F452897
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 484 | 266 | 472 | 283 |
Family's Representative Sequence
| Representative Sequence | 3300005548|Ga0070665_100043091|Ga0070665_1000430914 |
| Length | 333 |
| Sequence | VPKLYAGVQWRGHVSFLAVMQQAETIIFRAQLAVLLCRRASEERRFSYVWEDMAEFLSLAEAVDRNLNDGDIVAFEGFTHLIPHAAAHEAIRQGKKDLTLLRMTPDIIYDQMIGMGLAKKVIFSYAGNPGVGLLRRMRDAIENGYPRGIETVEHSHSAMAQAYEAGASGLPLALFRGYKGADLAKVNPDIRAIACPFTGEELAAIPAHRPDVTFIHAQKASRKGDVLIEGIIGVQKEAALAAKRVVVTVEEVVDDFKGFHPNLCILPHWTIDAIAVVPGGAHPSYAYGYYQRDNAAYLEWDKVSADRELFSAWIMENVMAVGPDAFAARVRDL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501114 | Microvirga lotononidis WSM3557 | Isolate | Nodule |
| 2 | 2643221551 | Mesorhizobium sp. Root1471 | Isolate | Unclassified |
| 3 | 2643221555 | Mesorhizobium sp. Root554 | Isolate | Unclassified |
| 4 | 2773857925 | Microvirga vignae BR3299 | Isolate | Unclassified |
| 5 | 2775506901 | Microvirga ossetica V5/3m | Isolate | Unclassified |
| 6 | 2835312727 | Microvirga calopogonii CCBAU 65841 | Isolate | Nodule |
| 7 | 2882456835 | Microvirga sp. KLBC 81 | Isolate | Unclassified |
| 8 | 2884298095 | Microvirga thermotolerans HR1 | Isolate | Rhizosphere |
| 9 | 2888343758 | Mesorhizobium sp. AA22 | Isolate | Unclassified |
| 10 | 2894232714 | Microvirga tunisiensis Lmie10 | Isolate | Nodule |
| 11 | 3004334049 | Mesorhizobium huakuii 583 | Isolate | Unclassified |
| 12 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 13 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 14 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 21 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 43 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 47 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 49 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 50 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 51 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 52 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 53 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 54 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 55 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 56 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 57 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 59 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 63 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 64 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 89 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 90 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 91 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 92 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 142 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 145 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 146 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 147 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 148 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 149 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 150 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 151 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 152 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 153 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 154 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 155 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 156 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 157 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 158 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 159 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 160 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 161 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 162 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 163 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 164 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 165 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 166 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 167 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 168 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 169 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 170 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 171 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 172 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 173 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 174 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 175 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 176 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 177 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 178 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 179 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 180 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 181 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 182 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 183 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 184 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 185 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 186 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 187 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 188 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 189 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 190 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 191 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 220 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 221 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 222 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 223 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 224 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 225 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 226 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 227 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 228 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 229 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 230 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 231 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 232 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 233 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 234 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 235 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 236 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 237 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 238 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 239 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 240 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 241 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 242 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 243 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 244 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 245 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 246 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 247 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 248 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 249 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 250 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 251 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 252 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 253 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 258 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 259 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 260 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 261 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 262 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 263 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 264 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 265 | 8045864390 | Aurantimonas endophytica KCTC 52296 | Isolate | Unclassified |
| 266 | 8057160832 | Larsenimonas rhizosphaerae GH2-1 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.31 |
| Metatranscriptomes | 0 |
| Isolates | 2.69 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.31 |
| Nodule | 0.62 |
| Rhizoplane | 1.03 |
| Rhizosphere | 92.56 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.48 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25151J46595_10000149 | 3300003187 | Bacteria | 91894 |
| 2 | rootH1_10098140 | 3300003316 | Unclassified | 2001 |
| 3 | rootH1_10098140 | 3300003323 | Bacteria | 4018 |
| 4 | Ga0070658_10047509 | 3300005327 | Bacteria | 3474 |
| 5 | Ga0070683_100000407 | 3300005329 | Bacteria | 29702 |
| 6 | Ga0070683_100014241 | 3300005329 | Bacteria | 6951 |
| 7 | Ga0070683_100042834 | 3300005329 | Bacteria | 4170 |
| 8 | Ga0070690_100092798 | 3300005330 | Bacteria | 1991 |
| 9 | Ga0070670_100069527 | 3300005331 | Bacteria | 3022 |
| 10 | Ga0070680_100003368 | 3300005336 | Bacteria | 11929 |
| 11 | Ga0070680_100237958 | 3300005336 | Bacteria | 1538 |
| 12 | Ga0070682_100092142 | 3300005337 | Bacteria | 1985 |
| 13 | Ga0068868_100080907 | 3300005338 | Bacteria | 2604 |
| 14 | Ga0070660_100205295 | 3300005339 | Bacteria | 1599 |
| 15 | Ga0070689_100049793 | 3300005340 | Bacteria | 3235 |
| 16 | Ga0070691_10000505 | 3300005341 | Bacteria | 14641 |
| 17 | Ga0070661_100000540 | 3300005344 | Bacteria | 28990 |
| 18 | Ga0070661_100011131 | 3300005344 | Bacteria | 6265 |
| 19 | Ga0070661_100035485 | 3300005344 | Bacteria | 3621 |
| 20 | Ga0070668_100042325 | 3300005347 | Bacteria | 3491 |
| 21 | Ga0070668_100209142 | 3300005347 | Bacteria | 1604 |
| 22 | Ga0070668_100488873 | 3300005347 | Bacteria | 1064 |
| 23 | Ga0070671_100250530 | 3300005355 | Bacteria | 1504 |
| 24 | Ga0070671_100299929 | 3300005355 | Bacteria | 1368 |
| 25 | Ga0070673_100055058 | 3300005364 | Bacteria | 3133 |
| 26 | Ga0070659_100002010 | 3300005366 | Bacteria | 14532 |
| 27 | Ga0070659_100053804 | 3300005366 | Bacteria | 3169 |
| 28 | Ga0070659_100087481 | 3300005366 | Bacteria | 2494 |
| 29 | Ga0070667_100139672 | 3300005367 | Bacteria | 2120 |
| 30 | Ga0070709_10028528 | 3300005434 | Bacteria | 3329 |
| 31 | Ga0070709_10165279 | 3300005434 | Bacteria | 1542 |
| 32 | Ga0070709_10219003 | 3300005434 | Bacteria | 1356 |
| 33 | Ga0070714_100000313 | 3300005435 | Bacteria | 36745 |
| 34 | Ga0070714_100040448 | 3300005435 | Bacteria | 3930 |
| 35 | Ga0070714_100347366 | 3300005435 | Bacteria | 1393 |
| 36 | Ga0070713_100001282 | 3300005436 | Bacteria | 16071 |
| 37 | Ga0070713_100050324 | 3300005436 | Bacteria | 3441 |
| 38 | Ga0070713_100085185 | 3300005436 | Bacteria | 2706 |
| 39 | Ga0070710_10043588 | 3300005437 | Bacteria | 2486 |
| 40 | Ga0070711_100011205 | 3300005439 | Bacteria | 5560 |
| 41 | Ga0070711_100011700 | 3300005439 | Bacteria | 5455 |
| 42 | Ga0070711_100037368 | 3300005439 | Bacteria | 3259 |
| 43 | Ga0070694_100138321 | 3300005444 | Bacteria | 1766 |
| 44 | Ga0070663_100087760 | 3300005455 | Bacteria | 2299 |
| 45 | Ga0070678_100128626 | 3300005456 | Bacteria | 2009 |
| 46 | Ga0070681_10000278 | 3300005458 | Bacteria | 40975 |
| 47 | Ga0070681_10035705 | 3300005458 | Bacteria | 4992 |
| 48 | Ga0070681_10529561 | 3300005458 | Bacteria | 1092 |
| 49 | Ga0070699_100157392 | 3300005518 | Bacteria | 2010 |
| 50 | Ga0070679_100010630 | 3300005530 | Bacteria | 8735 |
| 51 | Ga0070684_100000856 | 3300005535 | Bacteria | 21482 |
| 52 | Ga0070684_100010398 | 3300005535 | Bacteria | 7370 |
| 53 | Ga0070684_100590462 | 3300005535 | Bacteria | 1032 |
| 54 | Ga0068853_100004900 | 3300005539 | Bacteria | 10416 |
| 55 | Ga0068853_100010891 | 3300005539 | Bacteria | 7366 |
| 56 | Ga0068853_100014976 | 3300005539 | Bacteria | 6370 |
| 57 | Ga0068853_100074442 | 3300005539 | Bacteria | 2963 |
| 58 | Ga0068853_100161375 | 3300005539 | Bacteria | 2023 |
| 59 | Ga0070696_100250393 | 3300005546 | Bacteria | 1339 |
| 60 | Ga0070693_100027846 | 3300005547 | Bacteria | 3067 |
| 61 | Ga0070665_100043091 | 3300005548 | Bacteria | 4536 |
| 62 | Ga0070665_100386483 | 3300005548 | Bacteria | 1407 |
| 63 | Ga0068855_100010388 | 3300005563 | Bacteria | 11229 |
| 64 | Ga0068855_100045877 | 3300005563 | Bacteria | 5167 |
| 65 | Ga0068855_100100706 | 3300005563 | Bacteria | 3326 |
| 66 | Ga0068855_100179572 | 3300005563 | Bacteria | 2394 |
| 67 | Ga0068855_100279673 | 3300005563 | Bacteria | 1854 |
| 68 | Ga0070664_100342213 | 3300005564 | Bacteria | 1359 |
| 69 | Ga0070664_100503128 | 3300005564 | Bacteria | 1117 |
| 70 | Ga0068857_100000139 | 3300005577 | Bacteria | 44602 |
| 71 | Ga0068857_100055671 | 3300005577 | Bacteria | 3509 |
| 72 | Ga0068857_100063978 | 3300005577 | Bacteria | 3270 |
| 73 | Ga0068857_100073911 | 3300005577 | Bacteria | 3038 |
| 74 | Ga0068857_100180156 | 3300005577 | Bacteria | 1923 |
| 75 | Ga0068854_100005496 | 3300005578 | Bacteria | 8005 |
| 76 | Ga0068854_100016209 | 3300005578 | Bacteria | 4961 |
| 77 | Ga0068854_100050160 | 3300005578 | Bacteria | 2985 |
| 78 | Ga0068856_100003335 | 3300005614 | Bacteria | 16308 |
| 79 | Ga0068856_100095086 | 3300005614 | Bacteria | 2967 |
| 80 | Ga0068856_100245009 | 3300005614 | Bacteria | 1807 |
| 81 | Ga0068856_100329504 | 3300005614 | Bacteria | 1544 |
| 82 | Ga0068852_100000952 | 3300005616 | Bacteria | 19050 |
| 83 | Ga0068852_100009656 | 3300005616 | Bacteria | 7169 |
| 84 | Ga0068852_100010635 | 3300005616 | Bacteria | 6885 |
| 85 | Ga0068852_100227152 | 3300005616 | Bacteria | 1778 |
| 86 | Ga0068866_10238815 | 3300005718 | Bacteria | 1106 |
| 87 | Ga0068851_10000929 | 3300005834 | Bacteria | 12645 |
| 88 | Ga0068851_10031083 | 3300005834 | Bacteria | 2650 |
| 89 | Ga0068858_100029046 | 3300005842 | Bacteria | 5135 |
| 90 | Ga0068858_100076638 | 3300005842 | Bacteria | 3105 |
| 91 | Ga0068860_100063237 | 3300005843 | Bacteria | 3515 |
| 92 | Ga0081540_1018129 | 3300005983 | Bacteria | 4331 |
| 93 | Ga0070717_10050758 | 3300006028 | Bacteria | 3411 |
| 94 | Ga0075365_10059452 | 3300006038 | Bacteria | 2548 |
| 95 | Ga0075365_10192103 | 3300006038 | Bacteria | 1429 |
| 96 | Ga0075365_10193041 | 3300006038 | Bacteria | 1425 |
| 97 | Ga0070715_10061247 | 3300006163 | Bacteria | 1652 |
| 98 | Ga0070716_100018345 | 3300006173 | Bacteria | 3644 |
| 99 | Ga0070712_100029089 | 3300006175 | Bacteria | 3702 |
| 100 | Ga0070712_100098340 | 3300006175 | Bacteria | 2158 |
| 101 | Ga0070712_100202398 | 3300006175 | Bacteria | 1561 |
| 102 | Ga0068871_100006980 | 3300006358 | Bacteria | 8047 |
| 103 | Ga0068871_100029295 | 3300006358 | Bacteria | 4322 |
| 104 | Ga0068871_100066256 | 3300006358 | Bacteria | 2960 |
| 105 | Ga0068871_100106405 | 3300006358 | Bacteria | 2355 |
| 106 | Ga0068871_100478291 | 3300006358 | Bacteria | 1120 |
| 107 | Ga0075436_100351412 | 3300006914 | Bacteria | 1062 |
| 108 | Ga0075436_100399267 | 3300006914 | Bacteria | 996 |
| 109 | Ga0097620_100004436 | 3300006931 | Bacteria | 14320 |
| 110 | Ga0105240_10006325 | 3300009093 | Bacteria | 17434 |
| 111 | Ga0105240_10034029 | 3300009093 | Bacteria | 6577 |
| 112 | Ga0105240_10187642 | 3300009093 | Bacteria | 2434 |
| 113 | Ga0105240_10267517 | 3300009093 | Bacteria | 1970 |
| 114 | Ga0105240_10284146 | 3300009093 | Bacteria | 1899 |
| 115 | Ga0105240_10340903 | 3300009093 | Bacteria | 1703 |
| 116 | Ga0111539_10000107 | 3300009094 | Bacteria | 89993 |
| 117 | Ga0105245_10010569 | 3300009098 | Bacteria | 8030 |
| 118 | Ga0114129_10877797 | 3300009147 | Bacteria | 1138 |
| 119 | Ga0105243_10118887 | 3300009148 | Bacteria | 2225 |
| 120 | Ga0105241_10000274 | 3300009174 | Bacteria | 38434 |
| 121 | Ga0105241_10083233 | 3300009174 | Bacteria | 2510 |
| 122 | Ga0105241_10159343 | 3300009174 | Bacteria | 1854 |
| 123 | Ga0105242_10052908 | 3300009176 | Bacteria | 3314 |
| 124 | Ga0105242_10133019 | 3300009176 | Bacteria | 2149 |
| 125 | Ga0105242_10365068 | 3300009176 | Bacteria | 1337 |
| 126 | Ga0105248_10001455 | 3300009177 | Bacteria | 26372 |
| 127 | Ga0105248_10004780 | 3300009177 | Bacteria | 14992 |
| 128 | Ga0105237_10000301 | 3300009545 | Bacteria | 68372 |
| 129 | Ga0105237_10020637 | 3300009545 | Bacteria | 6788 |
| 130 | Ga0105237_10047466 | 3300009545 | Bacteria | 4317 |
| 131 | Ga0105237_10160946 | 3300009545 | Bacteria | 2243 |
| 132 | Ga0105237_10396627 | 3300009545 | Bacteria | 1384 |
| 133 | Ga0105238_10001117 | 3300009551 | Bacteria | 27102 |
| 134 | Ga0105238_10005017 | 3300009551 | Bacteria | 13083 |
| 135 | Ga0105238_10007723 | 3300009551 | Bacteria | 10752 |
| 136 | Ga0105238_10009735 | 3300009551 | Bacteria | 9624 |
| 137 | Ga0105238_10033018 | 3300009551 | Bacteria | 5267 |
| 138 | Ga0105238_10076576 | 3300009551 | Bacteria | 3336 |
| 139 | Ga0105238_10145961 | 3300009551 | Bacteria | 2342 |
| 140 | Ga0105238_10151385 | 3300009551 | Bacteria | 2295 |
| 141 | Ga0105238_10155277 | 3300009551 | Bacteria | 2264 |
| 142 | Ga0105249_10008628 | 3300009553 | Bacteria | 8884 |
| 143 | Ga0105249_10069986 | 3300009553 | Bacteria | 3239 |
| 144 | Ga0105249_10535510 | 3300009553 | Bacteria | 1220 |
| 145 | Ga0105239_10005500 | 3300010375 | Bacteria | 14848 |
| 146 | Ga0105239_10006926 | 3300010375 | Bacteria | 13076 |
| 147 | Ga0105239_10041754 | 3300010375 | Bacteria | 5026 |
| 148 | Ga0105239_10101977 | 3300010375 | Bacteria | 3176 |
| 149 | Ga0105239_10170271 | 3300010375 | Bacteria | 2435 |
| 150 | Ga0105246_10023038 | 3300011119 | Bacteria | 4025 |
| 151 | Ga0105246_10084543 | 3300011119 | Bacteria | 2270 |
| 152 | Ga0157371_10044871 | 3300013102 | Bacteria | 3147 |
| 153 | Ga0157371_10458240 | 3300013102 | Bacteria | 938 |
| 154 | Ga0157370_10031524 | 3300013104 | Bacteria | 5183 |
| 155 | Ga0157370_10035692 | 3300013104 | Bacteria | 4830 |
| 156 | Ga0157369_10005407 | 3300013105 | Bacteria | 14866 |
| 157 | Ga0157369_10027008 | 3300013105 | Bacteria | 6365 |
| 158 | Ga0157369_10512164 | 3300013105 | Bacteria | 1241 |
| 159 | Ga0157374_10080140 | 3300013296 | Bacteria | 3096 |
| 160 | Ga0157374_10116022 | 3300013296 | Bacteria | 2580 |
| 161 | Ga0157374_10308435 | 3300013296 | Bacteria | 1566 |
| 162 | Ga0157374_10506347 | 3300013296 | Bacteria | 1212 |
| 163 | Ga0157378_10019690 | 3300013297 | Bacteria | 5933 |
| 164 | Ga0157378_10539648 | 3300013297 | Bacteria | 1170 |
| 165 | Ga0157378_10766414 | 3300013297 | Bacteria | 989 |
| 166 | Ga0157372_10006082 | 3300013307 | Bacteria | 12826 |
| 167 | Ga0157372_10031558 | 3300013307 | Bacteria | 5801 |
| 168 | Ga0157372_10084740 | 3300013307 | Bacteria | 3593 |
| 169 | Ga0157372_10172917 | 3300013307 | Bacteria | 2499 |
| 170 | Ga0157372_10286675 | 3300013307 | Bacteria | 1915 |
| 171 | Ga0157375_10428754 | 3300013308 | Bacteria | 1488 |
| 172 | Ga0163163_10130677 | 3300014325 | Bacteria | 2551 |
| 173 | Ga0163163_10596803 | 3300014325 | Bacteria | 1167 |
| 174 | Ga0157379_10584450 | 3300014968 | Bacteria | 1041 |
| 175 | Ga0157376_10047689 | 3300014969 | Bacteria | 3538 |
| 176 | Ga0157376_10267249 | 3300014969 | Bacteria | 1605 |
| 177 | Ga0207427_104105 | 3300025231 | Bacteria | 2615 |
| 178 | Ga0209233_1000545 | 3300025261 | Bacteria | 21104 |
| 179 | Ga0209025_1000270 | 3300025294 | Bacteria | 120921 |
| 180 | Ga0209758_1007187 | 3300025297 | Bacteria | 7676 |
| 181 | Ga0207656_10000992 | 3300025321 | Bacteria | 9263 |
| 182 | Ga0207682_10104201 | 3300025893 | Bacteria | 1243 |
| 183 | Ga0207692_10064506 | 3300025898 | Bacteria | 1908 |
| 184 | Ga0207710_10136026 | 3300025900 | Bacteria | 1183 |
| 185 | Ga0207688_10084177 | 3300025901 | Bacteria | 1820 |
| 186 | Ga0207688_10119385 | 3300025901 | Bacteria | 1537 |
| 187 | Ga0207680_10248087 | 3300025903 | Bacteria | 1229 |
| 188 | Ga0207680_10307182 | 3300025903 | Bacteria | 1106 |
| 189 | Ga0207685_10118558 | 3300025905 | Bacteria | 1158 |
| 190 | Ga0207699_10065040 | 3300025906 | Bacteria | 2209 |
| 191 | Ga0207645_10053308 | 3300025907 | Bacteria | 2585 |
| 192 | Ga0207654_10002301 | 3300025911 | Bacteria | 9797 |
| 193 | Ga0207654_10036112 | 3300025911 | Bacteria | 2759 |
| 194 | Ga0207654_10081386 | 3300025911 | Bacteria | 1950 |
| 195 | Ga0207707_10002920 | 3300025912 | Bacteria | 15246 |
| 196 | Ga0207695_10000471 | 3300025913 | Bacteria | 87529 |
| 197 | Ga0207695_10269210 | 3300025913 | Bacteria | 1599 |
| 198 | Ga0207671_10000227 | 3300025914 | Bacteria | 84794 |
| 199 | Ga0207671_10080810 | 3300025914 | Bacteria | 2437 |
| 200 | Ga0207693_10015201 | 3300025915 | Bacteria | 6178 |
| 201 | Ga0207693_10015354 | 3300025915 | Bacteria | 6146 |
| 202 | Ga0207693_10169593 | 3300025915 | Bacteria | 1719 |
| 203 | Ga0207663_10010491 | 3300025916 | Bacteria | 4934 |
| 204 | Ga0207663_10133027 | 3300025916 | Bacteria | 1721 |
| 205 | Ga0207660_10023546 | 3300025917 | Bacteria | 4161 |
| 206 | Ga0207660_10145951 | 3300025917 | Bacteria | 1813 |
| 207 | Ga0207660_10248493 | 3300025917 | Bacteria | 1403 |
| 208 | Ga0207657_10006492 | 3300025919 | Bacteria | 12120 |
| 209 | Ga0207657_10064441 | 3300025919 | Bacteria | 3128 |
| 210 | Ga0207657_10128967 | 3300025919 | Bacteria | 2075 |
| 211 | Ga0207657_10254593 | 3300025919 | Bacteria | 1399 |
| 212 | Ga0207649_10021851 | 3300025920 | Bacteria | 3691 |
| 213 | Ga0207649_10039194 | 3300025920 | Bacteria | 2871 |
| 214 | Ga0207652_10060734 | 3300025921 | Bacteria | 3262 |
| 215 | Ga0207694_10006998 | 3300025924 | Bacteria | 8562 |
| 216 | Ga0207694_10008356 | 3300025924 | Bacteria | 7825 |
| 217 | Ga0207694_10040273 | 3300025924 | Bacteria | 3596 |
| 218 | Ga0207694_10100774 | 3300025924 | Bacteria | 2288 |
| 219 | Ga0207694_10309049 | 3300025924 | Bacteria | 1303 |
| 220 | Ga0207694_10465605 | 3300025924 | Bacteria | 1056 |
| 221 | Ga0207650_10055394 | 3300025925 | Bacteria | 2944 |
| 222 | Ga0207687_10001994 | 3300025927 | Bacteria | 14026 |
| 223 | Ga0207700_10001997 | 3300025928 | Bacteria | 11635 |
| 224 | Ga0207664_10000614 | 3300025929 | Bacteria | 24711 |
| 225 | Ga0207644_10014051 | 3300025931 | Bacteria | 5353 |
| 226 | Ga0207644_10539015 | 3300025931 | Bacteria | 965 |
| 227 | Ga0207690_10077341 | 3300025932 | Bacteria | 2313 |
| 228 | Ga0207690_10205206 | 3300025932 | Bacteria | 1499 |
| 229 | Ga0207706_10025304 | 3300025933 | Bacteria | 5319 |
| 230 | Ga0207686_10034010 | 3300025934 | Bacteria | 3047 |
| 231 | Ga0207686_10068510 | 3300025934 | Bacteria | 2273 |
| 232 | Ga0207670_10132185 | 3300025936 | Bacteria | 1830 |
| 233 | Ga0207711_10001248 | 3300025941 | Bacteria | 24136 |
| 234 | Ga0207711_10115785 | 3300025941 | Archaea | 2389 |
| 235 | Ga0207689_10343170 | 3300025942 | Bacteria | 1241 |
| 236 | Ga0207661_10034172 | 3300025944 | Bacteria | 3952 |
| 237 | Ga0207661_10200649 | 3300025944 | Bacteria | 1753 |
| 238 | Ga0207679_10082669 | 3300025945 | Bacteria | 2459 |
| 239 | Ga0207667_10000399 | 3300025949 | Bacteria | 58694 |
| 240 | Ga0207667_10016250 | 3300025949 | Bacteria | 8409 |
| 241 | Ga0207667_10019609 | 3300025949 | Bacteria | 7544 |
| 242 | Ga0207667_10156484 | 3300025949 | Bacteria | 2345 |
| 243 | Ga0207667_10186604 | 3300025949 | Bacteria | 2128 |
| 244 | Ga0207667_10373857 | 3300025949 | Bacteria | 1452 |
| 245 | Ga0207651_10029982 | 3300025960 | Bacteria | 3457 |
| 246 | Ga0207712_10421072 | 3300025961 | Bacteria | 1127 |
| 247 | Ga0207668_10036506 | 3300025972 | Bacteria | 3280 |
| 248 | Ga0207668_10188418 | 3300025972 | Bacteria | 1633 |
| 249 | Ga0207640_10102702 | 3300025981 | Bacteria | 2008 |
| 250 | Ga0207640_10108210 | 3300025981 | Bacteria | 1964 |
| 251 | Ga0207658_10042667 | 3300025986 | Bacteria | 3292 |
| 252 | Ga0207658_10240373 | 3300025986 | Bacteria | 1534 |
| 253 | Ga0207703_10003526 | 3300026035 | Bacteria | 13092 |
| 254 | Ga0207703_10446838 | 3300026035 | Bacteria | 1207 |
| 255 | Ga0207639_10000588 | 3300026041 | Bacteria | 25039 |
| 256 | Ga0207639_10072933 | 3300026041 | Bacteria | 2690 |
| 257 | Ga0207639_10082434 | 3300026041 | Bacteria | 2550 |
| 258 | Ga0207639_10122903 | 3300026041 | Bacteria | 2136 |
| 259 | Ga0207678_10008694 | 3300026067 | Bacteria | 8941 |
| 260 | Ga0207678_10183352 | 3300026067 | Bacteria | 1788 |
| 261 | Ga0207702_10011423 | 3300026078 | Bacteria | 7402 |
| 262 | Ga0207702_10036743 | 3300026078 | Bacteria | 4098 |
| 263 | Ga0207702_10073352 | 3300026078 | Bacteria | 2951 |
| 264 | Ga0207702_10220547 | 3300026078 | Bacteria | 1767 |
| 265 | Ga0207641_10134932 | 3300026088 | Bacteria | 2221 |
| 266 | Ga0207674_10000042 | 3300026116 | Bacteria | 126790 |
| 267 | Ga0207674_10002211 | 3300026116 | Bacteria | 24643 |
| 268 | Ga0207674_10033773 | 3300026116 | Bacteria | 5354 |
| 269 | Ga0207674_10238401 | 3300026116 | Bacteria | 1766 |
| 270 | Ga0207683_10094607 | 3300026121 | Bacteria | 2663 |
| 271 | Ga0207698_10007576 | 3300026142 | Bacteria | 6805 |
| 272 | Ga0207698_10015926 | 3300026142 | Bacteria | 5055 |
| 273 | Ga0209971_1021880 | 3300027682 | Bacteria | 1522 |
| 274 | Ga0209966_1001356 | 3300027695 | Bacteria | 4289 |
| 275 | Ga0207428_10000040 | 3300027907 | Bacteria | 210887 |
| 276 | Ga0268266_10001992 | 3300028379 | Bacteria | 22881 |
| 277 | Ga0268266_10362142 | 3300028379 | Bacteria | 1365 |
| 278 | Ga0268264_10025649 | 3300028381 | Bacteria | 4814 |
| 279 | Ga0265318_10012180 | 3300028577 | Bacteria | 3670 |
| 280 | Ga0265318_10029052 | 3300028577 | Bacteria | 2157 |
| 281 | Ga0265338_10026029 | 3300028800 | Bacteria | 5915 |
| 282 | Ga0265330_10015665 | 3300031235 | Bacteria | 3506 |
| 283 | Ga0265325_10011187 | 3300031241 | Bacteria | 5164 |
| 284 | Ga0265325_10026567 | 3300031241 | Bacteria | 3134 |
| 285 | Ga0265340_10069410 | 3300031247 | Bacteria | 1672 |
| 286 | Ga0265339_10000247 | 3300031249 | Bacteria | 43605 |
| 287 | Ga0265316_10012667 | 3300031344 | Bacteria | 7549 |
| 288 | Ga0307408_100450186 | 3300031548 | Bacteria | 1117 |
| 289 | Ga0265313_10000062 | 3300031595 | Bacteria | 106169 |
| 290 | Ga0265313_10000137 | 3300031595 | Bacteria | 75555 |
| 291 | Ga0265313_10006147 | 3300031595 | Bacteria | 8620 |
| 292 | Ga0265313_10007775 | 3300031595 | Bacteria | 7247 |
| 293 | Ga0307508_10274649 | 3300031616 | Bacteria | 1279 |
| 294 | Ga0265314_10018720 | 3300031711 | Bacteria | 5388 |
| 295 | Ga0316577_10003985 | 3300031733 | Bacteria | 7552 |
| 296 | Ga0307406_10092359 | 3300031901 | Bacteria | 2041 |
| 297 | Ga0307407_10022746 | 3300031903 | Bacteria | 3259 |
| 298 | Ga0307416_100073875 | 3300032002 | Bacteria | 2845 |
| 299 | Ga0307416_100576668 | 3300032002 | Bacteria | 1202 |
| 300 | Ga0316580_10037515 | 3300032139 | Bacteria | 1499 |
| 301 | Ga0373934_0002444 | 3300035086 | Bacteria | 6831 |
| 302 | Ga0373934_0029549 | 3300035086 | Bacteria | 2141 |
| 303 | Ga0373923_0007039 | 3300035111 | Bacteria | 3931 |
| 304 | Ga0373953_0017234 | 3300035117 | Bacteria | 2652 |
| 305 | Ga0373953_0097421 | 3300035117 | Bacteria | 1235 |
| 306 | Ga0373954_0000516 | 3300035118 | Bacteria | 14475 |
| 307 | Ga0373954_0018927 | 3300035118 | Bacteria | 3103 |
| 308 | Ga0373954_0118075 | 3300035118 | Bacteria | 1286 |
| 309 | Ga0373957_0014519 | 3300035120 | Bacteria | 2694 |
| 310 | Ga0373946_0005368 | 3300035171 | Bacteria | 4618 |
| 311 | Ga0373955_0012553 | 3300035172 | Bacteria | 4072 |
| 312 | Ga0373955_0147440 | 3300035172 | Bacteria | 1383 |
| 313 | Ga0373955_0206552 | 3300035172 | Bacteria | 1170 |
| 314 | Ga0373924_0036975 | 3300035410 | Bacteria | 1986 |
| 315 | Ga0373931_0025178 | 3300035691 | Bacteria | 3022 |
| 316 | Ga0373935_0113896 | 3300035692 | Bacteria | 1798 |
| 317 | Ga0373935_0379981 | 3300035692 | Bacteria | 1011 |
| 318 | Ga0373933_0006840 | 3300035724 | Bacteria | 6208 |
| 319 | Ga0373933_0007183 | 3300035724 | Bacteria | 6069 |
| 320 | Ga0373947_0035765 | 3300035725 | Bacteria | 2942 |
| 321 | Ga0373937_0004063 | 3300036401 | Bacteria | 12402 |
| 322 | Ga0373937_0006000 | 3300036401 | Bacteria | 10455 |
| 323 | Ga0373937_0013155 | 3300036401 | Bacteria | 7287 |
| 324 | Ga0373937_0043445 | 3300036401 | Bacteria | 4103 |
| 325 | Ga0316582_0003350 | 3300036647 | Bacteria | 7838 |
| 326 | Ga0316584_0001417 | 3300036712 | Bacteria | 14335 |
| 327 | Ga0395900_0038991 | 3300037418 | Bacteria | 4897 |
| 328 | Ga0395898_0699904 | 3300037466 | Bacteria | 955 |
| 329 | Ga0395905_0044491 | 3300037471 | Bacteria | 4167 |
| 330 | Ga0395905_0459224 | 3300037471 | Bacteria | 1172 |
| 331 | Ga0395901_0159534 | 3300038443 | Bacteria | 2368 |
| 332 | Ga0395901_0172065 | 3300038443 | Bacteria | 2272 |
| 333 | Ga0395901_0451754 | 3300038443 | Bacteria | 1314 |
| 334 | Ga0439445_0005912 | 3300042004 | Bacteria | 2802 |
| 335 | Ga0439464_0027513 | 3300042439 | Bacteria | 1581 |
| 336 | Ga0466969_0038148 | 3300044656 | Bacteria | 2419 |
| 337 | Ga0466972_0007115 | 3300044658 | Bacteria | 5619 |
| 338 | Ga0466966_0125634 | 3300044684 | Bacteria | 1573 |
| 339 | Ga0466966_0231948 | 3300044684 | Bacteria | 1113 |
| 340 | Ga0466963_0214131 | 3300044694 | Bacteria | 1348 |
| 341 | Ga0466963_0431442 | 3300044694 | Bacteria | 929 |
| 342 | Ga0466968_0054522 | 3300044735 | Bacteria | 1714 |
| 343 | Ga0466970_0126676 | 3300044765 | Bacteria | 1401 |
| 344 | Ga0466957_0029478 | 3300044842 | Bacteria | 3272 |
| 345 | Ga0466960_0005900 | 3300044901 | Bacteria | 4883 |
| 346 | Ga0466960_0227311 | 3300044901 | Bacteria | 1029 |
| 347 | Ga0466958_0191852 | 3300045836 | Bacteria | 1299 |
| 348 | Ga0466967_0007871 | 3300045976 | Bacteria | 7744 |
| 349 | Ga0495592_0001467 | 3300046454 | Bacteria | 16409 |
| 350 | Ga0495592_0027382 | 3300046454 | Bacteria | 4322 |
| 351 | Ga0495638_0137757 | 3300046460 | Bacteria | 1427 |
| 352 | Ga0495651_0005926 | 3300046462 | Bacteria | 9326 |
| 353 | Ga0495651_0034339 | 3300046462 | Bacteria | 3953 |
| 354 | Ga0495653_0060278 | 3300046463 | Bacteria | 2876 |
| 355 | Ga0495580_0119296 | 3300046472 | Unclassified | 1832 |
| 356 | Ga0495639_0006734 | 3300046475 | Bacteria | 4942 |
| 357 | Ga0495664_0172520 | 3300046477 | Bacteria | 1312 |
| 358 | Ga0495584_0062166 | 3300046491 | Bacteria | 1877 |
| 359 | Ga0495594_0270326 | 3300046499 | Bacteria | 968 |
| 360 | Ga0495608_0010996 | 3300046511 | Bacteria | 6308 |
| 361 | Ga0495608_0033982 | 3300046511 | Bacteria | 3444 |
| 362 | Ga0495628_0001714 | 3300046516 | Bacteria | 19985 |
| 363 | Ga0495632_0123917 | 3300046519 | Bacteria | 1206 |
| 364 | Ga0495652_0062838 | 3300046529 | Bacteria | 3129 |
| 365 | Ga0495665_0053409 | 3300046531 | Bacteria | 2137 |
| 366 | Ga0495587_0000561 | 3300046536 | Bacteria | 25626 |
| 367 | Ga0495587_0016959 | 3300046536 | Bacteria | 4529 |
| 368 | Ga0495587_0020579 | 3300046536 | Bacteria | 4071 |
| 369 | Ga0495645_0000223 | 3300046543 | Bacteria | 40729 |
| 370 | Ga0495635_0047278 | 3300046663 | Bacteria | 2968 |
| 371 | Ga0495657_0021350 | 3300046675 | Bacteria | 4646 |
| 372 | Ga0495599_0001359 | 3300046678 | Bacteria | 13977 |
| 373 | Ga0495599_0016748 | 3300046678 | Bacteria | 4552 |
| 374 | Ga0495623_0032010 | 3300046679 | Bacteria | 3381 |
| 375 | Ga0495623_0218516 | 3300046679 | Bacteria | 1087 |
| 376 | Ga0495646_0044814 | 3300046680 | Bacteria | 2704 |
| 377 | Ga0495658_0139907 | 3300046683 | Bacteria | 1480 |
| 378 | Ga0495613_0094991 | 3300046689 | Bacteria | 2157 |
| 379 | Ga0495604_0001128 | 3300047317 | Bacteria | 22177 |
| 380 | Ga0495680_0006632 | 3300047322 | Bacteria | 10716 |
| 381 | Ga0495680_0061489 | 3300047322 | Bacteria | 2889 |
| 382 | Ga0495675_0054421 | 3300047444 | Bacteria | 2539 |
| 383 | Ga0495675_0125804 | 3300047444 | Bacteria | 1595 |
| 384 | Ga0495684_0003073 | 3300047471 | Bacteria | 13120 |
| 385 | Ga0495602_0003250 | 3300048088 | Bacteria | 16775 |
| 386 | Ga0495602_0030168 | 3300048088 | Bacteria | 5149 |
| 387 | Ga0496104_0000537 | 3300048907 | Bacteria | 32588 |
| 388 | Ga0496104_0067273 | 3300048907 | Bacteria | 3403 |
| 389 | Ga0496104_0101005 | 3300048907 | Bacteria | 2762 |
| 390 | Ga0496105_0004684 | 3300048908 | Bacteria | 10311 |
| 391 | Ga0496112_0131970 | 3300048915 | Bacteria | 2469 |
| 392 | Ga0496119_0000198 | 3300048922 | Bacteria | 84746 |
| 393 | Ga0496121_0119133 | 3300048924 | Bacteria | 1997 |
| 394 | Ga0501031_0023094 | 3300049568 | Bacteria | 4056 |
| 395 | Ga0501031_0114978 | 3300049568 | Bacteria | 1758 |
| 396 | Ga0501032_0078902 | 3300049569 | Bacteria | 2192 |
| 397 | Ga0501032_0082801 | 3300049569 | Bacteria | 2134 |
| 398 | Ga0501032_0205755 | 3300049569 | Bacteria | 1284 |
| 399 | Ga0501032_0209463 | 3300049569 | Bacteria | 1271 |
| 400 | Ga0501033_0023597 | 3300049570 | Bacteria | 4639 |
| 401 | Ga0501033_0077168 | 3300049570 | Bacteria | 2445 |
| 402 | Ga0501034_0050979 | 3300049571 | Bacteria | 4174 |
| 403 | Ga0501034_0143114 | 3300049571 | Bacteria | 2370 |
| 404 | Ga0501034_0347774 | 3300049571 | Bacteria | 1411 |
| 405 | Ga0501036_0029209 | 3300049572 | Bacteria | 4661 |
| 406 | Ga0501037_0022301 | 3300049573 | Bacteria | 4684 |
| 407 | Ga0501038_0071272 | 3300049574 | Bacteria | 2948 |
| 408 | Ga0501039_0057166 | 3300049575 | Bacteria | 3021 |
| 409 | Ga0501039_0196777 | 3300049575 | Bacteria | 1585 |
| 410 | Ga0501046_0106575 | 3300049580 | Bacteria | 2145 |
| 411 | Ga0501047_0004012 | 3300049581 | Bacteria | 13837 |
| 412 | Ga0501047_0034657 | 3300049581 | Bacteria | 4874 |
| 413 | Ga0501047_0054565 | 3300049581 | Bacteria | 3865 |
| 414 | Ga0501047_0428713 | 3300049581 | Bacteria | 1153 |
| 415 | Ga0501067_0002501 | 3300049583 | Bacteria | 10154 |
| 416 | Ga0501067_0053439 | 3300049583 | Bacteria | 2238 |
| 417 | Ga0501068_0206311 | 3300049584 | Bacteria | 1247 |
| 418 | Ga0501069_0013536 | 3300049585 | Bacteria | 4350 |
| 419 | Ga0501069_0046124 | 3300049585 | Bacteria | 2416 |
| 420 | Ga0501070_0011213 | 3300049586 | Bacteria | 7567 |
| 421 | Ga0501070_0012528 | 3300049586 | Bacteria | 7152 |
| 422 | Ga0501070_0028668 | 3300049586 | Bacteria | 4668 |
| 423 | Ga0501070_0357738 | 3300049586 | Bacteria | 1184 |
| 424 | Ga0501070_0423274 | 3300049586 | Bacteria | 1075 |
| 425 | Ga0501071_0088128 | 3300049587 | Bacteria | 2277 |
| 426 | Ga0501073_0031711 | 3300049589 | Bacteria | 3770 |
| 427 | Ga0501073_0040731 | 3300049589 | Bacteria | 3286 |
| 428 | Ga0501073_0151797 | 3300049589 | Bacteria | 1606 |
| 429 | Ga0501076_0222607 | 3300049592 | Bacteria | 1542 |
| 430 | Ga0501238_002884 | 3300049671 | Bacteria | 2089 |
| 431 | Ga0501252_009647 | 3300049682 | Bacteria | 1129 |
| 432 | Ga0501079_0071931 | 3300049741 | Bacteria | 2672 |
| 433 | Ga0501080_0039777 | 3300049742 | Bacteria | 4388 |
| 434 | Ga0501080_0055640 | 3300049742 | Bacteria | 3685 |
| 435 | Ga0501080_0058452 | 3300049742 | Bacteria | 3589 |
| 436 | Ga0501080_0154616 | 3300049742 | Bacteria | 2119 |
| 437 | Ga0501080_0516724 | 3300049742 | Bacteria | 1066 |
| 438 | Ga0501083_0004629 | 3300049744 | Bacteria | 9714 |
| 439 | Ga0501083_0017118 | 3300049744 | Bacteria | 5056 |
| 440 | Ga0501083_0028855 | 3300049744 | Bacteria | 3822 |
| 441 | Ga0501083_0084963 | 3300049744 | Bacteria | 2094 |
| 442 | Ga0501083_0134454 | 3300049744 | Unclassified | 1620 |
| 443 | Ga0501035_0000453 | 3300049822 | Bacteria | 45820 |
| 444 | Ga0501035_0010167 | 3300049822 | Bacteria | 8733 |
| 445 | Ga0501035_0227064 | 3300049822 | Bacteria | 1592 |
| 446 | Ga0501044_0122142 | 3300049823 | Bacteria | 2604 |
| 447 | Ga0501044_0431031 | 3300049823 | Bacteria | 1228 |
| 448 | nmdc:mga0yw44_214006_c1 | 3300050492 | Bacteria | 1275 |
| 449 | nmdc:mga05p37_688465_c1 | 3300050507 | Bacteria | 1138 |
| 450 | nmdc:mga0qj67_160_c1 | 3300050509 | Bacteria | 45393 |
| 451 | nmdc:mga08y16_233_c1 | 3300050511 | Bacteria | 49640 |
| 452 | nmdc:mga08x19_448361_c1 | 3300050514 | Bacteria | 908 |
| 453 | Ga0495601_0105984 | 3300053077 | Bacteria | 1818 |
| 454 | Ga0495601_0208769 | 3300053077 | Bacteria | 1276 |
| 455 | Ga0495612_0010559 | 3300053078 | Bacteria | 3733 |
| 456 | Ga0495595_0001916 | 3300053084 | Bacteria | 8078 |
| 457 | Ga0495619_0000520 | 3300053085 | Bacteria | 25508 |
| 458 | Ga0495619_0173115 | 3300053085 | Bacteria | 1493 |
| 459 | Ga0500642_0004224 | 3300053130 | Bacteria | 4463 |
| 460 | Ga0500568_0006702 | 3300053139 | Bacteria | 5756 |
| 461 | Ga0500604_0000738 | 3300053151 | Bacteria | 8963 |
| 462 | Ga0500616_0009695 | 3300053153 | Bacteria | 5825 |
| 463 | Ga0500616_0045053 | 3300053153 | Bacteria | 2352 |
| 464 | Ga0500634_0000001 | 3300053161 | Bacteria | 258285 |
| 465 | Ga0500634_0011993 | 3300053161 | Bacteria | 4497 |
| 466 | Ga0501084_0096525 | 3300054114 | Bacteria | 2482 |
| 467 | Ga0501084_0162271 | 3300054114 | Bacteria | 1885 |
| 468 | Ga0501082_0029327 | 3300060353 | Bacteria | 4739 |
| 469 | Ga0501082_0277431 | 3300060353 | Bacteria | 1459 |
| 470 | Ga0501082_0281390 | 3300060353 | Unclassified | 1448 |
| 471 | Ga0466962_0039430 | 3300061719 | Bacteria | 2262 |
| 472 | Ga0466962_0218784 | 3300061719 | Bacteria | 933 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035086 | Ga0373934_0029549 | Ga0373934_0029549_290_1033 | 244 |
| 2 | 3300005329 | Ga0070683_100042834 | Ga0070683_1000428343 | 260 |
| 3 | 3300009174 | Ga0105241_10000274 | Ga0105241_100002742 | 260 |
| 4 | 3300013296 | Ga0157374_10116022 | Ga0157374_101160222 | 260 |
| 5 | 3300046531 | Ga0495665_0053409 | Ga0495665_0053409_493_1299 | 260 |
| 6 | 3300046679 | Ga0495623_0218516 | Ga0495623_0218516_158_949 | 260 |
| 7 | 3300046536 | Ga0495587_0016959 | Ga0495587_0016959_1770_2561 | 261 |
| 8 | 3300046678 | Ga0495599_0016748 | Ga0495599_0016748_13_804 | 261 |
| 9 | 3300005329 | Ga0070683_100000407 | Ga0070683_10000040720 | 262 |
| 10 | 3300005336 | Ga0070680_100003368 | Ga0070680_1000033683 | 262 |
| 11 | 3300005341 | Ga0070691_10000505 | Ga0070691_100005056 | 262 |
| 12 | 3300005444 | Ga0070694_100138321 | Ga0070694_1001383212 | 262 |
| 13 | 3300005458 | Ga0070681_10000278 | Ga0070681_1000027835 | 262 |
| 14 | 3300005530 | Ga0070679_100010630 | Ga0070679_1000106308 | 262 |
| 15 | 3300005535 | Ga0070684_100000856 | Ga0070684_1000008564 | 262 |
| 16 | 3300005539 | Ga0068853_100074442 | Ga0068853_1000744422 | 262 |
| 17 | 3300005563 | Ga0068855_100010388 | Ga0068855_1000103883 | 262 |
| 18 | 3300005577 | Ga0068857_100000139 | Ga0068857_10000013918 | 262 |
| 19 | 3300005614 | Ga0068856_100003335 | Ga0068856_10000333512 | 262 |
| 20 | 3300005616 | Ga0068852_100009656 | Ga0068852_1000096563 | 262 |
| 21 | 3300006914 | Ga0075436_100399267 | Ga0075436_1003992671 | 262 |
| 22 | 3300009093 | Ga0105240_10006325 | Ga0105240_1000632513 | 262 |
| 23 | 3300009545 | Ga0105237_10020637 | Ga0105237_100206375 | 262 |
| 24 | 3300009551 | Ga0105238_10001117 | Ga0105238_100011179 | 262 |
| 25 | 3300010375 | Ga0105239_10005500 | Ga0105239_1000550011 | 262 |
| 26 | 3300013105 | Ga0157369_10005407 | Ga0157369_100054073 | 262 |
| 27 | 3300013307 | Ga0157372_10006082 | Ga0157372_100060822 | 262 |
| 28 | 3300025911 | Ga0207654_10002301 | Ga0207654_100023018 | 262 |
| 29 | 3300025912 | Ga0207707_10002920 | Ga0207707_1000292011 | 262 |
| 30 | 3300025913 | Ga0207695_10000471 | Ga0207695_1000047115 | 262 |
| 31 | 3300025917 | Ga0207660_10023546 | Ga0207660_100235463 | 262 |
| 32 | 3300025921 | Ga0207652_10060734 | Ga0207652_100607342 | 262 |
| 33 | 3300025924 | Ga0207694_10006998 | Ga0207694_100069989 | 262 |
| 34 | 3300025942 | Ga0207689_10343170 | Ga0207689_103431701 | 262 |
| 35 | 3300025944 | Ga0207661_10034172 | Ga0207661_100341724 | 262 |
| 36 | 3300025949 | Ga0207667_10000399 | Ga0207667_1000039911 | 262 |
| 37 | 3300026041 | Ga0207639_10082434 | Ga0207639_100824342 | 262 |
| 38 | 3300026078 | Ga0207702_10011423 | Ga0207702_100114234 | 262 |
| 39 | 3300026116 | Ga0207674_10000042 | Ga0207674_1000004272 | 262 |
| 40 | 3300026142 | Ga0207698_10007576 | Ga0207698_100075765 | 262 |
| 41 | 3300050514 | nmdc:mga08x19_448361_c1 | nmdc:mga08x19_448361_c1_46_843 | 262 |
| 42 | 3300005842 | Ga0068858_100076638 | Ga0068858_1000766382 | 268 |
| 43 | 3300013296 | Ga0157374_10506347 | Ga0157374_105063472 | 268 |
| 44 | 3300013297 | Ga0157378_10766414 | Ga0157378_107664141 | 268 |
| 45 | 3300025934 | Ga0207686_10034010 | Ga0207686_100340102 | 268 |
| 46 | 3300025961 | Ga0207712_10421072 | Ga0207712_104210722 | 268 |
| 47 | 3300049592 | Ga0501076_0222607 | Ga0501076_0222607_110_919 | 268 |
| 48 | 3300005434 | Ga0070709_10028528 | Ga0070709_100285282 | 269 |
| 49 | 3300005435 | Ga0070714_100000313 | Ga0070714_10000031327 | 269 |
| 50 | 3300005436 | Ga0070713_100001282 | Ga0070713_10000128211 | 269 |
| 51 | 3300005439 | Ga0070711_100011700 | Ga0070711_1000117007 | 269 |
| 52 | 3300006028 | Ga0070717_10050758 | Ga0070717_100507582 | 269 |
| 53 | 3300006358 | Ga0068871_100029295 | Ga0068871_1000292952 | 269 |
| 54 | 3300025906 | Ga0207699_10065040 | Ga0207699_100650403 | 269 |
| 55 | 3300025916 | Ga0207663_10010491 | Ga0207663_100104912 | 269 |
| 56 | 3300025928 | Ga0207700_10001997 | Ga0207700_1000199710 | 269 |
| 57 | 3300025929 | Ga0207664_10000614 | Ga0207664_100006147 | 269 |
| 58 | 3300035172 | Ga0373955_0206552 | Ga0373955_0206552_141_959 | 269 |
| 59 | 3300035692 | Ga0373935_0113896 | Ga0373935_0113896_834_1652 | 269 |
| 60 | 3300035692 | Ga0373935_0379981 | Ga0373935_0379981_176_994 | 269 |
| 61 | 3300035725 | Ga0373947_0035765 | Ga0373947_0035765_1489_2307 | 269 |
| 62 | 3300036401 | Ga0373937_0004063 | Ga0373937_0004063_8174_8992 | 269 |
| 63 | 3300005327 | Ga0070658_10047509 | Ga0070658_100475093 | 271 |
| 64 | 3300005344 | Ga0070661_100011131 | Ga0070661_1000111312 | 271 |
| 65 | 3300005347 | Ga0070668_100042325 | Ga0070668_1000423254 | 271 |
| 66 | 3300005366 | Ga0070659_100087481 | Ga0070659_1000874812 | 271 |
| 67 | 3300005458 | Ga0070681_10529561 | Ga0070681_105295612 | 271 |
| 68 | 3300005539 | Ga0068853_100010891 | Ga0068853_1000108916 | 271 |
| 69 | 3300005548 | Ga0070665_100386483 | Ga0070665_1003864832 | 271 |
| 70 | 3300009551 | Ga0105238_10155277 | Ga0105238_101552772 | 271 |
| 71 | 3300010375 | Ga0105239_10170271 | Ga0105239_101702712 | 271 |
| 72 | 3300013102 | Ga0157371_10458240 | Ga0157371_104582401 | 271 |
| 73 | 3300013104 | Ga0157370_10031524 | Ga0157370_100315243 | 271 |
| 74 | 3300013105 | Ga0157369_10027008 | Ga0157369_100270085 | 271 |
| 75 | 3300014325 | Ga0163163_10596803 | Ga0163163_105968031 | 271 |
| 76 | 3300025893 | Ga0207682_10104201 | Ga0207682_101042012 | 271 |
| 77 | 3300025901 | Ga0207688_10084177 | Ga0207688_100841772 | 271 |
| 78 | 3300025932 | Ga0207690_10077341 | Ga0207690_100773413 | 271 |
| 79 | 3300025949 | Ga0207667_10019609 | Ga0207667_100196092 | 271 |
| 80 | 3300025972 | Ga0207668_10036506 | Ga0207668_100365063 | 271 |
| 81 | 3300026041 | Ga0207639_10122903 | Ga0207639_101229033 | 271 |
| 82 | 3300026067 | Ga0207678_10008694 | Ga0207678_100086946 | 271 |
| 83 | 3300026078 | Ga0207702_10073352 | Ga0207702_100733523 | 271 |
| 84 | 3300037466 | Ga0395898_0699904 | Ga0395898_0699904_78_893 | 271 |
| 85 | 3300037471 | Ga0395905_0459224 | Ga0395905_0459224_246_1061 | 271 |
| 86 | 3300038443 | Ga0395901_0451754 | Ga0395901_0451754_214_1029 | 271 |
| 87 | iso_pu_bacteria | 8057160832 | 8057163460 | 271 |
| 88 | 3300025919 | Ga0207657_10254593 | Ga0207657_102545932 | 272 |
| 89 | 3300049742 | Ga0501080_0516724 | Ga0501080_0516724_20_838 | 272 |
| 90 | 3300005331 | Ga0070670_100069527 | Ga0070670_1000695272 | 275 |
| 91 | 3300005355 | Ga0070671_100250530 | Ga0070671_1002505302 | 275 |
| 92 | 3300005455 | Ga0070663_100087760 | Ga0070663_1000877602 | 275 |
| 93 | 3300006038 | Ga0075365_10059452 | Ga0075365_100594522 | 275 |
| 94 | 3300025925 | Ga0207650_10055394 | Ga0207650_100553944 | 275 |
| 95 | 3300025931 | Ga0207644_10014051 | Ga0207644_100140514 | 275 |
| 96 | 3300025945 | Ga0207679_10082669 | Ga0207679_100826692 | 275 |
| 97 | 3300026067 | Ga0207678_10183352 | Ga0207678_101833522 | 275 |
| 98 | 3300026121 | Ga0207683_10094607 | Ga0207683_100946073 | 275 |
| 99 | 3300050492 | nmdc:mga0yw44_214006_c1 | nmdc:mga0yw44_214006_c1_199_1026 | 275 |
| 100 | iso_pu_bacteria | 2643221551 | 2643776190 | 277 |
| 101 | iso_pu_bacteria | 2643221555 | 2643794637 | 277 |
| 102 | iso_pu_bacteria | 2773857925 | 2774872917 | 277 |
| 103 | iso_pu_bacteria | 2775506901 | 2776260537 | 277 |
| 104 | iso_pu_bacteria | 2835312727 | 2835319034 | 277 |
| 105 | iso_pu_bacteria | 2882456835 | 2882457927 | 277 |
| 106 | iso_pu_bacteria | 2884298095 | 2884300656 | 277 |
| 107 | iso_pu_bacteria | 2888343758 | 2888345842 | 277 |
| 108 | iso_pu_bacteria | 2894232714 | 2894233292 | 277 |
| 109 | 3300006038 | Ga0075365_10193041 | Ga0075365_101930412 | 279 |
| 110 | 3300049744 | Ga0501083_0134454 | Ga0501083_0134454_261_1148 | 279 |
| 111 | 3300060353 | Ga0501082_0281390 | Ga0501082_0281390_166_1053 | 279 |
| 112 | iso_pu_bacteria | 2508501114 | 2509075609 | 279 |
| 113 | 3300009093 | Ga0105240_10284146 | Ga0105240_102841461 | 280 |
| 114 | 3300009545 | Ga0105237_10396627 | Ga0105237_103966272 | 280 |
| 115 | 3300009551 | Ga0105238_10145961 | Ga0105238_101459612 | 280 |
| 116 | 3300028379 | Ga0268266_10362142 | Ga0268266_103621421 | 280 |
| 117 | 3300044656 | Ga0466969_0038148 | Ga0466969_0038148_510_1355 | 280 |
| 118 | 3300044658 | Ga0466972_0007115 | Ga0466972_0007115_2281_3126 | 280 |
| 119 | 3300044684 | Ga0466966_0125634 | Ga0466966_0125634_79_924 | 280 |
| 120 | 3300044735 | Ga0466968_0054522 | Ga0466968_0054522_555_1400 | 280 |
| 121 | 3300044765 | Ga0466970_0126676 | Ga0466970_0126676_213_1058 | 280 |
| 122 | 3300044901 | Ga0466960_0005900 | Ga0466960_0005900_2956_3801 | 280 |
| 123 | 3300061719 | Ga0466962_0218784 | Ga0466962_0218784_50_895 | 280 |
| 124 | 3300005339 | Ga0070660_100205295 | Ga0070660_1002052952 | 281 |
| 125 | 3300005347 | Ga0070668_100209142 | Ga0070668_1002091422 | 281 |
| 126 | 3300005548 | Ga0070665_100043091 | Ga0070665_1000430914 | 281 |
| 127 | 3300006358 | Ga0068871_100478291 | Ga0068871_1004782911 | 281 |
| 128 | 3300009545 | Ga0105237_10000301 | Ga0105237_1000030124 | 281 |
| 129 | 3300009545 | Ga0105237_10160946 | Ga0105237_101609461 | 281 |
| 130 | 3300010375 | Ga0105239_10006926 | Ga0105239_100069264 | 281 |
| 131 | 3300013308 | Ga0157375_10428754 | Ga0157375_104287542 | 281 |
| 132 | 3300014968 | Ga0157379_10584450 | Ga0157379_105844502 | 281 |
| 133 | 3300014969 | Ga0157376_10267249 | Ga0157376_102672492 | 281 |
| 134 | 3300025914 | Ga0207671_10000227 | Ga0207671_1000022730 | 281 |
| 135 | 3300028379 | Ga0268266_10001992 | Ga0268266_1000199212 | 281 |
| 136 | 3300031616 | Ga0307508_10274649 | Ga0307508_102746492 | 281 |
| 137 | 3300031733 | Ga0316577_10003985 | Ga0316577_100039853 | 281 |
| 138 | 3300031901 | Ga0307406_10092359 | Ga0307406_100923593 | 281 |
| 139 | 3300031903 | Ga0307407_10022746 | Ga0307407_100227463 | 281 |
| 140 | 3300032002 | Ga0307416_100073875 | Ga0307416_1000738751 | 281 |
| 141 | 3300032139 | Ga0316580_10037515 | Ga0316580_100375152 | 281 |
| 142 | 3300036647 | Ga0316582_0003350 | Ga0316582_0003350_6337_7209 | 281 |
| 143 | 3300036712 | Ga0316584_0001417 | Ga0316584_0001417_7517_8389 | 281 |
| 144 | 3300037471 | Ga0395905_0044491 | Ga0395905_0044491_294_1139 | 281 |
| 145 | 3300044901 | Ga0466960_0227311 | Ga0466960_0227311_99_944 | 281 |
| 146 | 3300045836 | Ga0466958_0191852 | Ga0466958_0191852_49_894 | 281 |
| 147 | 3300047322 | Ga0495680_0061489 | Ga0495680_0061489_1948_2865 | 281 |
| 148 | 3300048907 | Ga0496104_0067273 | Ga0496104_0067273_822_1670 | 281 |
| 149 | 3300049568 | Ga0501031_0114978 | Ga0501031_0114978_95_940 | 281 |
| 150 | 3300049671 | Ga0501238_002884 | Ga0501238_002884_824_1669 | 281 |
| 151 | 3300049682 | Ga0501252_009647 | Ga0501252_009647_71_916 | 281 |
| 152 | 3300053139 | Ga0500568_0006702 | Ga0500568_0006702_4323_5168 | 281 |
| 153 | 3300053151 | Ga0500604_0000738 | Ga0500604_0000738_5880_6725 | 281 |
| 154 | 3300053153 | Ga0500616_0009695 | Ga0500616_0009695_4110_4958 | 281 |
| 155 | 3300053153 | Ga0500616_0045053 | Ga0500616_0045053_1419_2267 | 281 |
| 156 | 3300053161 | Ga0500634_0000001 | Ga0500634_0000001_80051_80896 | 281 |
| 157 | 3300053161 | Ga0500634_0011993 | Ga0500634_0011993_1657_2502 | 281 |
| 158 | iso_pu_bacteria | 3004334049 | 3004336794 | 281 |
| 159 | iso_pu_bacteria | 8045864390 | 8045866613 | 281 |
| 160 | 3300003323 | rootH1_10098140 | rootH1_100981405 | 282 |
| 161 | 3300005329 | Ga0070683_100014241 | Ga0070683_1000142416 | 282 |
| 162 | 3300005330 | Ga0070690_100092798 | Ga0070690_1000927982 | 282 |
| 163 | 3300005337 | Ga0070682_100092142 | Ga0070682_1000921422 | 282 |
| 164 | 3300005338 | Ga0068868_100080907 | Ga0068868_1000809072 | 282 |
| 165 | 3300005340 | Ga0070689_100049793 | Ga0070689_1000497932 | 282 |
| 166 | 3300005344 | Ga0070661_100000540 | Ga0070661_10000054025 | 282 |
| 167 | 3300005344 | Ga0070661_100035485 | Ga0070661_1000354853 | 282 |
| 168 | 3300005355 | Ga0070671_100299929 | Ga0070671_1002999292 | 282 |
| 169 | 3300005364 | Ga0070673_100055058 | Ga0070673_1000550583 | 282 |
| 170 | 3300005366 | Ga0070659_100002010 | Ga0070659_1000020107 | 282 |
| 171 | 3300005366 | Ga0070659_100053804 | Ga0070659_1000538042 | 282 |
| 172 | 3300005435 | Ga0070714_100040448 | Ga0070714_1000404482 | 282 |
| 173 | 3300005436 | Ga0070713_100085185 | Ga0070713_1000851854 | 282 |
| 174 | 3300005456 | Ga0070678_100128626 | Ga0070678_1001286262 | 282 |
| 175 | 3300005535 | Ga0070684_100010398 | Ga0070684_1000103986 | 282 |
| 176 | 3300005535 | Ga0070684_100590462 | Ga0070684_1005904621 | 282 |
| 177 | 3300005539 | Ga0068853_100004900 | Ga0068853_1000049009 | 282 |
| 178 | 3300005539 | Ga0068853_100014976 | Ga0068853_1000149763 | 282 |
| 179 | 3300005539 | Ga0068853_100161375 | Ga0068853_1001613752 | 282 |
| 180 | 3300005547 | Ga0070693_100027846 | Ga0070693_1000278462 | 282 |
| 181 | 3300005563 | Ga0068855_100045877 | Ga0068855_1000458773 | 282 |
| 182 | 3300005563 | Ga0068855_100100706 | Ga0068855_1001007063 | 282 |
| 183 | 3300005563 | Ga0068855_100179572 | Ga0068855_1001795722 | 282 |
| 184 | 3300005563 | Ga0068855_100279673 | Ga0068855_1002796732 | 282 |
| 185 | 3300005564 | Ga0070664_100342213 | Ga0070664_1003422132 | 282 |
| 186 | 3300005564 | Ga0070664_100503128 | Ga0070664_1005031281 | 282 |
| 187 | 3300005577 | Ga0068857_100055671 | Ga0068857_1000556712 | 282 |
| 188 | 3300005577 | Ga0068857_100063978 | Ga0068857_1000639783 | 282 |
| 189 | 3300005577 | Ga0068857_100073911 | Ga0068857_1000739113 | 282 |
| 190 | 3300005577 | Ga0068857_100180156 | Ga0068857_1001801562 | 282 |
| 191 | 3300005578 | Ga0068854_100005496 | Ga0068854_1000054965 | 282 |
| 192 | 3300005578 | Ga0068854_100016209 | Ga0068854_1000162093 | 282 |
| 193 | 3300005578 | Ga0068854_100050160 | Ga0068854_1000501602 | 282 |
| 194 | 3300005614 | Ga0068856_100095086 | Ga0068856_1000950863 | 282 |
| 195 | 3300005614 | Ga0068856_100245009 | Ga0068856_1002450092 | 282 |
| 196 | 3300005614 | Ga0068856_100329504 | Ga0068856_1003295041 | 282 |
| 197 | 3300005616 | Ga0068852_100000952 | Ga0068852_10000095216 | 282 |
| 198 | 3300005616 | Ga0068852_100010635 | Ga0068852_1000106354 | 282 |
| 199 | 3300005616 | Ga0068852_100227152 | Ga0068852_1002271522 | 282 |
| 200 | 3300005718 | Ga0068866_10238815 | Ga0068866_102388151 | 282 |
| 201 | 3300005834 | Ga0068851_10000929 | Ga0068851_100009296 | 282 |
| 202 | 3300005834 | Ga0068851_10031083 | Ga0068851_100310832 | 282 |
| 203 | 3300005842 | Ga0068858_100029046 | Ga0068858_1000290463 | 282 |
| 204 | 3300006163 | Ga0070715_10061247 | Ga0070715_100612472 | 282 |
| 205 | 3300006358 | Ga0068871_100006980 | Ga0068871_1000069803 | 282 |
| 206 | 3300006358 | Ga0068871_100066256 | Ga0068871_1000662563 | 282 |
| 207 | 3300006358 | Ga0068871_100106405 | Ga0068871_1001064051 | 282 |
| 208 | 3300006931 | Ga0097620_100004436 | Ga0097620_10000443610 | 282 |
| 209 | 3300009093 | Ga0105240_10034029 | Ga0105240_100340294 | 282 |
| 210 | 3300009093 | Ga0105240_10267517 | Ga0105240_102675172 | 282 |
| 211 | 3300009093 | Ga0105240_10340903 | Ga0105240_103409032 | 282 |
| 212 | 3300009098 | Ga0105245_10010569 | Ga0105245_100105693 | 282 |
| 213 | 3300009147 | Ga0114129_10877797 | Ga0114129_108777972 | 282 |
| 214 | 3300009148 | Ga0105243_10118887 | Ga0105243_101188872 | 282 |
| 215 | 3300009174 | Ga0105241_10083233 | Ga0105241_100832332 | 282 |
| 216 | 3300009176 | Ga0105242_10052908 | Ga0105242_100529083 | 282 |
| 217 | 3300009176 | Ga0105242_10133019 | Ga0105242_101330192 | 282 |
| 218 | 3300009176 | Ga0105242_10365068 | Ga0105242_103650682 | 282 |
| 219 | 3300009177 | Ga0105248_10001455 | Ga0105248_1000145510 | 282 |
| 220 | 3300009177 | Ga0105248_10004780 | Ga0105248_100047803 | 282 |
| 221 | 3300009545 | Ga0105237_10047466 | Ga0105237_100474664 | 282 |
| 222 | 3300009551 | Ga0105238_10005017 | Ga0105238_1000501710 | 282 |
| 223 | 3300009551 | Ga0105238_10007723 | Ga0105238_1000772310 | 282 |
| 224 | 3300009551 | Ga0105238_10009735 | Ga0105238_100097359 | 282 |
| 225 | 3300009551 | Ga0105238_10033018 | Ga0105238_100330184 | 282 |
| 226 | 3300009551 | Ga0105238_10151385 | Ga0105238_101513852 | 282 |
| 227 | 3300009553 | Ga0105249_10008628 | Ga0105249_100086285 | 282 |
| 228 | 3300009553 | Ga0105249_10069986 | Ga0105249_100699862 | 282 |
| 229 | 3300010375 | Ga0105239_10041754 | Ga0105239_100417544 | 282 |
| 230 | 3300010375 | Ga0105239_10101977 | Ga0105239_101019772 | 282 |
| 231 | 3300011119 | Ga0105246_10023038 | Ga0105246_100230381 | 282 |
| 232 | 3300011119 | Ga0105246_10084543 | Ga0105246_100845433 | 282 |
| 233 | 3300013102 | Ga0157371_10044871 | Ga0157371_100448713 | 282 |
| 234 | 3300013104 | Ga0157370_10035692 | Ga0157370_100356924 | 282 |
| 235 | 3300013105 | Ga0157369_10512164 | Ga0157369_105121642 | 282 |
| 236 | 3300013296 | Ga0157374_10080140 | Ga0157374_100801402 | 282 |
| 237 | 3300013296 | Ga0157374_10308435 | Ga0157374_103084352 | 282 |
| 238 | 3300013297 | Ga0157378_10019690 | Ga0157378_100196904 | 282 |
| 239 | 3300013307 | Ga0157372_10031558 | Ga0157372_100315583 | 282 |
| 240 | 3300013307 | Ga0157372_10172917 | Ga0157372_101729173 | 282 |
| 241 | 3300013307 | Ga0157372_10286675 | Ga0157372_102866752 | 282 |
| 242 | 3300014325 | Ga0163163_10130677 | Ga0163163_101306772 | 282 |
| 243 | 3300014969 | Ga0157376_10047689 | Ga0157376_100476893 | 282 |
| 244 | 3300025231 | Ga0207427_104105 | Ga0207427_1041054 | 282 |
| 245 | 3300025261 | Ga0209233_1000545 | Ga0209233_100054513 | 282 |
| 246 | 3300025321 | Ga0207656_10000992 | Ga0207656_100009927 | 282 |
| 247 | 3300025900 | Ga0207710_10136026 | Ga0207710_101360262 | 282 |
| 248 | 3300025903 | Ga0207680_10248087 | Ga0207680_102480872 | 282 |
| 249 | 3300025905 | Ga0207685_10118558 | Ga0207685_101185582 | 282 |
| 250 | 3300025907 | Ga0207645_10053308 | Ga0207645_100533083 | 282 |
| 251 | 3300025911 | Ga0207654_10036112 | Ga0207654_100361122 | 282 |
| 252 | 3300025911 | Ga0207654_10081386 | Ga0207654_100813862 | 282 |
| 253 | 3300025913 | Ga0207695_10269210 | Ga0207695_102692102 | 282 |
| 254 | 3300025914 | Ga0207671_10080810 | Ga0207671_100808102 | 282 |
| 255 | 3300025919 | Ga0207657_10006492 | Ga0207657_1000649210 | 282 |
| 256 | 3300025919 | Ga0207657_10064441 | Ga0207657_100644413 | 282 |
| 257 | 3300025919 | Ga0207657_10128967 | Ga0207657_101289672 | 282 |
| 258 | 3300025920 | Ga0207649_10021851 | Ga0207649_100218512 | 282 |
| 259 | 3300025920 | Ga0207649_10039194 | Ga0207649_100391942 | 282 |
| 260 | 3300025924 | Ga0207694_10008356 | Ga0207694_100083563 | 282 |
| 261 | 3300025924 | Ga0207694_10040273 | Ga0207694_100402733 | 282 |
| 262 | 3300025924 | Ga0207694_10100774 | Ga0207694_101007743 | 282 |
| 263 | 3300025924 | Ga0207694_10465605 | Ga0207694_104656052 | 282 |
| 264 | 3300025927 | Ga0207687_10001994 | Ga0207687_100019948 | 282 |
| 265 | 3300025931 | Ga0207644_10539015 | Ga0207644_105390152 | 282 |
| 266 | 3300025932 | Ga0207690_10205206 | Ga0207690_102052062 | 282 |
| 267 | 3300025933 | Ga0207706_10025304 | Ga0207706_100253042 | 282 |
| 268 | 3300025934 | Ga0207686_10068510 | Ga0207686_100685102 | 282 |
| 269 | 3300025936 | Ga0207670_10132185 | Ga0207670_101321852 | 282 |
| 270 | 3300025941 | Ga0207711_10001248 | Ga0207711_1000124819 | 282 |
| 271 | 3300025941 | Ga0207711_10115785 | Ga0207711_101157852 | 282 |
| 272 | 3300025944 | Ga0207661_10200649 | Ga0207661_102006491 | 282 |
| 273 | 3300025949 | Ga0207667_10016250 | Ga0207667_100162503 | 282 |
| 274 | 3300025949 | Ga0207667_10156484 | Ga0207667_101564842 | 282 |
| 275 | 3300025949 | Ga0207667_10186604 | Ga0207667_101866042 | 282 |
| 276 | 3300025949 | Ga0207667_10373857 | Ga0207667_103738572 | 282 |
| 277 | 3300025960 | Ga0207651_10029982 | Ga0207651_100299823 | 282 |
| 278 | 3300025981 | Ga0207640_10102702 | Ga0207640_101027022 | 282 |
| 279 | 3300025981 | Ga0207640_10108210 | Ga0207640_101082103 | 282 |
| 280 | 3300025986 | Ga0207658_10240373 | Ga0207658_102403732 | 282 |
| 281 | 3300026035 | Ga0207703_10003526 | Ga0207703_100035262 | 282 |
| 282 | 3300026035 | Ga0207703_10446838 | Ga0207703_104468381 | 282 |
| 283 | 3300026041 | Ga0207639_10000588 | Ga0207639_100005884 | 282 |
| 284 | 3300026041 | Ga0207639_10072933 | Ga0207639_100729332 | 282 |
| 285 | 3300026078 | Ga0207702_10036743 | Ga0207702_100367433 | 282 |
| 286 | 3300026078 | Ga0207702_10220547 | Ga0207702_102205472 | 282 |
| 287 | 3300026088 | Ga0207641_10134932 | Ga0207641_101349322 | 282 |
| 288 | 3300026116 | Ga0207674_10002211 | Ga0207674_100022117 | 282 |
| 289 | 3300026116 | Ga0207674_10033773 | Ga0207674_100337734 | 282 |
| 290 | 3300026116 | Ga0207674_10238401 | Ga0207674_102384013 | 282 |
| 291 | 3300026142 | Ga0207698_10015926 | Ga0207698_100159262 | 282 |
| 292 | 3300028577 | Ga0265318_10029052 | Ga0265318_100290523 | 282 |
| 293 | 3300028800 | Ga0265338_10026029 | Ga0265338_100260293 | 282 |
| 294 | 3300031235 | Ga0265330_10015665 | Ga0265330_100156652 | 282 |
| 295 | 3300031241 | Ga0265325_10011187 | Ga0265325_100111874 | 282 |
| 296 | 3300031249 | Ga0265339_10000247 | Ga0265339_1000024712 | 282 |
| 297 | 3300031548 | Ga0307408_100450186 | Ga0307408_1004501861 | 282 |
| 298 | 3300031595 | Ga0265313_10000137 | Ga0265313_1000013732 | 282 |
| 299 | 3300031595 | Ga0265313_10007775 | Ga0265313_100077756 | 282 |
| 300 | 3300032002 | Ga0307416_100576668 | Ga0307416_1005766682 | 282 |
| 301 | 3300035086 | Ga0373934_0002444 | Ga0373934_0002444_2901_3791 | 282 |
| 302 | 3300035111 | Ga0373923_0007039 | Ga0373923_0007039_593_1483 | 282 |
| 303 | 3300035117 | Ga0373953_0097421 | Ga0373953_0097421_237_1127 | 282 |
| 304 | 3300035118 | Ga0373954_0000516 | Ga0373954_0000516_8039_8929 | 282 |
| 305 | 3300035118 | Ga0373954_0018927 | Ga0373954_0018927_1178_2068 | 282 |
| 306 | 3300035172 | Ga0373955_0012553 | Ga0373955_0012553_730_1620 | 282 |
| 307 | 3300035172 | Ga0373955_0147440 | Ga0373955_0147440_369_1259 | 282 |
| 308 | 3300035724 | Ga0373933_0007183 | Ga0373933_0007183_4234_5157 | 282 |
| 309 | 3300036401 | Ga0373937_0006000 | Ga0373937_0006000_985_1875 | 282 |
| 310 | 3300036401 | Ga0373937_0013155 | Ga0373937_0013155_1287_2177 | 282 |
| 311 | 3300036401 | Ga0373937_0043445 | Ga0373937_0043445_405_1328 | 282 |
| 312 | 3300038443 | Ga0395901_0159534 | Ga0395901_0159534_1289_2137 | 282 |
| 313 | 3300042004 | Ga0439445_0005912 | Ga0439445_0005912_1138_1986 | 282 |
| 314 | 3300044694 | Ga0466963_0214131 | Ga0466963_0214131_208_1056 | 282 |
| 315 | 3300044694 | Ga0466963_0431442 | Ga0466963_0431442_40_888 | 282 |
| 316 | 3300045976 | Ga0466967_0007871 | Ga0466967_0007871_636_1484 | 282 |
| 317 | 3300046454 | Ga0495592_0027382 | Ga0495592_0027382_303_1226 | 282 |
| 318 | 3300046462 | Ga0495651_0034339 | Ga0495651_0034339_1262_2152 | 282 |
| 319 | 3300046472 | Ga0495580_0119296 | Ga0495580_0119296_70_927 | 282 |
| 320 | 3300046475 | Ga0495639_0006734 | Ga0495639_0006734_3282_4154 | 282 |
| 321 | 3300046499 | Ga0495594_0270326 | Ga0495594_0270326_60_932 | 282 |
| 322 | 3300046511 | Ga0495608_0033982 | Ga0495608_0033982_2435_3325 | 282 |
| 323 | 3300046519 | Ga0495632_0123917 | Ga0495632_0123917_70_918 | 282 |
| 324 | 3300046529 | Ga0495652_0062838 | Ga0495652_0062838_2223_3113 | 282 |
| 325 | 3300046536 | Ga0495587_0000561 | Ga0495587_0000561_23704_24627 | 282 |
| 326 | 3300046689 | Ga0495613_0094991 | Ga0495613_0094991_1115_1987 | 282 |
| 327 | 3300047444 | Ga0495675_0125804 | Ga0495675_0125804_417_1307 | 282 |
| 328 | 3300047471 | Ga0495684_0003073 | Ga0495684_0003073_6559_7449 | 282 |
| 329 | 3300048088 | Ga0495602_0003250 | Ga0495602_0003250_5130_6053 | 282 |
| 330 | 3300048907 | Ga0496104_0101005 | Ga0496104_0101005_936_1823 | 282 |
| 331 | 3300049568 | Ga0501031_0023094 | Ga0501031_0023094_91_939 | 282 |
| 332 | 3300049569 | Ga0501032_0082801 | Ga0501032_0082801_854_1702 | 282 |
| 333 | 3300049569 | Ga0501032_0205755 | Ga0501032_0205755_78_926 | 282 |
| 334 | 3300049570 | Ga0501033_0023597 | Ga0501033_0023597_1283_2131 | 282 |
| 335 | 3300049570 | Ga0501033_0077168 | Ga0501033_0077168_416_1264 | 282 |
| 336 | 3300049571 | Ga0501034_0143114 | Ga0501034_0143114_233_1081 | 282 |
| 337 | 3300049571 | Ga0501034_0347774 | Ga0501034_0347774_229_1077 | 282 |
| 338 | 3300049572 | Ga0501036_0029209 | Ga0501036_0029209_2610_3458 | 282 |
| 339 | 3300049573 | Ga0501037_0022301 | Ga0501037_0022301_1835_2683 | 282 |
| 340 | 3300049574 | Ga0501038_0071272 | Ga0501038_0071272_186_1034 | 282 |
| 341 | 3300049575 | Ga0501039_0057166 | Ga0501039_0057166_1093_1941 | 282 |
| 342 | 3300049581 | Ga0501047_0054565 | Ga0501047_0054565_563_1411 | 282 |
| 343 | 3300049581 | Ga0501047_0428713 | Ga0501047_0428713_239_1087 | 282 |
| 344 | 3300049584 | Ga0501068_0206311 | Ga0501068_0206311_200_1048 | 282 |
| 345 | 3300049586 | Ga0501070_0028668 | Ga0501070_0028668_985_1833 | 282 |
| 346 | 3300049586 | Ga0501070_0357738 | Ga0501070_0357738_321_1169 | 282 |
| 347 | 3300049589 | Ga0501073_0040731 | Ga0501073_0040731_164_1012 | 282 |
| 348 | 3300049742 | Ga0501080_0154616 | Ga0501080_0154616_1030_1878 | 282 |
| 349 | 3300049822 | Ga0501035_0010167 | Ga0501035_0010167_2876_3724 | 282 |
| 350 | 3300049823 | Ga0501044_0122142 | Ga0501044_0122142_1667_2515 | 282 |
| 351 | 3300050507 | nmdc:mga05p37_688465_c1 | nmdc:mga05p37_688465_c1_196_1053 | 282 |
| 352 | 3300053077 | Ga0495601_0105984 | Ga0495601_0105984_59_916 | 282 |
| 353 | 3300053085 | Ga0495619_0173115 | Ga0495619_0173115_411_1301 | 282 |
| 354 | 3300053130 | Ga0500642_0004224 | Ga0500642_0004224_3001_3849 | 282 |
| 355 | 3300005347 | Ga0070668_100488873 | Ga0070668_1004888731 | 283 |
| 356 | 3300005367 | Ga0070667_100139672 | Ga0070667_1001396723 | 283 |
| 357 | 3300005435 | Ga0070714_100347366 | Ga0070714_1003473662 | 283 |
| 358 | 3300005437 | Ga0070710_10043588 | Ga0070710_100435883 | 283 |
| 359 | 3300005843 | Ga0068860_100063237 | Ga0068860_1000632373 | 283 |
| 360 | 3300009553 | Ga0105249_10535510 | Ga0105249_105355101 | 283 |
| 361 | 3300013297 | Ga0157378_10539648 | Ga0157378_105396481 | 283 |
| 362 | 3300025898 | Ga0207692_10064506 | Ga0207692_100645062 | 283 |
| 363 | 3300025901 | Ga0207688_10119385 | Ga0207688_101193851 | 283 |
| 364 | 3300025903 | Ga0207680_10307182 | Ga0207680_103071821 | 283 |
| 365 | 3300025917 | Ga0207660_10248493 | Ga0207660_102484931 | 283 |
| 366 | 3300025924 | Ga0207694_10309049 | Ga0207694_103090492 | 283 |
| 367 | 3300025972 | Ga0207668_10188418 | Ga0207668_101884182 | 283 |
| 368 | 3300025986 | Ga0207658_10042667 | Ga0207658_100426672 | 283 |
| 369 | 3300028381 | Ga0268264_10025649 | Ga0268264_100256495 | 283 |
| 370 | 3300028577 | Ga0265318_10012180 | Ga0265318_100121803 | 283 |
| 371 | 3300031344 | Ga0265316_10012667 | Ga0265316_100126676 | 283 |
| 372 | 3300031595 | Ga0265313_10006147 | Ga0265313_100061472 | 283 |
| 373 | 3300031711 | Ga0265314_10018720 | Ga0265314_100187204 | 283 |
| 374 | 3300038443 | Ga0395901_0172065 | Ga0395901_0172065_564_1415 | 283 |
| 375 | 3300046491 | Ga0495584_0062166 | Ga0495584_0062166_901_1755 | 283 |
| 376 | 3300048924 | Ga0496121_0119133 | Ga0496121_0119133_826_1677 | 283 |
| 377 | 3300049569 | Ga0501032_0209463 | Ga0501032_0209463_158_1009 | 283 |
| 378 | 3300049580 | Ga0501046_0106575 | Ga0501046_0106575_1083_1934 | 283 |
| 379 | 3300049583 | Ga0501067_0002501 | Ga0501067_0002501_5570_6421 | 283 |
| 380 | 3300049586 | Ga0501070_0423274 | Ga0501070_0423274_35_886 | 283 |
| 381 | 3300049742 | Ga0501080_0055640 | Ga0501080_0055640_2104_2955 | 283 |
| 382 | 3300049744 | Ga0501083_0028855 | Ga0501083_0028855_2505_3356 | 283 |
| 383 | 3300049822 | Ga0501035_0227064 | Ga0501035_0227064_113_964 | 283 |
| 384 | 3300054114 | Ga0501084_0096525 | Ga0501084_0096525_1149_2000 | 283 |
| 385 | 3300054114 | Ga0501084_0162271 | Ga0501084_0162271_976_1827 | 283 |
| 386 | 3300060353 | Ga0501082_0029327 | Ga0501082_0029327_1595_2446 | 283 |
| 387 | 3300044684 | Ga0466966_0231948 | Ga0466966_0231948_94_948 | 284 |
| 388 | 3300044842 | Ga0466957_0029478 | Ga0466957_0029478_1899_2753 | 284 |
| 389 | 3300048922 | Ga0496119_0000198 | Ga0496119_0000198_36938_37792 | 284 |
| 390 | 3300053077 | Ga0495601_0208769 | Ga0495601_0208769_207_1061 | 284 |
| 391 | 3300061719 | Ga0466962_0039430 | Ga0466962_0039430_474_1328 | 284 |
| 392 | 3300003187 | JGI25151J46595_10000149 | JGI25151J46595_1000014917 | 285 |
| 393 | 3300005336 | Ga0070680_100237958 | Ga0070680_1002379582 | 285 |
| 394 | 3300005434 | Ga0070709_10165279 | Ga0070709_101652792 | 285 |
| 395 | 3300005434 | Ga0070709_10219003 | Ga0070709_102190032 | 285 |
| 396 | 3300005436 | Ga0070713_100050324 | Ga0070713_1000503243 | 285 |
| 397 | 3300005439 | Ga0070711_100011205 | Ga0070711_1000112054 | 285 |
| 398 | 3300005439 | Ga0070711_100037368 | Ga0070711_1000373683 | 285 |
| 399 | 3300005458 | Ga0070681_10035705 | Ga0070681_100357051 | 285 |
| 400 | 3300005518 | Ga0070699_100157392 | Ga0070699_1001573922 | 285 |
| 401 | 3300005546 | Ga0070696_100250393 | Ga0070696_1002503931 | 285 |
| 402 | 3300005983 | Ga0081540_1018129 | Ga0081540_10181293 | 285 |
| 403 | 3300006038 | Ga0075365_10192103 | Ga0075365_101921032 | 285 |
| 404 | 3300006173 | Ga0070716_100018345 | Ga0070716_1000183453 | 285 |
| 405 | 3300006175 | Ga0070712_100029089 | Ga0070712_1000290896 | 285 |
| 406 | 3300006175 | Ga0070712_100098340 | Ga0070712_1000983402 | 285 |
| 407 | 3300006175 | Ga0070712_100202398 | Ga0070712_1002023982 | 285 |
| 408 | 3300006914 | Ga0075436_100351412 | Ga0075436_1003514122 | 285 |
| 409 | 3300009093 | Ga0105240_10187642 | Ga0105240_101876422 | 285 |
| 410 | 3300009094 | Ga0111539_10000107 | Ga0111539_1000010755 | 285 |
| 411 | 3300009174 | Ga0105241_10159343 | Ga0105241_101593433 | 285 |
| 412 | 3300009551 | Ga0105238_10076576 | Ga0105238_100765762 | 285 |
| 413 | 3300013307 | Ga0157372_10084740 | Ga0157372_100847402 | 285 |
| 414 | 3300025294 | Ga0209025_1000270 | Ga0209025_1000270104 | 285 |
| 415 | 3300025297 | Ga0209758_1007187 | Ga0209758_10071876 | 285 |
| 416 | 3300025915 | Ga0207693_10015201 | Ga0207693_100152018 | 285 |
| 417 | 3300025915 | Ga0207693_10015354 | Ga0207693_100153545 | 285 |
| 418 | 3300025915 | Ga0207693_10169593 | Ga0207693_101695932 | 285 |
| 419 | 3300025916 | Ga0207663_10133027 | Ga0207663_101330273 | 285 |
| 420 | 3300025917 | Ga0207660_10145951 | Ga0207660_101459512 | 285 |
| 421 | 3300027682 | Ga0209971_1021880 | Ga0209971_10218801 | 285 |
| 422 | 3300027695 | Ga0209966_1001356 | Ga0209966_10013563 | 285 |
| 423 | 3300027907 | Ga0207428_10000040 | Ga0207428_1000004033 | 285 |
| 424 | 3300031241 | Ga0265325_10026567 | Ga0265325_100265673 | 285 |
| 425 | 3300031247 | Ga0265340_10069410 | Ga0265340_100694102 | 285 |
| 426 | 3300031595 | Ga0265313_10000062 | Ga0265313_1000006256 | 285 |
| 427 | 3300035117 | Ga0373953_0017234 | Ga0373953_0017234_787_1647 | 285 |
| 428 | 3300035118 | Ga0373954_0118075 | Ga0373954_0118075_182_1042 | 285 |
| 429 | 3300035120 | Ga0373957_0014519 | Ga0373957_0014519_191_1051 | 285 |
| 430 | 3300035171 | Ga0373946_0005368 | Ga0373946_0005368_493_1353 | 285 |
| 431 | 3300035410 | Ga0373924_0036975 | Ga0373924_0036975_728_1588 | 285 |
| 432 | 3300035691 | Ga0373931_0025178 | Ga0373931_0025178_2044_2904 | 285 |
| 433 | 3300035724 | Ga0373933_0006840 | Ga0373933_0006840_5133_5993 | 285 |
| 434 | 3300037418 | Ga0395900_0038991 | Ga0395900_0038991_917_1774 | 285 |
| 435 | 3300042439 | Ga0439464_0027513 | Ga0439464_0027513_345_1205 | 285 |
| 436 | 3300046454 | Ga0495592_0001467 | Ga0495592_0001467_982_1842 | 285 |
| 437 | 3300046460 | Ga0495638_0137757 | Ga0495638_0137757_309_1166 | 285 |
| 438 | 3300046462 | Ga0495651_0005926 | Ga0495651_0005926_3785_4645 | 285 |
| 439 | 3300046463 | Ga0495653_0060278 | Ga0495653_0060278_1404_2264 | 285 |
| 440 | 3300046477 | Ga0495664_0172520 | Ga0495664_0172520_366_1226 | 285 |
| 441 | 3300046511 | Ga0495608_0010996 | Ga0495608_0010996_3738_4598 | 285 |
| 442 | 3300046516 | Ga0495628_0001714 | Ga0495628_0001714_2999_3859 | 285 |
| 443 | 3300046536 | Ga0495587_0020579 | Ga0495587_0020579_2367_3227 | 285 |
| 444 | 3300046543 | Ga0495645_0000223 | Ga0495645_0000223_6095_6955 | 285 |
| 445 | 3300046663 | Ga0495635_0047278 | Ga0495635_0047278_889_1749 | 285 |
| 446 | 3300046675 | Ga0495657_0021350 | Ga0495657_0021350_1220_2080 | 285 |
| 447 | 3300046678 | Ga0495599_0001359 | Ga0495599_0001359_7555_8415 | 285 |
| 448 | 3300046679 | Ga0495623_0032010 | Ga0495623_0032010_1667_2527 | 285 |
| 449 | 3300046680 | Ga0495646_0044814 | Ga0495646_0044814_593_1453 | 285 |
| 450 | 3300046683 | Ga0495658_0139907 | Ga0495658_0139907_216_1076 | 285 |
| 451 | 3300047317 | Ga0495604_0001128 | Ga0495604_0001128_14008_14868 | 285 |
| 452 | 3300047322 | Ga0495680_0006632 | Ga0495680_0006632_5593_6453 | 285 |
| 453 | 3300047444 | Ga0495675_0054421 | Ga0495675_0054421_638_1498 | 285 |
| 454 | 3300048088 | Ga0495602_0030168 | Ga0495602_0030168_3902_4762 | 285 |
| 455 | 3300048907 | Ga0496104_0000537 | Ga0496104_0000537_10383_11243 | 285 |
| 456 | 3300048908 | Ga0496105_0004684 | Ga0496105_0004684_1705_2565 | 285 |
| 457 | 3300048915 | Ga0496112_0131970 | Ga0496112_0131970_909_1769 | 285 |
| 458 | 3300049569 | Ga0501032_0078902 | Ga0501032_0078902_919_1779 | 285 |
| 459 | 3300049571 | Ga0501034_0050979 | Ga0501034_0050979_2461_3321 | 285 |
| 460 | 3300049575 | Ga0501039_0196777 | Ga0501039_0196777_551_1414 | 285 |
| 461 | 3300049581 | Ga0501047_0004012 | Ga0501047_0004012_5649_6509 | 285 |
| 462 | 3300049581 | Ga0501047_0034657 | Ga0501047_0034657_1747_2610 | 285 |
| 463 | 3300049583 | Ga0501067_0053439 | Ga0501067_0053439_403_1266 | 285 |
| 464 | 3300049585 | Ga0501069_0013536 | Ga0501069_0013536_2088_2945 | 285 |
| 465 | 3300049585 | Ga0501069_0046124 | Ga0501069_0046124_493_1356 | 285 |
| 466 | 3300049586 | Ga0501070_0011213 | Ga0501070_0011213_4255_5112 | 285 |
| 467 | 3300049586 | Ga0501070_0012528 | Ga0501070_0012528_2625_3482 | 285 |
| 468 | 3300049587 | Ga0501071_0088128 | Ga0501071_0088128_1295_2158 | 285 |
| 469 | 3300049589 | Ga0501073_0031711 | Ga0501073_0031711_931_1794 | 285 |
| 470 | 3300049589 | Ga0501073_0151797 | Ga0501073_0151797_149_1006 | 285 |
| 471 | 3300049741 | Ga0501079_0071931 | Ga0501079_0071931_1197_2060 | 285 |
| 472 | 3300049742 | Ga0501080_0039777 | Ga0501080_0039777_424_1281 | 285 |
| 473 | 3300049742 | Ga0501080_0058452 | Ga0501080_0058452_2366_3229 | 285 |
| 474 | 3300049744 | Ga0501083_0004629 | Ga0501083_0004629_739_1599 | 285 |
| 475 | 3300049744 | Ga0501083_0017118 | Ga0501083_0017118_2253_3113 | 285 |
| 476 | 3300049744 | Ga0501083_0084963 | Ga0501083_0084963_54_914 | 285 |
| 477 | 3300049822 | Ga0501035_0000453 | Ga0501035_0000453_22677_23534 | 285 |
| 478 | 3300049823 | Ga0501044_0431031 | Ga0501044_0431031_117_974 | 285 |
| 479 | 3300050509 | nmdc:mga0qj67_160_c1 | nmdc:mga0qj67_160_c1_6422_7282 | 285 |
| 480 | 3300050511 | nmdc:mga08y16_233_c1 | nmdc:mga08y16_233_c1_14499_15356 | 285 |
| 481 | 3300053078 | Ga0495612_0010559 | Ga0495612_0010559_930_1790 | 285 |
| 482 | 3300053084 | Ga0495595_0001916 | Ga0495595_0001916_6779_7639 | 285 |
| 483 | 3300053085 | Ga0495619_0000520 | Ga0495619_0000520_24139_24999 | 285 |
| 484 | 3300060353 | Ga0501082_0277431 | Ga0501082_0277431_296_1156 | 285 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1poi-assembly1.cif.gz_A | crystal structure of glutaconate coenzyme a-transferase from acidaminococcus fermentans to 2.55 angstoms resolution | 0.8885 | 2 | 278 |
| 6co9-assembly1.cif.gz_A | crystal structure of rhodococcus jostii rha1 ipdab cochea-coa complex | 0.8776 | 1 | 284 |
| 5mzx-assembly1.cif.gz_C | crystal structure of the decarboxylase aiba/aibb in complex with 4'-diphospho pantetheine | 0.8729 | 2 | 268 |
| 6co9-assembly1.cif.gz_A | crystal structure of rhodococcus jostii rha1 ipdab cochea-coa complex | 0.8718 | 1 | 284 |
| 6con-assembly2.cif.gz_G | crystal structure of mycobacterium tuberculosis ipdab | 0.8709 | 1 | 284 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1poiA01 | Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase | 0.8881 | 2 | 278 | 3.40.1080.10 |
| 5dbnA00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase | 0.8464 | 1 | 223 | 3.40.1080.10 |
| 5dbnA00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase | 0.8357 | 1 | 223 | 3.40.1080.10 |
| 1poiA01 | Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase | 0.8114 | 2 | 278 | 3.40.1080.10 |
| af_Q2G1C6_6_271_3.40.1080.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase | 0.8113 | 1 | 232 | 3.40.1080.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3S1UZU6-F1-model_v4 | CoA transferase subunit A | 0.9775 | 1 | 199 |
GO:0008410
|
| AF-A0A531YTP3-F1-model_v4 | deleted | 0.9773 | 165 | 233 |
|
| AF-A0A4U8Z744-F1-model_v4 | Putative Glutaconate CoA-transferase (EC 2.8.3.12) | 0.9753 | 1 | 226 |
GO:0018730
|
| AF-A0A1I3G4H7-F1-model_v4 | Glutaconate CoA-transferase subunit A | 0.9736 | 1 | 268 |
GO:0008410
|
| AF-A0A350DJ37-F1-model_v4 | 3-oxoadipate--succinyl-CoA transferase subunit A | 0.9733 | 1 | 193 |
GO:0008410
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar