163162_10015627 | 3300013306 | Bacteria | 7418 |
| 196 | Ga0163162_10443316 | 3300013306 | Bacteria | 1431 |
| 197 | Ga0157372_10052414 | 3300013307 | Bacteria | 4543 |
| 198 | Ga0157372_10953665 | 3300013307 | Bacteria | 994 |
| 199 | Ga0157372_11214980 | 3300013307 | Bacteria | 871 |
| 200 | Ga0157375_10038134 | 3300013308 | Bacteria | 4611 |
| 201 | Ga0157375_10822580 | 3300013308 | Unclassified | 1077 |
| 202 | Ga0157375_11405627 | 3300013308 | Bacteria | 822 |
| 203 | Ga0163163_10010007 | 3300014325 | Bacteria | 8503 |
| 204 | Ga0163163_10150011 | 3300014325 | Bacteria | 2375 |
| 205 | Ga0163163_10388908 | 3300014325 | Bacteria | 1452 |
| 206 | Ga0157380_10003019 | 3300014326 | Bacteria | 11465 |
| 207 | Ga0157380_10021836 | 3300014326 | Bacteria | 4808 |
| 208 | Ga0157380_12212053 | 3300014326 | Unclassified | 614 |
| 209 | Ga0157377_10593386 | 3300014745 | Bacteria | 789 |
| 210 | Ga0157379_10000098 | 3300014968 | Bacteria | 59060 |
| 211 | Ga0157376_10303037 | 3300014969 | Bacteria | 1513 |
| 212 | Ga0163161_10038345 | 3300017792 | Bacteria | 3437 |
| 213 | Ga0213874_10050054 | 3300021377 | Bacteria | 1279 |
| 214 | Ga0207697_10001247 | 3300025315 | Bacteria | 13947 |
| 215 | Ga0207697_10175681 | 3300025315 | Bacteria | 938 |
| 216 | Ga0207656_10001481 | 3300025321 | Bacteria | 7773 |
| 217 | Ga0207696_1086637 | 3300025711 | Bacteria | 861 |
| 218 | Ga0207696_1133225 | 3300025711 | Unclassified | 667 |
| 219 | Ga0207682_10001691 | 3300025893 | Bacteria | 10110 |
| 220 | Ga0207682_10045741 | 3300025893 | Unclassified | 1797 |
| 221 | Ga0207642_10000386 | 3300025899 | Bacteria | 13199 |
| 222 | Ga0207710_10001837 | 3300025900 | Bacteria | 10231 |
| 223 | Ga0207710_10128523 | 3300025900 | Bacteria | 1215 |
| 224 | Ga0207688_10000100 | 3300025901 | Bacteria | 34208 |
| 225 | Ga0207680_10000207 | 3300025903 | Bacteria | 28427 |
| 226 | Ga0207680_10235738 | 3300025903 | Bacteria | 1259 |
| 227 | Ga0207647_10001302 | 3300025904 | Bacteria | 19206 |
| 228 | Ga0207645_10000386 | 3300025907 | Bacteria | 36411 |
| 229 | Ga0207645_10121851 | 3300025907 | Unclassified | 1693 |
| 230 | Ga0207643_10000002 | 3300025908 | Bacteria | 224909 |
| 231 | Ga0207643_10041137 | 3300025908 | Bacteria | 2604 |
| 232 | Ga0207705_10093046 | 3300025909 | Bacteria | 2210 |
| 233 | Ga0207705_10434375 | 3300025909 | Bacteria | 1017 |
| 234 | Ga0207705_10769426 | 3300025909 | Unclassified | 748 |
| 235 | Ga0207654_10004228 | 3300025911 | Bacteria | 7243 |
| 236 | Ga0207707_10077681 | 3300025912 | Bacteria | 2898 |
| 237 | Ga0207707_10165983 | 3300025912 | Bacteria | 1929 |
| 238 | Ga0207695_10043836 | 3300025913 | Bacteria | 4763 |
| 239 | Ga0207695_10525955 | 3300025913 | Bacteria | 1064 |
| 240 | Ga0207671_10000756 | 3300025914 | Bacteria | 41002 |
| 241 | Ga0207693_10315580 | 3300025915 | Bacteria | 1224 |
| 242 | Ga0207693_10647017 | 3300025915 | Bacteria | 821 |
| 243 | Ga0207663_10703922 | 3300025916 | Bacteria | 800 |
| 244 | Ga0207660_10072347 | 3300025917 | Bacteria | 2511 |
| 245 | Ga0207662_10000011 | 3300025918 | Bacteria | 90777 |
| 246 | Ga0207662_10797204 | 3300025918 | Bacteria | 666 |
| 247 | Ga0207657_10000607 | 3300025919 | Bacteria | 38122 |
| 248 | Ga0207657_10046911 | 3300025919 | Bacteria | 3783 |
| 249 | Ga0207657_10635555 | 3300025919 | Unclassified | 831 |
| 250 | Ga0207649_10000627 | 3300025920 | Bacteria | 23719 |
| 251 | Ga0207649_10002450 | 3300025920 | Bacteria | 10388 |
| 252 | Ga0207649_10417225 | 3300025920 | Bacteria | 1007 |
| 253 | Ga0207649_10436449 | 3300025920 | Bacteria | 986 |
| 254 | Ga0207649_10885504 | 3300025920 | Bacteria | 699 |
| 255 | Ga0207681_10000108 | 3300025923 | Bacteria | 71434 |
| 256 | Ga0207694_10007411 | 3300025924 | Bacteria | 8322 |
| 257 | Ga0207650_10000349 | 3300025925 | Bacteria | 44570 |
| 258 | Ga0207650_10051679 | 3300025925 | Bacteria | 3042 |
| 259 | Ga0207659_10000123 | 3300025926 | Bacteria | 45421 |
| 260 | Ga0207659_10095313 | 3300025926 | Bacteria | 2231 |
| 261 | Ga0207659_10836088 | 3300025926 | Unclassified | 791 |
| 262 | Ga0207659_11717215 | 3300025926 | Bacteria | 534 |
| 263 | Ga0207687_10003914 | 3300025927 | Bacteria | 9981 |
| 264 | Ga0207700_10038833 | 3300025928 | Bacteria | 3459 |
| 265 | Ga0207664_10000874 | 3300025929 | Bacteria | 20374 |
| 266 | Ga0207644_10000565 | 3300025931 | Bacteria | 23709 |
| 267 | Ga0207644_10038923 | 3300025931 | Bacteria | 3353 |
| 268 | Ga0207644_10626306 | 3300025931 | Bacteria | 894 |
| 269 | Ga0207690_10001018 | 3300025932 | Bacteria | 17940 |
| 270 | Ga0207706_10000078 | 3300025933 | Bacteria | 100847 |
| 271 | Ga0207686_10005642 | 3300025934 | Bacteria | 6707 |
| 272 | Ga0207686_10067400 | 3300025934 | Bacteria | 2290 |
| 273 | Ga0207686_10613968 | 3300025934 | Bacteria | 857 |
| 274 | Ga0207709_10035162 | 3300025935 | Bacteria | 2960 |
| 275 | Ga0207670_10000224 | 3300025936 | Bacteria | 36974 |
| 276 | Ga0207670_10029508 | 3300025936 | Bacteria | 3495 |
| 277 | Ga0207670_10366866 | 3300025936 | Bacteria | 1144 |
| 278 | Ga0207670_10984911 | 3300025936 | Unclassified | 709 |
| 279 | Ga0207669_10002589 | 3300025937 | Bacteria | 7729 |
| 280 | Ga0207704_10000199 | 3300025938 | Bacteria | 30848 |
| 281 | Ga0207704_10004475 | 3300025938 | Bacteria | 6387 |
| 282 | Ga0207665_10036565 | 3300025939 | Bacteria | 3266 |
| 283 | Ga0207691_10000389 | 3300025940 | Bacteria | 43983 |
| 284 | Ga0207691_10069210 | 3300025940 | Bacteria | 3188 |
| 285 | Ga0207691_10458894 | 3300025940 | Bacteria | 1084 |
| 286 | Ga0207711_10001003 | 3300025941 | Bacteria | 27077 |
| 287 | Ga0207711_10002221 | 3300025941 | Bacteria | 17432 |
| 288 | Ga0207711_11503053 | 3300025941 | Bacteria | 616 |
| 289 | Ga0207711_11940229 | 3300025941 | Bacteria | 532 |
| 290 | Ga0207689_10000523 | 3300025942 | Bacteria | 36411 |
| 291 | Ga0207689_11339220 | 3300025942 | Unclassified | 601 |
| 292 | Ga0207661_10002620 | 3300025944 | Bacteria | 12385 |
| 293 | Ga0207661_10107033 | 3300025944 | Bacteria | 2358 |
| 294 | Ga0207661_10142520 | 3300025944 | Bacteria | 2064 |
| 295 | Ga0207661_11788429 | 3300025944 | Bacteria | 560 |
| 296 | Ga0207679_10000442 | 3300025945 | Bacteria | 29194 |
| 297 | Ga0207679_10003533 | 3300025945 | Bacteria | 9676 |
| 298 | Ga0207679_10071960 | 3300025945 | Bacteria | 2610 |
| 299 | Ga0207679_10155171 | 3300025945 | Bacteria | 1868 |
| 300 | Ga0207679_10297315 | 3300025945 | Bacteria | 1390 |
| 301 | Ga0207679_10890048 | 3300025945 | Bacteria | 814 |
| 302 | Ga0207667_10011534 | 3300025949 | Bacteria | 10268 |
| 303 | Ga0207651_10000020 | 3300025960 | Bacteria | 83049 |
| 304 | Ga0207651_10243616 | 3300025960 | Bacteria | 1467 |
| 305 | Ga0207651_10325237 | 3300025960 | Bacteria | 1287 |
| 306 | Ga0207712_10000666 | 3300025961 | Bacteria | 26658 |
| 307 | Ga0207712_10015934 | 3300025961 | Unclassified | 4859 |
| 308 | Ga0207668_10228178 | 3300025972 | Bacteria | 1499 |
| 309 | Ga0207640_10000302 | 3300025981 | Bacteria | 32782 |
| 310 | Ga0207640_10161961 | 3300025981 | Bacteria | 1656 |
| 311 | Ga0207640_10162573 | 3300025981 | Bacteria | 1654 |
| 312 | Ga0207640_10583028 | 3300025981 | Bacteria | 944 |
| 313 | Ga0207658_10000437 | 3300025986 | Bacteria | 39386 |
| 314 | Ga0207658_10029516 | 3300025986 | Bacteria | 3874 |
| 315 | Ga0207677_10000079 | 3300026023 | Bacteria | 79753 |
| 316 | Ga0207703_10000148 | 3300026035 | Bacteria | 81341 |
| 317 | Ga0207703_10000236 | 3300026035 | Bacteria | 62877 |
| 318 | Ga0207703_10022917 | 3300026035 | Bacteria | 4904 |
| 319 | Ga0207639_10000609 | 3300026041 | Bacteria | 24634 |
| 320 | Ga0207639_10006727 | 3300026041 | Bacteria | 7820 |
| 321 | Ga0207639_10265571 | 3300026041 | Bacteria | 1503 |
| 322 | Ga0207678_10001757 | 3300026067 | Bacteria | 19846 |
| 323 | Ga0207702_10009610 | 3300026078 | Bacteria | 8116 |
| 324 | Ga0207702_10905682 | 3300026078 | Bacteria | 874 |
| 325 | Ga0207641_10016042 | 3300026088 | Bacteria | 6134 |
| 326 | Ga0207641_10030088 | 3300026088 | Bacteria | 4495 |
| 327 | Ga0207648_10000497 | 3300026089 | Bacteria | 43780 |
| 328 | Ga0207648_10349450 | 3300026089 | Bacteria | 1333 |
| 329 | Ga0207648_10963701 | 3300026089 | Bacteria | 798 |
| 330 | Ga0207676_10000636 | 3300026095 | Bacteria | 28319 |
| 331 | Ga0207676_10004297 | 3300026095 | Bacteria | 10070 |
| 332 | Ga0207676_10072105 | 3300026095 | Bacteria | 2775 |
| 333 | Ga0207676_10406456 | 3300026095 | Bacteria | 1274 |
| 334 | Ga0207676_10810414 | 3300026095 | Bacteria | 914 |
| 335 | Ga0207674_10000427 | 3300026116 | Bacteria | 54893 |
| 336 | Ga0207674_10001529 | 3300026116 | Bacteria | 29791 |
| 337 | Ga0207674_10004939 | 3300026116 | Bacteria | 15929 |
| 338 | Ga0207675_100000006 | 3300026118 | Bacteria | 189749 |
| 339 | Ga0207675_100487832 | 3300026118 | Bacteria | 1225 |
| 340 | Ga0207675_101064670 | 3300026118 | Unclassified | 828 |
| 341 | Ga0207683_10000589 | 3300026121 | Bacteria | 33426 |
| 342 | Ga0207683_10059352 | 3300026121 | Bacteria | 3360 |
| 343 | Ga0207683_10180310 | 3300026121 | Bacteria | 1915 |
| 344 | Ga0207683_10197510 | 3300026121 | Bacteria | 1828 |
| 345 | Ga0207683_10207331 | 3300026121 | Bacteria | 1783 |
| 346 | Ga0207698_10000382 | 3300026142 | Bacteria | 25568 |
| 347 | Ga0207698_10124618 | 3300026142 | Bacteria | 2188 |
| 348 | Ga0209998_10115156 | 3300027717 | Bacteria | 674 |
| 349 | Ga0209974_10110939 | 3300027876 | Bacteria | 965 |
| 350 | Ga0268266_10000687 | 3300028379 | Bacteria | 45601 |
| 351 | Ga0268265_10001081 | 3300028380 | Bacteria | 24268 |
| 352 | Ga0268265_10177097 | 3300028380 | Bacteria | 1829 |
| 353 | Ga0268265_11506065 | 3300028380 | Bacteria | 676 |
| 354 | Ga0268264_10000447 | 3300028381 | Bacteria | 56371 |
| 355 | Ga0268264_10000705 | 3300028381 | Bacteria | 38562 |
| 356 | Ga0265334_10000008 | 3300028573 | Bacteria | 200602 |
| 357 | Ga0265318_10217117 | 3300028577 | Bacteria | 699 |
| 358 | Ga0265338_10081181 | 3300028800 | Bacteria | 2720 |
| 359 | Ga0265327_10016046 | 3300031251 | Bacteria | 4789 |
| 360 | Ga0307408_100325215 | 3300031548 | Unclassified | 1297 |
| 361 | Ga0307408_100338213 | 3300031548 | Bacteria | 1273 |
| 362 | Ga0265313_10000076 | 3300031595 | Bacteria | 96542 |
| 363 | Ga0265313_10101286 | 3300031595 | Bacteria | 1278 |
| 364 | Ga0316575_10070913 | 3300031665 | Bacteria | 1400 |
| 365 | Ga0307405_10464328 | 3300031731 | Bacteria | 1007 |
| 366 | Ga0307413_10046948 | 3300031824 | Bacteria | 2572 |
| 367 | Ga0307413_10053134 | 3300031824 | Bacteria | 2451 |
| 368 | Ga0307413_10136229 | 3300031824 | Unclassified | 1689 |
| 369 | Ga0307413_10184857 | 3300031824 | Bacteria | 1490 |
| 370 | Ga0307413_10315465 | 3300031824 | Unclassified | 1192 |
| 371 | Ga0307410_10009777 | 3300031852 | Bacteria | 5398 |
| 372 | Ga0307410_10124776 | 3300031852 | Unclassified | 1883 |
| 373 | Ga0307410_10201804 | 3300031852 | Bacteria | 1518 |
| 374 | Ga0307410_11255698 | 3300031852 | Bacteria | 647 |
| 375 | Ga0307406_10455148 | 3300031901 | Bacteria | 1028 |
| 376 | Ga0307406_10660201 | 3300031901 | Bacteria | 869 |
| 377 | Ga0307406_10969620 | 3300031901 | Unclassified | 728 |
| 378 | Ga0307407_10054050 | 3300031903 | Unclassified | 2314 |
| 379 | Ga0307407_10085155 | 3300031903 | Bacteria | 1922 |
| 380 | Ga0307407_10147956 | 3300031903 | Bacteria | 1523 |
| 381 | Ga0307412_10054463 | 3300031911 | Bacteria | 2656 |
| 382 | Ga0307409_100029637 | 3300031995 | Bacteria | 3919 |
| 383 | Ga0307409_100118184 | 3300031995 | Bacteria | 2239 |
| 384 | Ga0307409_100357742 | 3300031995 | Bacteria | 1380 |
| 385 | Ga0307416_100079109 | 3300032002 | Bacteria | 2769 |
| 386 | Ga0307416_100319685 | 3300032002 | Bacteria | 1553 |
| 387 | Ga0307416_101849660 | 3300032002 | Bacteria | 707 |
| 388 | Ga0307416_101881537 | 3300032002 | Bacteria | 702 |
| 389 | Ga0307414_10060830 | 3300032004 | Bacteria | 2673 |
| 390 | Ga0307414_10329323 | 3300032004 | Bacteria | 1303 |
| 391 | Ga0307411_10044503 | 3300032005 | Bacteria | 2848 |
| 392 | Ga0307411_10068429 | 3300032005 | Bacteria | 2393 |
| 393 | Ga0307411_10201339 | 3300032005 | Bacteria | 1529 |
| 394 | Ga0307411_10302549 | 3300032005 | Unclassified | 1283 |
| 395 | Ga0307415_100013136 | 3300032126 | Bacteria | 4822 |
| 396 | Ga0307415_100167250 | 3300032126 | Bacteria | 1711 |
| 397 | Ga0307415_100466095 | 3300032126 | Unclassified | 1096 |
| 398 | Ga0307415_101300274 | 3300032126 | Unclassified | 689 |
| 399 | Ga0373930_0058637 | 3300034816 | Bacteria | 855 |
| 400 | Ga0373926_0160987 | 3300035083 | Bacteria | 857 |
| 401 | Ga0373929_0159636 | 3300035085 | Bacteria | 610 |
| 402 | Ga0373951_0206030 | 3300035091 | Bacteria | 575 |
| 403 | Ga0373932_0218669 | 3300035112 | Bacteria | 684 |
| 404 | Ga0373945_0005329 | 3300035116 | Bacteria | 4116 |
| 405 | Ga0373943_0681693 | 3300035170 | Bacteria | 608 |
| 406 | Ga0373946_0063103 | 3300035171 | Bacteria | 1581 |
| 407 | Ga0373927_0000001 | 3300035695 | Bacteria | 1082160 |
| 408 | Ga0373937_0169878 | 3300036401 | Bacteria | 2046 |
| 409 | Ga0373937_0259919 | 3300036401 | Bacteria | 1637 |
| 410 | Ga0373925_0000241 | 3300037068 | Bacteria | 57902 |
| 411 | Ga0395900_0006717 | 3300037418 | Bacteria | 11943 |
| 412 | Ga0436360_0998048 | 3300039438 | Bacteria | 1156 |
| 413 | Ga0451807_0616362 | 3300041486 | Bacteria | 656 |
| 414 | Ga0451837_1605580 | 3300041494 | Bacteria | 2290 |
| 415 | Ga0451839_0704564 | 3300041496 | Bacteria | 723 |
| 416 | Ga0451853_1538364 | 3300041512 | Bacteria | 1061 |
| 417 | Ga0439448_0024925 | 3300042005 | Bacteria | 1873 |
| 418 | Ga0439455_0018316 | 3300042012 | Bacteria | 1641 |
| 419 | Ga0439458_0025879 | 3300042157 | Bacteria | 1378 |
| 420 | Ga0439444_0073343 | 3300042437 | Bacteria | 737 |
| 421 | Ga0451577_0049141 | 3300042876 | Bacteria | 3767 |
| 422 | Ga0451577_0217602 | 3300042876 | Bacteria | 1726 |
| 423 | Ga0453683_0463980 | 3300044673 | Bacteria | 820 |
| 424 | Ga0453684_1465337 | 3300044712 | Bacteria | 705 |
| 425 | Ga0451576_0014574 | 3300045051 | Bacteria | 8738 |
| 426 | Ga0451576_2154280 | 3300045051 | Bacteria | 573 |
| 427 | Ga0495629_0000009 | 3300046459 | Bacteria | 348242 |
| 428 | Ga0495639_0000260 | 3300046475 | Bacteria | 26124 |
| 429 | Ga0495628_0331839 | 3300046516 | Bacteria | 1121 |
| 430 | Ga0495630_0091499 | 3300046517 | Bacteria | 2298 |
| 431 | Ga0495630_0153888 | 3300046517 | Bacteria | 1750 |
| 432 | Ga0495630_0314949 | 3300046517 | Bacteria | 1196 |
| 433 | Ga0495666_0000238 | 3300046526 | Bacteria | 23620 |
| 434 | Ga0495586_0000473 | 3300046535 | Bacteria | 23970 |
| 435 | Ga0495622_0131207 | 3300046557 | Bacteria | 1141 |
| 436 | Ga0495668_0001246 | 3300046616 | Bacteria | 25534 |
| 437 | Ga0495635_0007147 | 3300046663 | Bacteria | 7800 |
| 438 | Ga0495588_0075776 | 3300046674 | Bacteria | 1753 |
| 439 | Ga0495658_0030579 | 3300046683 | Bacteria | 2925 |
| 440 | Ga0495613_0020956 | 3300046689 | Bacteria | 4873 |
| 441 | Ga0495613_0113908 | 3300046689 | Bacteria | 1947 |
| 442 | Ga0495613_0218704 | 3300046689 | Bacteria | 1338 |
| 443 | Ga0495624_0115201 | 3300046690 | Bacteria | 1652 |
| 444 | Ga0495672_0357305 | 3300047320 | Unclassified | 677 |
| 445 | Ga0495676_0003955 | 3300047321 | Bacteria | 13490 |
| 446 | Ga0495680_0003926 | 3300047322 | Bacteria | 14379 |
| 447 | Ga0495684_0017103 | 3300047471 | Bacteria | 5585 |
| 448 | Ga0495684_0228053 | 3300047471 | Bacteria | 1363 |
| 449 | Ga0495684_0889207 | 3300047471 | Unclassified | 575 |
| 450 | Ga0496101_0181012 | 3300048904 | Bacteria | 1623 |
| 451 | Ga0496101_0291299 | 3300048904 | Bacteria | 1277 |
| 452 | Ga0496102_0000795 | 3300048905 | Bacteria | 30629 |
| 453 | Ga0496104_0158071 | 3300048907 | Unclassified | 2175 |
| 454 | Ga0496104_0191104 | 3300048907 | Bacteria | 1959 |
| 455 | Ga0496106_0000648 | 3300048909 | Bacteria | 24888 |
| 456 | Ga0496107_0235819 | 3300048910 | Bacteria | 1361 |
| 457 | Ga0496108_0025501 | 3300048911 | Bacteria | 4872 |
| 458 | Ga0496109_0020726 | 3300048912 | Bacteria | 5806 |
| 459 | Ga0496109_0206018 | 3300048912 | Unclassified | 1849 |
| 460 | Ga0496112_0000385 | 3300048915 | Bacteria | 28974 |
| 461 | Ga0496113_0102667 | 3300048916 | Bacteria | 2217 |
| 462 | Ga0496114_0685335 | 3300048917 | Bacteria | 899 |
| 463 | Ga0496114_0814574 | 3300048917 | Bacteria | 813 |
| 464 | Ga0496115_0413236 | 3300048918 | Bacteria | 1094 |
| 465 | Ga0501046_0136130 | 3300049580 | Bacteria | 1860 |
| 466 | Ga0501047_0113778 | 3300049581 | Bacteria | 2588 |
| 467 | Ga0501198_068338 | 3300049649 | Bacteria | 665 |
| 468 | Ga0501239_015282 | 3300049672 | Bacteria | 896 |
| 469 | Ga0501242_039648 | 3300049674 | Bacteria | 662 |
| 470 | Ga0501257_043849 | 3300049686 | Bacteria | 1103 |
| 471 | Ga0501266_024690 | 3300049763 | Unclassified | 836 |
| 472 | Ga0501272_059112 | 3300049769 | Unclassified | 545 |
| 473 | Ga0501273_020402 | 3300049770 | Bacteria | 894 |
| 474 | nmdc:mga05p37_926826_c1 | 3300050507 | Bacteria | 935 |
| 475 | nmdc:mga0qj67_32404_c1 | 3300050509 | Bacteria | 4075 |
| 476 | nmdc:mga06r32_517526_c1 | 3300050510 | Unclassified | 1169 |
| 477 | nmdc:mga06r32_70187_c1 | 3300050510 | Bacteria | 3387 |
| 478 | nmdc:mga08y16_1665732_c1 | 3300050511 | Unclassified | 594 |
| 479 | nmdc:mga08y16_572646_c1 | 3300050511 | Bacteria | 1141 |
| 480 | nmdc:mga0n895_783139_c1 | 3300050512 | Bacteria | 945 |
| 481 | nmdc:mga0rr50_120422_c1 | 3300050513 | Bacteria | 2088 |
| 482 | Ga0495619_0192897 | 3300053085 | Bacteria | 1410 |
| 483 | Ga0501082_0585465 | 3300060353 | Bacteria | 976 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300006173 | Ga0070716_100062423 | Ga0070716_1000624231 | 124 |
| 2 | 3300025939 | Ga0207665_10036565 | Ga0207665_100365653 | 124 |
| 3 | 3300014968 | Ga0157379_10000098 | Ga0157379_1000009829 | 126 |
| 4 | 3300025941 | Ga0207711_11503053 | Ga0207711_115030531 | 126 |
| 5 | 3300026121 | Ga0207683_10207331 | Ga0207683_102073312 | 126 |
| 6 | 3300034816 | Ga0373930_0058637 | Ga0373930_0058637_458_838 | 126 |
| 7 | 3300035091 | Ga0373951_0206030 | Ga0373951_0206030_25_405 | 126 |
| 8 | 3300028577 | Ga0265318_10217117 | Ga0265318_102171172 | 127 |
| 9 | 3300005563 | Ga0068855_100218694 | Ga0068855_1002186942 | 135 |
| 10 | 3300005564 | Ga0070664_100081494 | Ga0070664_1000814944 | 135 |
| 11 | 3300005564 | Ga0070664_100147350 | Ga0070664_1001473502 | 135 |
| 12 | 3300025919 | Ga0207657_10046911 | Ga0207657_100469112 | 135 |
| 13 | 3300005435 | Ga0070714_100367459 | Ga0070714_1003674592 | 136 |
| 14 | 3300014326 | Ga0157380_12212053 | Ga0157380_122120531 | 136 |
| 15 | iso_pu_bacteria | 2671180531 | 2673162361 | 136 |
| 16 | 3300005328 | Ga0070676_10023647 | Ga0070676_100236473 | 137 |
| 17 | 3300005333 | Ga0070677_10004018 | Ga0070677_100040186 | 137 |
| 18 | 3300005435 | Ga0070714_100001058 | Ga0070714_10000105818 | 137 |
| 19 | 3300005444 | Ga0070694_100026838 | Ga0070694_1000268381 | 137 |
| 20 | 3300005456 | Ga0070678_100070930 | Ga0070678_1000709303 | 137 |
| 21 | 3300005459 | Ga0068867_100702639 | Ga0068867_1007026392 | 137 |
| 22 | 3300005545 | Ga0070695_100221738 | Ga0070695_1002217382 | 137 |
| 23 | 3300006844 | Ga0075428_100104825 | Ga0075428_1001048253 | 137 |
| 24 | 3300006844 | Ga0075428_100132211 | Ga0075428_1001322113 | 137 |
| 25 | 3300006844 | Ga0075428_100365174 | Ga0075428_1003651742 | 137 |
| 26 | 3300006846 | Ga0075430_100042980 | Ga0075430_1000429804 | 137 |
| 27 | 3300006846 | Ga0075430_100658664 | Ga0075430_1006586642 | 137 |
| 28 | 3300006847 | Ga0075431_100082748 | Ga0075431_1000827483 | 137 |
| 29 | 3300006847 | Ga0075431_100111246 | Ga0075431_1001112462 | 137 |
| 30 | 3300009094 | Ga0111539_10067497 | Ga0111539_100674973 | 137 |
| 31 | 3300009176 | Ga0105242_10078050 | Ga0105242_100780502 | 137 |
| 32 | 3300013104 | Ga0157370_11787658 | Ga0157370_117876581 | 137 |
| 33 | 3300013308 | Ga0157375_11405627 | Ga0157375_114056272 | 137 |
| 34 | 3300014326 | Ga0157380_10003019 | Ga0157380_100030193 | 137 |
| 35 | 3300025893 | Ga0207682_10045741 | Ga0207682_100457412 | 137 |
| 36 | 3300025907 | Ga0207645_10121851 | Ga0207645_101218512 | 137 |
| 37 | 3300025915 | Ga0207693_10315580 | Ga0207693_103155802 | 137 |
| 38 | 3300025926 | Ga0207659_11717215 | Ga0207659_117172151 | 137 |
| 39 | 3300025929 | Ga0207664_10000874 | Ga0207664_1000087419 | 137 |
| 40 | 3300025934 | Ga0207686_10067400 | Ga0207686_100674002 | 137 |
| 41 | 3300028380 | Ga0268265_10177097 | Ga0268265_101770972 | 137 |
| 42 | 3300028573 | Ga0265334_10000008 | Ga0265334_10000008174 | 137 |
| 43 | 3300028800 | Ga0265338_10081181 | Ga0265338_100811813 | 137 |
| 44 | 3300031251 | Ga0265327_10016046 | Ga0265327_100160462 | 137 |
| 45 | 3300031595 | Ga0265313_10000076 | Ga0265313_1000007625 | 137 |
| 46 | 3300031595 | Ga0265313_10101286 | Ga0265313_101012863 | 137 |
| 47 | 3300031824 | Ga0307413_10315465 | Ga0307413_103154652 | 137 |
| 48 | 3300031852 | Ga0307410_10124776 | Ga0307410_101247762 | 137 |
| 49 | 3300031901 | Ga0307406_10969620 | Ga0307406_109696201 | 137 |
| 50 | 3300031903 | Ga0307407_10054050 | Ga0307407_100540502 | 137 |
| 51 | 3300032126 | Ga0307415_100466095 | Ga0307415_1004660952 | 137 |
| 52 | 3300032126 | Ga0307415_101300274 | Ga0307415_1013002741 | 137 |
| 53 | 3300035112 | Ga0373932_0218669 | Ga0373932_0218669_206_622 | 137 |
| 54 | 3300035116 | Ga0373945_0005329 | Ga0373945_0005329_2319_2759 | 137 |
| 55 | 3300035171 | Ga0373946_0063103 | Ga0373946_0063103_262_702 | 137 |
| 56 | 3300035695 | Ga0373927_0000001 | Ga0373927_0000001_982198_982614 | 137 |
| 57 | 3300036401 | Ga0373937_0259919 | Ga0373937_0259919_715_1155 | 137 |
| 58 | 3300037068 | Ga0373925_0000241 | Ga0373925_0000241_13700_14140 | 137 |
| 59 | 3300037418 | Ga0395900_0006717 | Ga0395900_0006717_7172_7588 | 137 |
| 60 | 3300042876 | Ga0451577_0217602 | Ga0451577_0217602_1098_1514 | 137 |
| 61 | 3300046459 | Ga0495629_0000009 | Ga0495629_0000009_295031_295471 | 137 |
| 62 | 3300046475 | Ga0495639_0000260 | Ga0495639_0000260_13242_13682 | 137 |
| 63 | 3300046516 | Ga0495628_0331839 | Ga0495628_0331839_253_666 | 137 |
| 64 | 3300046517 | Ga0495630_0091499 | Ga0495630_0091499_1541_1954 | 137 |
| 65 | 3300046517 | Ga0495630_0153888 | Ga0495630_0153888_954_1394 | 137 |
| 66 | 3300046517 | Ga0495630_0314949 | Ga0495630_0314949_697_1137 | 137 |
| 67 | 3300046526 | Ga0495666_0000238 | Ga0495666_0000238_14929_15369 | 137 |
| 68 | 3300046535 | Ga0495586_0000473 | Ga0495586_0000473_7928_8368 | 137 |
| 69 | 3300046557 | Ga0495622_0131207 | Ga0495622_0131207_57_497 | 137 |
| 70 | 3300046663 | Ga0495635_0007147 | Ga0495635_0007147_3577_4017 | 137 |
| 71 | 3300046674 | Ga0495588_0075776 | Ga0495588_0075776_914_1354 | 137 |
| 72 | 3300046683 | Ga0495658_0030579 | Ga0495658_0030579_498_938 | 137 |
| 73 | 3300046689 | Ga0495613_0020956 | Ga0495613_0020956_4240_4680 | 137 |
| 74 | 3300046689 | Ga0495613_0113908 | Ga0495613_0113908_583_1023 | 137 |
| 75 | 3300046690 | Ga0495624_0115201 | Ga0495624_0115201_995_1435 | 137 |
| 76 | 3300047321 | Ga0495676_0003955 | Ga0495676_0003955_11898_12338 | 137 |
| 77 | 3300047322 | Ga0495680_0003926 | Ga0495680_0003926_2830_3270 | 137 |
| 78 | 3300047471 | Ga0495684_0017103 | Ga0495684_0017103_4189_4629 | 137 |
| 79 | 3300047471 | Ga0495684_0228053 | Ga0495684_0228053_461_886 | 137 |
| 80 | 3300049674 | Ga0501242_039648 | Ga0501242_039648_16_432 | 137 |
| 81 | 3300050507 | nmdc:mga05p37_926826_c1 | nmdc:mga05p37_926826_c1_209_649 | 137 |
| 82 | 3300050509 | nmdc:mga0qj67_32404_c1 | nmdc:mga0qj67_32404_c1_2552_2992 | 137 |
| 83 | 3300050510 | nmdc:mga06r32_517526_c1 | nmdc:mga06r32_517526_c1_634_1092 | 137 |
| 84 | 3300050510 | nmdc:mga06r32_70187_c1 | nmdc:mga06r32_70187_c1_871_1311 | 137 |
| 85 | 3300053085 | Ga0495619_0192897 | Ga0495619_0192897_243_683 | 137 |
| 86 | 3300005327 | Ga0070658_10111228 | Ga0070658_101112282 | 138 |
| 87 | 3300005331 | Ga0070670_100823608 | Ga0070670_1008236082 | 138 |
| 88 | 3300005331 | Ga0070670_101511527 | Ga0070670_1015115271 | 138 |
| 89 | 3300005334 | Ga0068869_100783364 | Ga0068869_1007833642 | 138 |
| 90 | 3300005336 | Ga0070680_101118957 | Ga0070680_1011189572 | 138 |
| 91 | 3300005338 | Ga0068868_100654478 | Ga0068868_1006544782 | 138 |
| 92 | 3300005339 | Ga0070660_101111525 | Ga0070660_1011115252 | 138 |
| 93 | 3300005344 | Ga0070661_100756225 | Ga0070661_1007562252 | 138 |
| 94 | 3300005354 | Ga0070675_100003395 | Ga0070675_10000339511 | 138 |
| 95 | 3300005364 | Ga0070673_100130339 | Ga0070673_1001303392 | 138 |
| 96 | 3300005364 | Ga0070673_100370496 | Ga0070673_1003704962 | 138 |
| 97 | 3300005367 | Ga0070667_100669535 | Ga0070667_1006695351 | 138 |
| 98 | 3300005441 | Ga0070700_100271301 | Ga0070700_1002713011 | 138 |
| 99 | 3300005444 | Ga0070694_100295778 | Ga0070694_1002957782 | 138 |
| 100 | 3300005455 | Ga0070663_101234806 | Ga0070663_1012348062 | 138 |
| 101 | 3300005456 | Ga0070678_100110605 | Ga0070678_1001106052 | 138 |
| 102 | 3300005457 | Ga0070662_100366060 | Ga0070662_1003660602 | 138 |
| 103 | 3300005457 | Ga0070662_100897507 | Ga0070662_1008975072 | 138 |
| 104 | 3300005458 | Ga0070681_10033955 | Ga0070681_100339552 | 138 |
| 105 | 3300005466 | Ga0070685_10110872 | Ga0070685_101108721 | 138 |
| 106 | 3300005539 | Ga0068853_100020783 | Ga0068853_1000207835 | 138 |
| 107 | 3300005543 | Ga0070672_100254736 | Ga0070672_1002547362 | 138 |
| 108 | 3300005543 | Ga0070672_100608040 | Ga0070672_1006080402 | 138 |
| 109 | 3300005549 | Ga0070704_101784141 | Ga0070704_1017841411 | 138 |
| 110 | 3300005564 | Ga0070664_100081850 | Ga0070664_1000818502 | 138 |
| 111 | 3300005564 | Ga0070664_100161764 | Ga0070664_1001617642 | 138 |
| 112 | 3300005564 | Ga0070664_100818572 | Ga0070664_1008185721 | 138 |
| 113 | 3300005577 | Ga0068857_100002895 | Ga0068857_10000289512 | 138 |
| 114 | 3300005578 | Ga0068854_100198645 | Ga0068854_1001986452 | 138 |
| 115 | 3300005578 | Ga0068854_100410763 | Ga0068854_1004107632 | 138 |
| 116 | 3300005617 | Ga0068859_101316544 | Ga0068859_1013165441 | 138 |
| 117 | 3300005618 | Ga0068864_100543608 | Ga0068864_1005436082 | 138 |
| 118 | 3300005618 | Ga0068864_100657632 | Ga0068864_1006576321 | 138 |
| 119 | 3300005719 | Ga0068861_101015914 | Ga0068861_1010159142 | 138 |
| 120 | 3300005841 | Ga0068863_100197632 | Ga0068863_1001976321 | 138 |
| 121 | 3300005841 | Ga0068863_100970094 | Ga0068863_1009700942 | 138 |
| 122 | 3300005842 | Ga0068858_100535078 | Ga0068858_1005350782 | 138 |
| 123 | 3300005843 | Ga0068860_101926977 | Ga0068860_1019269772 | 138 |
| 124 | 3300006237 | Ga0097621_100072090 | Ga0097621_1000720903 | 138 |
| 125 | 3300006358 | Ga0068871_100135927 | Ga0068871_1001359272 | 138 |
| 126 | 3300006358 | Ga0068871_100739222 | Ga0068871_1007392221 | 138 |
| 127 | 3300006881 | Ga0068865_100002265 | Ga0068865_1000022659 | 138 |
| 128 | 3300006881 | Ga0068865_100600064 | Ga0068865_1006000641 | 138 |
| 129 | 3300006931 | Ga0097620_101316710 | Ga0097620_1013167101 | 138 |
| 130 | 3300009094 | Ga0111539_10486995 | Ga0111539_104869953 | 138 |
| 131 | 3300009101 | Ga0105247_10001005 | Ga0105247_100010052 | 138 |
| 132 | 3300009174 | Ga0105241_10063266 | Ga0105241_100632664 | 138 |
| 133 | 3300009553 | Ga0105249_10187736 | Ga0105249_101877362 | 138 |
| 134 | 3300010375 | Ga0105239_10130361 | Ga0105239_101303612 | 138 |
| 135 | 3300013100 | Ga0157373_11297372 | Ga0157373_112973721 | 138 |
| 136 | 3300013104 | Ga0157370_10552174 | Ga0157370_105521742 | 138 |
| 137 | 3300013105 | Ga0157369_10039346 | Ga0157369_100393463 | 138 |
| 138 | 3300013297 | Ga0157378_10676549 | Ga0157378_106765492 | 138 |
| 139 | 3300013306 | Ga0163162_10443316 | Ga0163162_104433162 | 138 |
| 140 | 3300013307 | Ga0157372_10052414 | Ga0157372_100524144 | 138 |
| 141 | 3300013307 | Ga0157372_10953665 | Ga0157372_109536651 | 138 |
| 142 | 3300013308 | Ga0157375_10822580 | Ga0157375_108225802 | 138 |
| 143 | 3300014325 | Ga0163163_10150011 | Ga0163163_101500112 | 138 |
| 144 | 3300014325 | Ga0163163_10388908 | Ga0163163_103889083 | 138 |
| 145 | 3300014326 | Ga0157380_10021836 | Ga0157380_100218365 | 138 |
| 146 | 3300014745 | Ga0157377_10593386 | Ga0157377_105933861 | 138 |
| 147 | 3300014969 | Ga0157376_10303037 | Ga0157376_103030373 | 138 |
| 148 | 3300025315 | Ga0207697_10175681 | Ga0207697_101756811 | 138 |
| 149 | 3300025711 | Ga0207696_1133225 | Ga0207696_11332251 | 138 |
| 150 | 3300025908 | Ga0207643_10041137 | Ga0207643_100411372 | 138 |
| 151 | 3300025909 | Ga0207705_10093046 | Ga0207705_100930462 | 138 |
| 152 | 3300025909 | Ga0207705_10769426 | Ga0207705_107694262 | 138 |
| 153 | 3300025912 | Ga0207707_10165983 | Ga0207707_101659832 | 138 |
| 154 | 3300025918 | Ga0207662_10797204 | Ga0207662_107972042 | 138 |
| 155 | 3300025919 | Ga0207657_10635555 | Ga0207657_106355552 | 138 |
| 156 | 3300025920 | Ga0207649_10417225 | Ga0207649_104172252 | 138 |
| 157 | 3300025925 | Ga0207650_10051679 | Ga0207650_100516792 | 138 |
| 158 | 3300025926 | Ga0207659_10095313 | Ga0207659_100953132 | 138 |
| 159 | 3300025926 | Ga0207659_10836088 | Ga0207659_108360882 | 138 |
| 160 | 3300025936 | Ga0207670_10984911 | Ga0207670_109849112 | 138 |
| 161 | 3300025938 | Ga0207704_10004475 | Ga0207704_100044755 | 138 |
| 162 | 3300025940 | Ga0207691_10069210 | Ga0207691_100692102 | 138 |
| 163 | 3300025940 | Ga0207691_10458894 | Ga0207691_104588942 | 138 |
| 164 | 3300025942 | Ga0207689_11339220 | Ga0207689_113392202 | 138 |
| 165 | 3300025944 | Ga0207661_10142520 | Ga0207661_101425203 | 138 |
| 166 | 3300025944 | Ga0207661_11788429 | Ga0207661_117884291 | 138 |
| 167 | 3300025945 | Ga0207679_10155171 | Ga0207679_101551713 | 138 |
| 168 | 3300025945 | Ga0207679_10297315 | Ga0207679_102973153 | 138 |
| 169 | 3300025945 | Ga0207679_10890048 | Ga0207679_108900482 | 138 |
| 170 | 3300025960 | Ga0207651_10243616 | Ga0207651_102436162 | 138 |
| 171 | 3300025960 | Ga0207651_10325237 | Ga0207651_103252372 | 138 |
| 172 | 3300025961 | Ga0207712_10015934 | Ga0207712_100159342 | 138 |
| 173 | 3300025981 | Ga0207640_10161961 | Ga0207640_101619611 | 138 |
| 174 | 3300025981 | Ga0207640_10162573 | Ga0207640_101625732 | 138 |
| 175 | 3300026041 | Ga0207639_10265571 | Ga0207639_102655712 | 138 |
| 176 | 3300026089 | Ga0207648_10349450 | Ga0207648_103494502 | 138 |
| 177 | 3300026095 | Ga0207676_10072105 | Ga0207676_100721055 | 138 |
| 178 | 3300026095 | Ga0207676_10406456 | Ga0207676_104064562 | 138 |
| 179 | 3300026095 | Ga0207676_10810414 | Ga0207676_108104142 | 138 |
| 180 | 3300026116 | Ga0207674_10004939 | Ga0207674_1000493916 | 138 |
| 181 | 3300026118 | Ga0207675_100487832 | Ga0207675_1004878322 | 138 |
| 182 | 3300026118 | Ga0207675_101064670 | Ga0207675_1010646702 | 138 |
| 183 | 3300026121 | Ga0207683_10059352 | Ga0207683_100593523 | 138 |
| 184 | 3300026142 | Ga0207698_10124618 | Ga0207698_101246182 | 138 |
| 185 | 3300027717 | Ga0209998_10115156 | Ga0209998_101151561 | 138 |
| 186 | 3300027876 | Ga0209974_10110939 | Ga0209974_101109392 | 138 |
| 187 | 3300028380 | Ga0268265_11506065 | Ga0268265_115060651 | 138 |
| 188 | 3300028381 | Ga0268264_10000447 | Ga0268264_1000044722 | 138 |
| 189 | 3300031548 | Ga0307408_100325215 | Ga0307408_1003252152 | 138 |
| 190 | 3300031548 | Ga0307408_100338213 | Ga0307408_1003382132 | 138 |
| 191 | 3300031665 | Ga0316575_10070913 | Ga0316575_100709133 | 138 |
| 192 | 3300031731 | Ga0307405_10464328 | Ga0307405_104643282 | 138 |
| 193 | 3300031824 | Ga0307413_10046948 | Ga0307413_100469482 | 138 |
| 194 | 3300031824 | Ga0307413_10053134 | Ga0307413_100531343 | 138 |
| 195 | 3300031824 | Ga0307413_10136229 | Ga0307413_101362292 | 138 |
| 196 | 3300031824 | Ga0307413_10184857 | Ga0307413_101848572 | 138 |
| 197 | 3300031852 | Ga0307410_10201804 | Ga0307410_102018042 | 138 |
| 198 | 3300031901 | Ga0307406_10455148 | Ga0307406_104551482 | 138 |
| 199 | 3300031903 | Ga0307407_10147956 | Ga0307407_101479562 | 138 |
| 200 | 3300031995 | Ga0307409_100029637 | Ga0307409_1000296373 | 138 |
| 201 | 3300031995 | Ga0307409_100118184 | Ga0307409_1001181842 | 138 |
| 202 | 3300031995 | Ga0307409_100357742 | Ga0307409_1003577422 | 138 |
| 203 | 3300032002 | Ga0307416_100319685 | Ga0307416_1003196852 | 138 |
| 204 | 3300032002 | Ga0307416_101849660 | Ga0307416_1018496601 | 138 |
| 205 | 3300032002 | Ga0307416_101881537 | Ga0307416_1018815371 | 138 |
| 206 | 3300032004 | Ga0307414_10060830 | Ga0307414_100608302 | 138 |
| 207 | 3300032004 | Ga0307414_10329323 | Ga0307414_103293232 | 138 |
| 208 | 3300032005 | Ga0307411_10044503 | Ga0307411_100445032 | 138 |
| 209 | 3300032005 | Ga0307411_10302549 | Ga0307411_103025492 | 138 |
| 210 | 3300032126 | Ga0307415_100013136 | Ga0307415_1000131364 | 138 |
| 211 | 3300035170 | Ga0373943_0681693 | Ga0373943_0681693_145_567 | 138 |
| 212 | 3300041486 | Ga0451807_0616362 | Ga0451807_0616362_189_605 | 138 |
| 213 | 3300041494 | Ga0451837_1605580 | Ga0451837_1605580_619_1035 | 138 |
| 214 | 3300041496 | Ga0451839_0704564 | Ga0451839_0704564_45_461 | 138 |
| 215 | 3300041512 | Ga0451853_1538364 | Ga0451853_1538364_306_728 | 138 |
| 216 | 3300046616 | Ga0495668_0001246 | Ga0495668_0001246_11130_11549 | 138 |
| 217 | 3300047320 | Ga0495672_0357305 | Ga0495672_0357305_67_483 | 138 |
| 218 | 3300047471 | Ga0495684_0889207 | Ga0495684_0889207_80_499 | 138 |
| 219 | 3300049580 | Ga0501046_0136130 | Ga0501046_0136130_479_904 | 138 |
| 220 | 3300049581 | Ga0501047_0113778 | Ga0501047_0113778_2133_2558 | 138 |
| 221 | 3300049649 | Ga0501198_068338 | Ga0501198_068338_232_651 | 138 |
| 222 | 3300049672 | Ga0501239_015282 | Ga0501239_015282_391_810 | 138 |
| 223 | 3300049686 | Ga0501257_043849 | Ga0501257_043849_457_876 | 138 |
| 224 | 3300049763 | Ga0501266_024690 | Ga0501266_024690_30_449 | 138 |
| 225 | 3300049769 | Ga0501272_059112 | Ga0501272_059112_55_474 | 138 |
| 226 | 3300049770 | Ga0501273_020402 | Ga0501273_020402_342_761 | 138 |
| 227 | 3300050511 | nmdc:mga08y16_1665732_c1 | nmdc:mga08y16_1665732_c1_71_487 | 138 |
| 228 | 3300060353 | Ga0501082_0585465 | Ga0501082_0585465_281_703 | 138 |
| 229 | 3300001978 | JGI24747J21853_1001606 | JGI24747J21853_10016063 | 139 |
| 230 | 3300001989 | JGI24739J22299_10083034 | JGI24739J22299_100830342 | 139 |
| 231 | 3300001990 | JGI24737J22298_10014448 | JGI24737J22298_100144483 | 139 |
| 232 | 3300002074 | JGI24748J21848_1000717 | JGI24748J21848_10007174 | 139 |
| 233 | 3300002076 | JGI24749J21850_1001969 | JGI24749J21850_10019694 | 139 |
| 234 | 3300002077 | JGI24744J21845_10011636 | JGI24744J21845_100116362 | 139 |
| 235 | 3300002239 | JGI24034J26672_10000720 | JGI24034J26672_100007204 | 139 |
| 236 | 3300003659 | JGI25404J52841_10004682 | JGI25404J52841_100046823 | 139 |
| 237 | 3300005290 | Ga0065712_10141030 | Ga0065712_101410302 | 139 |
| 238 | 3300005293 | Ga0065715_10162607 | Ga0065715_101626073 | 139 |
| 239 | 3300005295 | Ga0065707_10173559 | Ga0065707_101735592 | 139 |
| 240 | 3300005327 | Ga0070658_10001254 | Ga0070658_100012541 | 139 |
| 241 | 3300005328 | Ga0070676_10003356 | Ga0070676_100033566 | 139 |
| 242 | 3300005329 | Ga0070683_100001622 | Ga0070683_10000162213 | 139 |
| 243 | 3300005329 | Ga0070683_100191096 | Ga0070683_1001910962 | 139 |
| 244 | 3300005330 | Ga0070690_100000327 | Ga0070690_10000032724 | 139 |
| 245 | 3300005331 | Ga0070670_100013423 | Ga0070670_1000134235 | 139 |
| 246 | 3300005333 | Ga0070677_10000209 | Ga0070677_100002099 | 139 |
| 247 | 3300005334 | Ga0068869_100000286 | Ga0068869_10000028627 | 139 |
| 248 | 3300005335 | Ga0070666_10000805 | Ga0070666_1000080518 | 139 |
| 249 | 3300005336 | Ga0070680_100002873 | Ga0070680_1000028736 | 139 |
| 250 | 3300005338 | Ga0068868_100000557 | Ga0068868_10000055725 | 139 |
| 251 | 3300005338 | Ga0068868_100002964 | Ga0068868_1000029643 | 139 |
| 252 | 3300005339 | Ga0070660_100000479 | Ga0070660_10000047927 | 139 |
| 253 | 3300005340 | Ga0070689_100000344 | Ga0070689_10000034427 | 139 |
| 254 | 3300005340 | Ga0070689_100061892 | Ga0070689_1000618922 | 139 |
| 255 | 3300005340 | Ga0070689_100394678 | Ga0070689_1003946782 | 139 |
| 256 | 3300005341 | Ga0070691_10043824 | Ga0070691_100438242 | 139 |
| 257 | 3300005343 | Ga0070687_100000032 | Ga0070687_10000003221 | 139 |
| 258 | 3300005344 | Ga0070661_100000412 | Ga0070661_10000041225 | 139 |
| 259 | 3300005344 | Ga0070661_100001964 | Ga0070661_10000196415 | 139 |
| 260 | 3300005344 | Ga0070661_100537879 | Ga0070661_1005378792 | 139 |
| 261 | 3300005345 | Ga0070692_10013772 | Ga0070692_100137723 | 139 |
| 262 | 3300005347 | Ga0070668_100000345 | Ga0070668_10000034512 | 139 |
| 263 | 3300005353 | Ga0070669_100000307 | Ga0070669_10000030720 | 139 |
| 264 | 3300005354 | Ga0070675_100001155 | Ga0070675_10000115518 | 139 |
| 265 | 3300005355 | Ga0070671_100003430 | Ga0070671_1000034303 | 139 |
| 266 | 3300005355 | Ga0070671_100014228 | Ga0070671_1000142284 | 139 |
| 267 | 3300005356 | Ga0070674_100000600 | Ga0070674_1000006005 | 139 |
| 268 | 3300005364 | Ga0070673_100001765 | Ga0070673_10000176512 | 139 |
| 269 | 3300005365 | Ga0070688_100000122 | Ga0070688_10000012221 | 139 |
| 270 | 3300005365 | Ga0070688_100006427 | Ga0070688_1000064272 | 139 |
| 271 | 3300005366 | Ga0070659_100000635 | Ga0070659_1000006356 | 139 |
| 272 | 3300005367 | Ga0070667_100008888 | Ga0070667_1000088887 | 139 |
| 273 | 3300005367 | Ga0070667_100064873 | Ga0070667_1000648732 | 139 |
| 274 | 3300005436 | Ga0070713_100333705 | Ga0070713_1003337052 | 139 |
| 275 | 3300005438 | Ga0070701_10013876 | Ga0070701_100138763 | 139 |
| 276 | 3300005439 | Ga0070711_100213767 | Ga0070711_1002137673 | 139 |
| 277 | 3300005440 | Ga0070705_100000279 | Ga0070705_10000027929 | 139 |
| 278 | 3300005440 | Ga0070705_100195785 | Ga0070705_1001957852 | 139 |
| 279 | 3300005455 | Ga0070663_100000597 | Ga0070663_1000005975 | 139 |
| 280 | 3300005456 | Ga0070678_100002705 | Ga0070678_1000027056 | 139 |
| 281 | 3300005456 | Ga0070678_100143443 | Ga0070678_1001434433 | 139 |
| 282 | 3300005457 | Ga0070662_100000190 | Ga0070662_10000019024 | 139 |
| 283 | 3300005458 | Ga0070681_10395984 | Ga0070681_103959842 | 139 |
| 284 | 3300005459 | Ga0068867_100003036 | Ga0068867_1000030364 | 139 |
| 285 | 3300005466 | Ga0070685_10000369 | Ga0070685_100003696 | 139 |
| 286 | 3300005466 | Ga0070685_10003127 | Ga0070685_100031273 | 139 |
| 287 | 3300005530 | Ga0070679_100525456 | Ga0070679_1005254562 | 139 |
| 288 | 3300005535 | Ga0070684_100014406 | Ga0070684_1000144065 | 139 |
| 289 | 3300005535 | Ga0070684_100115556 | Ga0070684_1001155563 | 139 |
| 290 | 3300005535 | Ga0070684_100117499 | Ga0070684_1001174993 | 139 |
| 291 | 3300005539 | Ga0068853_100000259 | Ga0068853_10000025925 | 139 |
| 292 | 3300005539 | Ga0068853_100020356 | Ga0068853_1000203564 | 139 |
| 293 | 3300005543 | Ga0070672_100000406 | Ga0070672_1000004066 | 139 |
| 294 | 3300005544 | Ga0070686_100000081 | Ga0070686_10000008127 | 139 |
| 295 | 3300005544 | Ga0070686_100192419 | Ga0070686_1001924192 | 139 |
| 296 | 3300005545 | Ga0070695_100275547 | Ga0070695_1002755472 | 139 |
| 297 | 3300005546 | Ga0070696_100523859 | Ga0070696_1005238591 | 139 |
| 298 | 3300005547 | Ga0070693_100010235 | Ga0070693_1000102352 | 139 |
| 299 | 3300005548 | Ga0070665_100010946 | Ga0070665_1000109465 | 139 |
| 300 | 3300005549 | Ga0070704_100039510 | Ga0070704_1000395102 | 139 |
| 301 | 3300005563 | Ga0068855_100001159 | Ga0068855_1000011596 | 139 |
| 302 | 3300005564 | Ga0070664_100001026 | Ga0070664_10000102612 | 139 |
| 303 | 3300005564 | Ga0070664_100001532 | Ga0070664_10000153219 | 139 |
| 304 | 3300005564 | Ga0070664_100211844 | Ga0070664_1002118442 | 139 |
| 305 | 3300005577 | Ga0068857_100001061 | Ga0068857_10000106121 | 139 |
| 306 | 3300005577 | Ga0068857_100003310 | Ga0068857_1000033105 | 139 |
| 307 | 3300005578 | Ga0068854_100000223 | Ga0068854_10000022320 | 139 |
| 308 | 3300005578 | Ga0068854_100414154 | Ga0068854_1004141542 | 139 |
| 309 | 3300005614 | Ga0068856_100005028 | Ga0068856_1000050286 | 139 |
| 310 | 3300005615 | Ga0070702_100000849 | Ga0070702_1000008495 | 139 |
| 311 | 3300005615 | Ga0070702_100037042 | Ga0070702_1000370424 | 139 |
| 312 | 3300005616 | Ga0068852_100000420 | Ga0068852_1000004207 | 139 |
| 313 | 3300005617 | Ga0068859_100006848 | Ga0068859_1000068483 | 139 |
| 314 | 3300005617 | Ga0068859_100010357 | Ga0068859_1000103576 | 139 |
| 315 | 3300005618 | Ga0068864_100004095 | Ga0068864_10000409512 | 139 |
| 316 | 3300005718 | Ga0068866_10000018 | Ga0068866_100000187 | 139 |
| 317 | 3300005719 | Ga0068861_100000738 | Ga0068861_1000007385 | 139 |
| 318 | 3300005719 | Ga0068861_100507398 | Ga0068861_1005073982 | 139 |
| 319 | 3300005834 | Ga0068851_10000206 | Ga0068851_100002069 | 139 |
| 320 | 3300005840 | Ga0068870_10000033 | Ga0068870_1000003330 | 139 |
| 321 | 3300005841 | Ga0068863_100000937 | Ga0068863_10000093726 | 139 |
| 322 | 3300005842 | Ga0068858_100009300 | Ga0068858_1000093006 | 139 |
| 323 | 3300005843 | Ga0068860_100002378 | Ga0068860_10000237819 | 139 |
| 324 | 3300005844 | Ga0068862_100000659 | Ga0068862_10000065930 | 139 |
| 325 | 3300005937 | Ga0081455_10250594 | Ga0081455_102505943 | 139 |
| 326 | 3300005983 | Ga0081540_1000141 | Ga0081540_100014142 | 139 |
| 327 | 3300005983 | Ga0081540_1000258 | Ga0081540_100025835 | 139 |
| 328 | 3300005983 | Ga0081540_1003160 | Ga0081540_10031605 | 139 |
| 329 | 3300006175 | Ga0070712_100675148 | Ga0070712_1006751482 | 139 |
| 330 | 3300006237 | Ga0097621_100000812 | Ga0097621_1000008122 | 139 |
| 331 | 3300006237 | Ga0097621_100030223 | Ga0097621_1000302237 | 139 |
| 332 | 3300006358 | Ga0068871_100000098 | Ga0068871_10000009830 | 139 |
| 333 | 3300006844 | Ga0075428_102410331 | Ga0075428_1024103311 | 139 |
| 334 | 3300006881 | Ga0068865_100000442 | Ga0068865_10000044219 | 139 |
| 335 | 3300006931 | Ga0097620_100006848 | Ga0097620_10000684811 | 139 |
| 336 | 3300006931 | Ga0097620_100010356 | Ga0097620_1000103566 | 139 |
| 337 | 3300007076 | Ga0075435_100172002 | Ga0075435_1001720022 | 139 |
| 338 | 3300009011 | Ga0105251_10403807 | Ga0105251_104038072 | 139 |
| 339 | 3300009094 | Ga0111539_10734943 | Ga0111539_107349431 | 139 |
| 340 | 3300009101 | Ga0105247_10150749 | Ga0105247_101507493 | 139 |
| 341 | 3300009148 | Ga0105243_10876152 | Ga0105243_108761522 | 139 |
| 342 | 3300009174 | Ga0105241_11443901 | Ga0105241_114439011 | 139 |
| 343 | 3300009176 | Ga0105242_10013836 | Ga0105242_100138365 | 139 |
| 344 | 3300009177 | Ga0105248_11661553 | Ga0105248_116615531 | 139 |
| 345 | 3300013102 | Ga0157371_10306352 | Ga0157371_103063522 | 139 |
| 346 | 3300013296 | Ga0157374_10042545 | Ga0157374_100425456 | 139 |
| 347 | 3300013297 | Ga0157378_10038348 | Ga0157378_100383484 | 139 |
| 348 | 3300013306 | Ga0163162_10015627 | Ga0163162_100156275 | 139 |
| 349 | 3300013307 | Ga0157372_11214980 | Ga0157372_112149801 | 139 |
| 350 | 3300013308 | Ga0157375_10038134 | Ga0157375_100381343 | 139 |
| 351 | 3300014325 | Ga0163163_10010007 | Ga0163163_100100074 | 139 |
| 352 | 3300017792 | Ga0163161_10038345 | Ga0163161_100383453 | 139 |
| 353 | 3300021377 | Ga0213874_10050054 | Ga0213874_100500543 | 139 |
| 354 | 3300025315 | Ga0207697_10001247 | Ga0207697_100012477 | 139 |
| 355 | 3300025321 | Ga0207656_10001481 | Ga0207656_100014819 | 139 |
| 356 | 3300025711 | Ga0207696_1086637 | Ga0207696_10866372 | 139 |
| 357 | 3300025893 | Ga0207682_10001691 | Ga0207682_100016919 | 139 |
| 358 | 3300025899 | Ga0207642_10000386 | Ga0207642_100003863 | 139 |
| 359 | 3300025900 | Ga0207710_10001837 | Ga0207710_1000183712 | 139 |
| 360 | 3300025900 | Ga0207710_10128523 | Ga0207710_101285232 | 139 |
| 361 | 3300025901 | Ga0207688_10000100 | Ga0207688_1000010025 | 139 |
| 362 | 3300025903 | Ga0207680_10000207 | Ga0207680_100002079 | 139 |
| 363 | 3300025903 | Ga0207680_10235738 | Ga0207680_102357382 | 139 |
| 364 | 3300025904 | Ga0207647_10001302 | Ga0207647_1000130214 | 139 |
| 365 | 3300025907 | Ga0207645_10000386 | Ga0207645_100003869 | 139 |
| 366 | 3300025908 | Ga0207643_10000002 | Ga0207643_10000002167 | 139 |
| 367 | 3300025909 | Ga0207705_10434375 | Ga0207705_104343751 | 139 |
| 368 | 3300025911 | Ga0207654_10004228 | Ga0207654_100042287 | 139 |
| 369 | 3300025912 | Ga0207707_10077681 | Ga0207707_100776812 | 139 |
| 370 | 3300025913 | Ga0207695_10043836 | Ga0207695_100438362 | 139 |
| 371 | 3300025913 | Ga0207695_10525955 | Ga0207695_105259552 | 139 |
| 372 | 3300025914 | Ga0207671_10000756 | Ga0207671_1000075621 | 139 |
| 373 | 3300025915 | Ga0207693_10647017 | Ga0207693_106470172 | 139 |
| 374 | 3300025916 | Ga0207663_10703922 | Ga0207663_107039222 | 139 |
| 375 | 3300025917 | Ga0207660_10072347 | Ga0207660_100723473 | 139 |
| 376 | 3300025918 | Ga0207662_10000011 | Ga0207662_1000001135 | 139 |
| 377 | 3300025919 | Ga0207657_10000607 | Ga0207657_1000060733 | 139 |
| 378 | 3300025920 | Ga0207649_10000627 | Ga0207649_100006275 | 139 |
| 379 | 3300025920 | Ga0207649_10002450 | Ga0207649_1000245011 | 139 |
| 380 | 3300025920 | Ga0207649_10436449 | Ga0207649_104364492 | 139 |
| 381 | 3300025920 | Ga0207649_10885504 | Ga0207649_108855041 | 139 |
| 382 | 3300025923 | Ga0207681_10000108 | Ga0207681_1000010855 | 139 |
| 383 | 3300025924 | Ga0207694_10007411 | Ga0207694_100074116 | 139 |
| 384 | 3300025925 | Ga0207650_10000349 | Ga0207650_1000034932 | 139 |
| 385 | 3300025926 | Ga0207659_10000123 | Ga0207659_1000012333 | 139 |
| 386 | 3300025927 | Ga0207687_10003914 | Ga0207687_100039147 | 139 |
| 387 | 3300025928 | Ga0207700_10038833 | Ga0207700_100388334 | 139 |
| 388 | 3300025931 | Ga0207644_10000565 | Ga0207644_1000056524 | 139 |
| 389 | 3300025931 | Ga0207644_10038923 | Ga0207644_100389235 | 139 |
| 390 | 3300025931 | Ga0207644_10626306 | Ga0207644_106263062 | 139 |
| 391 | 3300025932 | Ga0207690_10001018 | Ga0207690_100010184 | 139 |
| 392 | 3300025933 | Ga0207706_10000078 | Ga0207706_1000007831 | 139 |
| 393 | 3300025934 | Ga0207686_10005642 | Ga0207686_100056423 | 139 |
| 394 | 3300025934 | Ga0207686_10613968 | Ga0207686_106139682 | 139 |
| 395 | 3300025935 | Ga0207709_10035162 | Ga0207709_100351623 | 139 |
| 396 | 3300025936 | Ga0207670_10000224 | Ga0207670_100002249 | 139 |
| 397 | 3300025936 | Ga0207670_10029508 | Ga0207670_100295085 | 139 |
| 398 | 3300025936 | Ga0207670_10366866 | Ga0207670_103668662 | 139 |
| 399 | 3300025937 | Ga0207669_10002589 | Ga0207669_100025895 | 139 |
| 400 | 3300025938 | Ga0207704_10000199 | Ga0207704_100001999 | 139 |
| 401 | 3300025940 | Ga0207691_10000389 | Ga0207691_1000038917 | 139 |
| 402 | 3300025941 | Ga0207711_10001003 | Ga0207711_1000100327 | 139 |
| 403 | 3300025941 | Ga0207711_10002221 | Ga0207711_100022219 | 139 |
| 404 | 3300025941 | Ga0207711_11940229 | Ga0207711_119402291 | 139 |
| 405 | 3300025942 | Ga0207689_10000523 | Ga0207689_100005239 | 139 |
| 406 | 3300025944 | Ga0207661_10002620 | Ga0207661_100026204 | 139 |
| 407 | 3300025944 | Ga0207661_10107033 | Ga0207661_101070332 | 139 |
| 408 | 3300025945 | Ga0207679_10000442 | Ga0207679_100004427 | 139 |
| 409 | 3300025945 | Ga0207679_10003533 | Ga0207679_100035337 | 139 |
| 410 | 3300025945 | Ga0207679_10071960 | Ga0207679_100719603 | 139 |
| 411 | 3300025949 | Ga0207667_10011534 | Ga0207667_100115349 | 139 |
| 412 | 3300025960 | Ga0207651_10000020 | Ga0207651_1000002027 | 139 |
| 413 | 3300025961 | Ga0207712_10000666 | Ga0207712_1000066628 | 139 |
| 414 | 3300025972 | Ga0207668_10228178 | Ga0207668_102281782 | 139 |
| 415 | 3300025981 | Ga0207640_10000302 | Ga0207640_100003022 | 139 |
| 416 | 3300025981 | Ga0207640_10583028 | Ga0207640_105830282 | 139 |
| 417 | 3300025986 | Ga0207658_10000437 | Ga0207658_1000043717 | 139 |
| 418 | 3300025986 | Ga0207658_10029516 | Ga0207658_100295165 | 139 |
| 419 | 3300026023 | Ga0207677_10000079 | Ga0207677_1000007951 | 139 |
| 420 | 3300026035 | Ga0207703_10000148 | Ga0207703_1000014819 | 139 |
| 421 | 3300026035 | Ga0207703_10000236 | Ga0207703_100002365 | 139 |
| 422 | 3300026035 | Ga0207703_10022917 | Ga0207703_100229172 | 139 |
| 423 | 3300026041 | Ga0207639_10000609 | Ga0207639_1000060925 | 139 |
| 424 | 3300026041 | Ga0207639_10006727 | Ga0207639_100067275 | 139 |
| 425 | 3300026067 | Ga0207678_10001757 | Ga0207678_100017576 | 139 |
| 426 | 3300026078 | Ga0207702_10009610 | Ga0207702_100096106 | 139 |
| 427 | 3300026078 | Ga0207702_10905682 | Ga0207702_109056822 | 139 |
| 428 | 3300026088 | Ga0207641_10016042 | Ga0207641_100160427 | 139 |
| 429 | 3300026088 | Ga0207641_10030088 | Ga0207641_100300883 | 139 |
| 430 | 3300026089 | Ga0207648_10000497 | Ga0207648_1000049717 | 139 |
| 431 | 3300026089 | Ga0207648_10963701 | Ga0207648_109637011 | 139 |
| 432 | 3300026095 | Ga0207676_10000636 | Ga0207676_100006365 | 139 |
| 433 | 3300026095 | Ga0207676_10004297 | Ga0207676_100042972 | 139 |
| 434 | 3300026116 | Ga0207674_10000427 | Ga0207674_1000042735 | 139 |
| 435 | 3300026116 | Ga0207674_10001529 | Ga0207674_100015295 | 139 |
| 436 | 3300026118 | Ga0207675_100000006 | Ga0207675_10000000627 | 139 |
| 437 | 3300026121 | Ga0207683_10000589 | Ga0207683_1000058933 | 139 |
| 438 | 3300026121 | Ga0207683_10180310 | Ga0207683_101803103 | 139 |
| 439 | 3300026121 | Ga0207683_10197510 | Ga0207683_101975101 | 139 |
| 440 | 3300026142 | Ga0207698_10000382 | Ga0207698_1000038228 | 139 |
| 441 | 3300028379 | Ga0268266_10000687 | Ga0268266_1000068717 | 139 |
| 442 | 3300028380 | Ga0268265_10001081 | Ga0268265_1000108126 | 139 |
| 443 | 3300028381 | Ga0268264_10000705 | Ga0268264_1000070517 | 139 |
| 444 | 3300031852 | Ga0307410_10009777 | Ga0307410_100097775 | 139 |
| 445 | 3300031852 | Ga0307410_11255698 | Ga0307410_112556981 | 139 |
| 446 | 3300031901 | Ga0307406_10660201 | Ga0307406_106602012 | 139 |
| 447 | 3300031903 | Ga0307407_10085155 | Ga0307407_100851552 | 139 |
| 448 | 3300031911 | Ga0307412_10054463 | Ga0307412_100544631 | 139 |
| 449 | 3300032002 | Ga0307416_100079109 | Ga0307416_1000791091 | 139 |
| 450 | 3300032005 | Ga0307411_10068429 | Ga0307411_100684292 | 139 |
| 451 | 3300032005 | Ga0307411_10201339 | Ga0307411_102013392 | 139 |
| 452 | 3300032126 | Ga0307415_100167250 | Ga0307415_1001672502 | 139 |
| 453 | 3300035083 | Ga0373926_0160987 | Ga0373926_0160987_21_452 | 139 |
| 454 | 3300035085 | Ga0373929_0159636 | Ga0373929_0159636_34_453 | 139 |
| 455 | 3300036401 | Ga0373937_0169878 | Ga0373937_0169878_362_781 | 139 |
| 456 | 3300039438 | Ga0436360_0998048 | Ga0436360_0998048_290_709 | 139 |
| 457 | 3300042005 | Ga0439448_0024925 | Ga0439448_0024925_534_953 | 139 |
| 458 | 3300042012 | Ga0439455_0018316 | Ga0439455_0018316_919_1338 | 139 |
| 459 | 3300042157 | Ga0439458_0025879 | Ga0439458_0025879_412_831 | 139 |
| 460 | 3300042437 | Ga0439444_0073343 | Ga0439444_0073343_277_696 | 139 |
| 461 | 3300042876 | Ga0451577_0049141 | Ga0451577_0049141_1118_1537 | 139 |
| 462 | 3300044673 | Ga0453683_0463980 | Ga0453683_0463980_23_442 | 139 |
| 463 | 3300044712 | Ga0453684_1465337 | Ga0453684_1465337_197_616 | 139 |
| 464 | 3300045051 | Ga0451576_0014574 | Ga0451576_0014574_2841_3260 | 139 |
| 465 | 3300045051 | Ga0451576_2154280 | Ga0451576_2154280_22_447 | 139 |
| 466 | 3300046689 | Ga0495613_0218704 | Ga0495613_0218704_548_967 | 139 |
| 467 | 3300048904 | Ga0496101_0181012 | Ga0496101_0181012_1168_1593 | 139 |
| 468 | 3300048904 | Ga0496101_0291299 | Ga0496101_0291299_609_1028 | 139 |
| 469 | 3300048905 | Ga0496102_0000795 | Ga0496102_0000795_8239_8658 | 139 |
| 470 | 3300048907 | Ga0496104_0158071 | Ga0496104_0158071_662_1087 | 139 |
| 471 | 3300048907 | Ga0496104_0191104 | Ga0496104_0191104_207_626 | 139 |
| 472 | 3300048909 | Ga0496106_0000648 | Ga0496106_0000648_8920_9339 | 139 |
| 473 | 3300048910 | Ga0496107_0235819 | Ga0496107_0235819_92_511 | 139 |
| 474 | 3300048911 | Ga0496108_0025501 | Ga0496108_0025501_1668_2087 | 139 |
| 475 | 3300048912 | Ga0496109_0020726 | Ga0496109_0020726_1793_2212 | 139 |
| 476 | 3300048912 | Ga0496109_0206018 | Ga0496109_0206018_977_1402 | 139 |
| 477 | 3300048915 | Ga0496112_0000385 | Ga0496112_0000385_6666_7085 | 139 |
| 478 | 3300048916 | Ga0496113_0102667 | Ga0496113_0102667_1659_2078 | 139 |
| 479 | 3300048917 | Ga0496114_0685335 | Ga0496114_0685335_202_627 | 139 |
| 480 | 3300048917 | Ga0496114_0814574 | Ga0496114_0814574_293_712 | 139 |
| 481 | 3300048918 | Ga0496115_0413236 | Ga0496115_0413236_500_919 | 139 |
| 482 | 3300050511 | nmdc:mga08y16_572646_c1 | nmdc:mga08y16_572646_c1_42_461 | 139 |
| 483 | 3300050512 | nmdc:mga0n895_783139_c1 | nmdc:mga0n895_783139_c1_70_489 | 139 |
| 484 | 3300050513 | nmdc:mga0rr50_120422_c1 | nmdc:mga0rr50_120422_c1_1045_1464 | 139 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3quw-assembly1.cif.gz_A | crystal structure of yeast mmf1 | 0.9509 | 4 | 138 |
| 2dyy-assembly2.cif.gz_E | crystal structure of putative translation initiation inhibitor ph0854 from pyrococcus horikoshii | 0.9504 | 1 | 136 |
| 3l7q-assembly2.cif.gz_E | crystal structure of aldr from streptococcus mutans | 0.943 | 4 | 138 |
| 3m1x-assembly1.cif.gz_A | crystal structure of a putative endoribonuclease l-psp from entamoeba histolytica, rhomobohedral form | 0.9397 | 4 | 137 |
| 5v4d-assembly2.cif.gz_F | crystal structure of the protein of unknown function of the conserved rid protein family yyfa from yersinia pestis | 0.9385 | 4 | 137 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5hp8A00 | Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like | 0.9403 | 19 | 137 | 3.30.1330.40 |
| 3m1xA00 | Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like | 0.9397 | 4 | 137 | 3.30.1330.40 |
| 3k0tB00 | Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like | 0.9388 | 4 | 137 | 3.30.1330.40 |
| 2dyyG00 | Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like | 0.9382 | 4 | 138 | 3.30.1330.40 |
| af_Q86KR5_2_129_3.30.1330.40 | Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like | 0.9376 | 4 | 138 | 3.30.1330.40 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A5C6QRB9-F1-model_v4 | RidA family protein | 0.9909 | 4 | 139 |
GO:0005829
GO:0019239 |
| AF-A0A328BJP6-F1-model_v4 | RidA family protein | 0.9904 | 4 | 139 |
GO:0005829
GO:0019239 |
| AF-A0A2E0D955-F1-model_v4 | deleted | 0.9882 | 2 | 137 |
|
| AF-Q08XM2-F1-model_v4 | Endoribonuclease L-PSP family | 0.9864 | 3 | 139 |
GO:0005829
GO:0019239 |
| AF-J0V3C2-F1-model_v4 | 2-aminomuconate deaminase | 0.9833 | 1 | 138 |
GO:0005829
GO:0019239 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar