F452897

General Info

Members Datasets Scaffolds Average Seq Length
484 266 472 283

Family's Representative Sequence

Representative Sequence 3300005548|Ga0070665_100043091|Ga0070665_1000430914
Length 333
Sequence VPKLYAGVQWRGHVSFLAVMQQAETIIFRAQLAVLLCRRASEERRFSYVWEDMAEFLSLAEAVDRNLNDGDIVAFEGFTHLIPHAAAHEAIRQGKKDLTLLRMTPDIIYDQMIGMGLAKKVIFSYAGNPGVGLLRRMRDAIENGYPRGIETVEHSHSAMAQAYEAGASGLPLALFRGYKGADLAKVNPDIRAIACPFTGEELAAIPAHRPDVTFIHAQKASRKGDVLIEGIIGVQKEAALAAKRVVVTVEEVVDDFKGFHPNLCILPHWTIDAIAVVPGGAHPSYAYGYYQRDNAAYLEWDKVSADRELFSAWIMENVMAVGPDAFAARVRDL

Samples

Sample ID Description Type Environment
1 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
2 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
3 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
4 2773857925 Microvirga vignae BR3299 Isolate Unclassified
5 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
6 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
7 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
8 2884298095 Microvirga thermotolerans HR1 Isolate Rhizosphere
9 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
10 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
11 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
12 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
13 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
57 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
58 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
59 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
60 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
61 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
79 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
89 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
90 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
91 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
92 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
142 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
145 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
146 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
147 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
148 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
149 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
150 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
151 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
152 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
153 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
154 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
155 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
156 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
157 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
158 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
159 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
160 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
161 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
162 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
163 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
164 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
165 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
166 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
167 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
168 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
169 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
170 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
171 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
172 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
173 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
174 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
175 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
176 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
177 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
178 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
179 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
180 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
181 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
182 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
183 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
184 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
185 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
186 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
187 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
188 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
189 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
190 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
191 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
192 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
193 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
194 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
195 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
196 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
197 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
198 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
199 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
200 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
201 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
202 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
203 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
204 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
205 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
206 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
207 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
208 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
209 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
210 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
211 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
212 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
213 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
214 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
215 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
216 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
217 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
218 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
219 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
220 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
221 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
222 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
223 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
224 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
235 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
236 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
237 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
238 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
239 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
240 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
241 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
242 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
243 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
244 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
245 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
246 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
248 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
249 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
250 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
251 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
252 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
253 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
254 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
255 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
256 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
257 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
258 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
259 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
260 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
261 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
262 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
263 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
264 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
265 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified
266 8057160832 Larsenimonas rhizosphaerae GH2-1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.31
Metatranscriptomes 0
Isolates 2.69

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.31
Nodule 0.62
Rhizoplane 1.03
Rhizosphere 92.56
Stem 0
Stem Tuber 0
Unclassified 2.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10000149 3300003187 Bacteria 91894
2 rootH1_10098140 3300003316 Unclassified 2001
3 rootH1_10098140 3300003323 Bacteria 4018
4 Ga0070658_10047509 3300005327 Bacteria 3474
5 Ga0070683_100000407 3300005329 Bacteria 29702
6 Ga0070683_100014241 3300005329 Bacteria 6951
7 Ga0070683_100042834 3300005329 Bacteria 4170
8 Ga0070690_100092798 3300005330 Bacteria 1991
9 Ga0070670_100069527 3300005331 Bacteria 3022
10 Ga0070680_100003368 3300005336 Bacteria 11929
11 Ga0070680_100237958 3300005336 Bacteria 1538
12 Ga0070682_100092142 3300005337 Bacteria 1985
13 Ga0068868_100080907 3300005338 Bacteria 2604
14 Ga0070660_100205295 3300005339 Bacteria 1599
15 Ga0070689_100049793 3300005340 Bacteria 3235
16 Ga0070691_10000505 3300005341 Bacteria 14641
17 Ga0070661_100000540 3300005344 Bacteria 28990
18 Ga0070661_100011131 3300005344 Bacteria 6265
19 Ga0070661_100035485 3300005344 Bacteria 3621
20 Ga0070668_100042325 3300005347 Bacteria 3491
21 Ga0070668_100209142 3300005347 Bacteria 1604
22 Ga0070668_100488873 3300005347 Bacteria 1064
23 Ga0070671_100250530 3300005355 Bacteria 1504
24 Ga0070671_100299929 3300005355 Bacteria 1368
25 Ga0070673_100055058 3300005364 Bacteria 3133
26 Ga0070659_100002010 3300005366 Bacteria 14532
27 Ga0070659_100053804 3300005366 Bacteria 3169
28 Ga0070659_100087481 3300005366 Bacteria 2494
29 Ga0070667_100139672 3300005367 Bacteria 2120
30 Ga0070709_10028528 3300005434 Bacteria 3329
31 Ga0070709_10165279 3300005434 Bacteria 1542
32 Ga0070709_10219003 3300005434 Bacteria 1356
33 Ga0070714_100000313 3300005435 Bacteria 36745
34 Ga0070714_100040448 3300005435 Bacteria 3930
35 Ga0070714_100347366 3300005435 Bacteria 1393
36 Ga0070713_100001282 3300005436 Bacteria 16071
37 Ga0070713_100050324 3300005436 Bacteria 3441
38 Ga0070713_100085185 3300005436 Bacteria 2706
39 Ga0070710_10043588 3300005437 Bacteria 2486
40 Ga0070711_100011205 3300005439 Bacteria 5560
41 Ga0070711_100011700 3300005439 Bacteria 5455
42 Ga0070711_100037368 3300005439 Bacteria 3259
43 Ga0070694_100138321 3300005444 Bacteria 1766
44 Ga0070663_100087760 3300005455 Bacteria 2299
45 Ga0070678_100128626 3300005456 Bacteria 2009
46 Ga0070681_10000278 3300005458 Bacteria 40975
47 Ga0070681_10035705 3300005458 Bacteria 4992
48 Ga0070681_10529561 3300005458 Bacteria 1092
49 Ga0070699_100157392 3300005518 Bacteria 2010
50 Ga0070679_100010630 3300005530 Bacteria 8735
51 Ga0070684_100000856 3300005535 Bacteria 21482
52 Ga0070684_100010398 3300005535 Bacteria 7370
53 Ga0070684_100590462 3300005535 Bacteria 1032
54 Ga0068853_100004900 3300005539 Bacteria 10416
55 Ga0068853_100010891 3300005539 Bacteria 7366
56 Ga0068853_100014976 3300005539 Bacteria 6370
57 Ga0068853_100074442 3300005539 Bacteria 2963
58 Ga0068853_100161375 3300005539 Bacteria 2023
59 Ga0070696_100250393 3300005546 Bacteria 1339
60 Ga0070693_100027846 3300005547 Bacteria 3067
61 Ga0070665_100043091 3300005548 Bacteria 4536
62 Ga0070665_100386483 3300005548 Bacteria 1407
63 Ga0068855_100010388 3300005563 Bacteria 11229
64 Ga0068855_100045877 3300005563 Bacteria 5167
65 Ga0068855_100100706 3300005563 Bacteria 3326
66 Ga0068855_100179572 3300005563 Bacteria 2394
67 Ga0068855_100279673 3300005563 Bacteria 1854
68 Ga0070664_100342213 3300005564 Bacteria 1359
69 Ga0070664_100503128 3300005564 Bacteria 1117
70 Ga0068857_100000139 3300005577 Bacteria 44602
71 Ga0068857_100055671 3300005577 Bacteria 3509
72 Ga0068857_100063978 3300005577 Bacteria 3270
73 Ga0068857_100073911 3300005577 Bacteria 3038
74 Ga0068857_100180156 3300005577 Bacteria 1923
75 Ga0068854_100005496 3300005578 Bacteria 8005
76 Ga0068854_100016209 3300005578 Bacteria 4961
77 Ga0068854_100050160 3300005578 Bacteria 2985
78 Ga0068856_100003335 3300005614 Bacteria 16308
79 Ga0068856_100095086 3300005614 Bacteria 2967
80 Ga0068856_100245009 3300005614 Bacteria 1807
81 Ga0068856_100329504 3300005614 Bacteria 1544
82 Ga0068852_100000952 3300005616 Bacteria 19050
83 Ga0068852_100009656 3300005616 Bacteria 7169
84 Ga0068852_100010635 3300005616 Bacteria 6885
85 Ga0068852_100227152 3300005616 Bacteria 1778
86 Ga0068866_10238815 3300005718 Bacteria 1106
87 Ga0068851_10000929 3300005834 Bacteria 12645
88 Ga0068851_10031083 3300005834 Bacteria 2650
89 Ga0068858_100029046 3300005842 Bacteria 5135
90 Ga0068858_100076638 3300005842 Bacteria 3105
91 Ga0068860_100063237 3300005843 Bacteria 3515
92 Ga0081540_1018129 3300005983 Bacteria 4331
93 Ga0070717_10050758 3300006028 Bacteria 3411
94 Ga0075365_10059452 3300006038 Bacteria 2548
95 Ga0075365_10192103 3300006038 Bacteria 1429
96 Ga0075365_10193041 3300006038 Bacteria 1425
97 Ga0070715_10061247 3300006163 Bacteria 1652
98 Ga0070716_100018345 3300006173 Bacteria 3644
99 Ga0070712_100029089 3300006175 Bacteria 3702
100 Ga0070712_100098340 3300006175 Bacteria 2158
101 Ga0070712_100202398 3300006175 Bacteria 1561
102 Ga0068871_100006980 3300006358 Bacteria 8047
103 Ga0068871_100029295 3300006358 Bacteria 4322
104 Ga0068871_100066256 3300006358 Bacteria 2960
105 Ga0068871_100106405 3300006358 Bacteria 2355
106 Ga0068871_100478291 3300006358 Bacteria 1120
107 Ga0075436_100351412 3300006914 Bacteria 1062
108 Ga0075436_100399267 3300006914 Bacteria 996
109 Ga0097620_100004436 3300006931 Bacteria 14320
110 Ga0105240_10006325 3300009093 Bacteria 17434
111 Ga0105240_10034029 3300009093 Bacteria 6577
112 Ga0105240_10187642 3300009093 Bacteria 2434
113 Ga0105240_10267517 3300009093 Bacteria 1970
114 Ga0105240_10284146 3300009093 Bacteria 1899
115 Ga0105240_10340903 3300009093 Bacteria 1703
116 Ga0111539_10000107 3300009094 Bacteria 89993
117 Ga0105245_10010569 3300009098 Bacteria 8030
118 Ga0114129_10877797 3300009147 Bacteria 1138
119 Ga0105243_10118887 3300009148 Bacteria 2225
120 Ga0105241_10000274 3300009174 Bacteria 38434
121 Ga0105241_10083233 3300009174 Bacteria 2510
122 Ga0105241_10159343 3300009174 Bacteria 1854
123 Ga0105242_10052908 3300009176 Bacteria 3314
124 Ga0105242_10133019 3300009176 Bacteria 2149
125 Ga0105242_10365068 3300009176 Bacteria 1337
126 Ga0105248_10001455 3300009177 Bacteria 26372
127 Ga0105248_10004780 3300009177 Bacteria 14992
128 Ga0105237_10000301 3300009545 Bacteria 68372
129 Ga0105237_10020637 3300009545 Bacteria 6788
130 Ga0105237_10047466 3300009545 Bacteria 4317
131 Ga0105237_10160946 3300009545 Bacteria 2243
132 Ga0105237_10396627 3300009545 Bacteria 1384
133 Ga0105238_10001117 3300009551 Bacteria 27102
134 Ga0105238_10005017 3300009551 Bacteria 13083
135 Ga0105238_10007723 3300009551 Bacteria 10752
136 Ga0105238_10009735 3300009551 Bacteria 9624
137 Ga0105238_10033018 3300009551 Bacteria 5267
138 Ga0105238_10076576 3300009551 Bacteria 3336
139 Ga0105238_10145961 3300009551 Bacteria 2342
140 Ga0105238_10151385 3300009551 Bacteria 2295
141 Ga0105238_10155277 3300009551 Bacteria 2264
142 Ga0105249_10008628 3300009553 Bacteria 8884
143 Ga0105249_10069986 3300009553 Bacteria 3239
144 Ga0105249_10535510 3300009553 Bacteria 1220
145 Ga0105239_10005500 3300010375 Bacteria 14848
146 Ga0105239_10006926 3300010375 Bacteria 13076
147 Ga0105239_10041754 3300010375 Bacteria 5026
148 Ga0105239_10101977 3300010375 Bacteria 3176
149 Ga0105239_10170271 3300010375 Bacteria 2435
150 Ga0105246_10023038 3300011119 Bacteria 4025
151 Ga0105246_10084543 3300011119 Bacteria 2270
152 Ga0157371_10044871 3300013102 Bacteria 3147
153 Ga0157371_10458240 3300013102 Bacteria 938
154 Ga0157370_10031524 3300013104 Bacteria 5183
155 Ga0157370_10035692 3300013104 Bacteria 4830
156 Ga0157369_10005407 3300013105 Bacteria 14866
157 Ga0157369_10027008 3300013105 Bacteria 6365
158 Ga0157369_10512164 3300013105 Bacteria 1241
159 Ga0157374_10080140 3300013296 Bacteria 3096
160 Ga0157374_10116022 3300013296 Bacteria 2580
161 Ga0157374_10308435 3300013296 Bacteria 1566
162 Ga0157374_10506347 3300013296 Bacteria 1212
163 Ga0157378_10019690 3300013297 Bacteria 5933
164 Ga0157378_10539648 3300013297 Bacteria 1170
165 Ga0157378_10766414 3300013297 Bacteria 989
166 Ga0157372_10006082 3300013307 Bacteria 12826
167 Ga0157372_10031558 3300013307 Bacteria 5801
168 Ga0157372_10084740 3300013307 Bacteria 3593
169 Ga0157372_10172917 3300013307 Bacteria 2499
170 Ga0157372_10286675 3300013307 Bacteria 1915
171 Ga0157375_10428754 3300013308 Bacteria 1488
172 Ga0163163_10130677 3300014325 Bacteria 2551
173 Ga0163163_10596803 3300014325 Bacteria 1167
174 Ga0157379_10584450 3300014968 Bacteria 1041
175 Ga0157376_10047689 3300014969 Bacteria 3538
176 Ga0157376_10267249 3300014969 Bacteria 1605
177 Ga0207427_104105 3300025231 Bacteria 2615
178 Ga0209233_1000545 3300025261 Bacteria 21104
179 Ga0209025_1000270 3300025294 Bacteria 120921
180 Ga0209758_1007187 3300025297 Bacteria 7676
181 Ga0207656_10000992 3300025321 Bacteria 9263
182 Ga0207682_10104201 3300025893 Bacteria 1243
183 Ga0207692_10064506 3300025898 Bacteria 1908
184 Ga0207710_10136026 3300025900 Bacteria 1183
185 Ga0207688_10084177 3300025901 Bacteria 1820
186 Ga0207688_10119385 3300025901 Bacteria 1537
187 Ga0207680_10248087 3300025903 Bacteria 1229
188 Ga0207680_10307182 3300025903 Bacteria 1106
189 Ga0207685_10118558 3300025905 Bacteria 1158
190 Ga0207699_10065040 3300025906 Bacteria 2209
191 Ga0207645_10053308 3300025907 Bacteria 2585
192 Ga0207654_10002301 3300025911 Bacteria 9797
193 Ga0207654_10036112 3300025911 Bacteria 2759
194 Ga0207654_10081386 3300025911 Bacteria 1950
195 Ga0207707_10002920 3300025912 Bacteria 15246
196 Ga0207695_10000471 3300025913 Bacteria 87529
197 Ga0207695_10269210 3300025913 Bacteria 1599
198 Ga0207671_10000227 3300025914 Bacteria 84794
199 Ga0207671_10080810 3300025914 Bacteria 2437
200 Ga0207693_10015201 3300025915 Bacteria 6178
201 Ga0207693_10015354 3300025915 Bacteria 6146
202 Ga0207693_10169593 3300025915 Bacteria 1719
203 Ga0207663_10010491 3300025916 Bacteria 4934
204 Ga0207663_10133027 3300025916 Bacteria 1721
205 Ga0207660_10023546 3300025917 Bacteria 4161
206 Ga0207660_10145951 3300025917 Bacteria 1813
207 Ga0207660_10248493 3300025917 Bacteria 1403
208 Ga0207657_10006492 3300025919 Bacteria 12120
209 Ga0207657_10064441 3300025919 Bacteria 3128
210 Ga0207657_10128967 3300025919 Bacteria 2075
211 Ga0207657_10254593 3300025919 Bacteria 1399
212 Ga0207649_10021851 3300025920 Bacteria 3691
213 Ga0207649_10039194 3300025920 Bacteria 2871
214 Ga0207652_10060734 3300025921 Bacteria 3262
215 Ga0207694_10006998 3300025924 Bacteria 8562
216 Ga0207694_10008356 3300025924 Bacteria 7825
217 Ga0207694_10040273 3300025924 Bacteria 3596
218 Ga0207694_10100774 3300025924 Bacteria 2288
219 Ga0207694_10309049 3300025924 Bacteria 1303
220 Ga0207694_10465605 3300025924 Bacteria 1056
221 Ga0207650_10055394 3300025925 Bacteria 2944
222 Ga0207687_10001994 3300025927 Bacteria 14026
223 Ga0207700_10001997 3300025928 Bacteria 11635
224 Ga0207664_10000614 3300025929 Bacteria 24711
225 Ga0207644_10014051 3300025931 Bacteria 5353
226 Ga0207644_10539015 3300025931 Bacteria 965
227 Ga0207690_10077341 3300025932 Bacteria 2313
228 Ga0207690_10205206 3300025932 Bacteria 1499
229 Ga0207706_10025304 3300025933 Bacteria 5319
230 Ga0207686_10034010 3300025934 Bacteria 3047
231 Ga0207686_10068510 3300025934 Bacteria 2273
232 Ga0207670_10132185 3300025936 Bacteria 1830
233 Ga0207711_10001248 3300025941 Bacteria 24136
234 Ga0207711_10115785 3300025941 Archaea 2389
235 Ga0207689_10343170 3300025942 Bacteria 1241
236 Ga0207661_10034172 3300025944 Bacteria 3952
237 Ga0207661_10200649 3300025944 Bacteria 1753
238 Ga0207679_10082669 3300025945 Bacteria 2459
239 Ga0207667_10000399 3300025949 Bacteria 58694
240 Ga0207667_10016250 3300025949 Bacteria 8409
241 Ga0207667_10019609 3300025949 Bacteria 7544
242 Ga0207667_10156484 3300025949 Bacteria 2345
243 Ga0207667_10186604 3300025949 Bacteria 2128
244 Ga0207667_10373857 3300025949 Bacteria 1452
245 Ga0207651_10029982 3300025960 Bacteria 3457
246 Ga0207712_10421072 3300025961 Bacteria 1127
247 Ga0207668_10036506 3300025972 Bacteria 3280
248 Ga0207668_10188418 3300025972 Bacteria 1633
249 Ga0207640_10102702 3300025981 Bacteria 2008
250 Ga0207640_10108210 3300025981 Bacteria 1964
251 Ga0207658_10042667 3300025986 Bacteria 3292
252 Ga0207658_10240373 3300025986 Bacteria 1534
253 Ga0207703_10003526 3300026035 Bacteria 13092
254 Ga0207703_10446838 3300026035 Bacteria 1207
255 Ga0207639_10000588 3300026041 Bacteria 25039
256 Ga0207639_10072933 3300026041 Bacteria 2690
257 Ga0207639_10082434 3300026041 Bacteria 2550
258 Ga0207639_10122903 3300026041 Bacteria 2136
259 Ga0207678_10008694 3300026067 Bacteria 8941
260 Ga0207678_10183352 3300026067 Bacteria 1788
261 Ga0207702_10011423 3300026078 Bacteria 7402
262 Ga0207702_10036743 3300026078 Bacteria 4098
263 Ga0207702_10073352 3300026078 Bacteria 2951
264 Ga0207702_10220547 3300026078 Bacteria 1767
265 Ga0207641_10134932 3300026088 Bacteria 2221
266 Ga0207674_10000042 3300026116 Bacteria 126790
267 Ga0207674_10002211 3300026116 Bacteria 24643
268 Ga0207674_10033773 3300026116 Bacteria 5354
269 Ga0207674_10238401 3300026116 Bacteria 1766
270 Ga0207683_10094607 3300026121 Bacteria 2663
271 Ga0207698_10007576 3300026142 Bacteria 6805
272 Ga0207698_10015926 3300026142 Bacteria 5055
273 Ga0209971_1021880 3300027682 Bacteria 1522
274 Ga0209966_1001356 3300027695 Bacteria 4289
275 Ga0207428_10000040 3300027907 Bacteria 210887
276 Ga0268266_10001992 3300028379 Bacteria 22881
277 Ga0268266_10362142 3300028379 Bacteria 1365
278 Ga0268264_10025649 3300028381 Bacteria 4814
279 Ga0265318_10012180 3300028577 Bacteria 3670
280 Ga0265318_10029052 3300028577 Bacteria 2157
281 Ga0265338_10026029 3300028800 Bacteria 5915
282 Ga0265330_10015665 3300031235 Bacteria 3506
283 Ga0265325_10011187 3300031241 Bacteria 5164
284 Ga0265325_10026567 3300031241 Bacteria 3134
285 Ga0265340_10069410 3300031247 Bacteria 1672
286 Ga0265339_10000247 3300031249 Bacteria 43605
287 Ga0265316_10012667 3300031344 Bacteria 7549
288 Ga0307408_100450186 3300031548 Bacteria 1117
289 Ga0265313_10000062 3300031595 Bacteria 106169
290 Ga0265313_10000137 3300031595 Bacteria 75555
291 Ga0265313_10006147 3300031595 Bacteria 8620
292 Ga0265313_10007775 3300031595 Bacteria 7247
293 Ga0307508_10274649 3300031616 Bacteria 1279
294 Ga0265314_10018720 3300031711 Bacteria 5388
295 Ga0316577_10003985 3300031733 Bacteria 7552
296 Ga0307406_10092359 3300031901 Bacteria 2041
297 Ga0307407_10022746 3300031903 Bacteria 3259
298 Ga0307416_100073875 3300032002 Bacteria 2845
299 Ga0307416_100576668 3300032002 Bacteria 1202
300 Ga0316580_10037515 3300032139 Bacteria 1499
301 Ga0373934_0002444 3300035086 Bacteria 6831
302 Ga0373934_0029549 3300035086 Bacteria 2141
303 Ga0373923_0007039 3300035111 Bacteria 3931
304 Ga0373953_0017234 3300035117 Bacteria 2652
305 Ga0373953_0097421 3300035117 Bacteria 1235
306 Ga0373954_0000516 3300035118 Bacteria 14475
307 Ga0373954_0018927 3300035118 Bacteria 3103
308 Ga0373954_0118075 3300035118 Bacteria 1286
309 Ga0373957_0014519 3300035120 Bacteria 2694
310 Ga0373946_0005368 3300035171 Bacteria 4618
311 Ga0373955_0012553 3300035172 Bacteria 4072
312 Ga0373955_0147440 3300035172 Bacteria 1383
313 Ga0373955_0206552 3300035172 Bacteria 1170
314 Ga0373924_0036975 3300035410 Bacteria 1986
315 Ga0373931_0025178 3300035691 Bacteria 3022
316 Ga0373935_0113896 3300035692 Bacteria 1798
317 Ga0373935_0379981 3300035692 Bacteria 1011
318 Ga0373933_0006840 3300035724 Bacteria 6208
319 Ga0373933_0007183 3300035724 Bacteria 6069
320 Ga0373947_0035765 3300035725 Bacteria 2942
321 Ga0373937_0004063 3300036401 Bacteria 12402
322 Ga0373937_0006000 3300036401 Bacteria 10455
323 Ga0373937_0013155 3300036401 Bacteria 7287
324 Ga0373937_0043445 3300036401 Bacteria 4103
325 Ga0316582_0003350 3300036647 Bacteria 7838
326 Ga0316584_0001417 3300036712 Bacteria 14335
327 Ga0395900_0038991 3300037418 Bacteria 4897
328 Ga0395898_0699904 3300037466 Bacteria 955
329 Ga0395905_0044491 3300037471 Bacteria 4167
330 Ga0395905_0459224 3300037471 Bacteria 1172
331 Ga0395901_0159534 3300038443 Bacteria 2368
332 Ga0395901_0172065 3300038443 Bacteria 2272
333 Ga0395901_0451754 3300038443 Bacteria 1314
334 Ga0439445_0005912 3300042004 Bacteria 2802
335 Ga0439464_0027513 3300042439 Bacteria 1581
336 Ga0466969_0038148 3300044656 Bacteria 2419
337 Ga0466972_0007115 3300044658 Bacteria 5619
338 Ga0466966_0125634 3300044684 Bacteria 1573
339 Ga0466966_0231948 3300044684 Bacteria 1113
340 Ga0466963_0214131 3300044694 Bacteria 1348
341 Ga0466963_0431442 3300044694 Bacteria 929
342 Ga0466968_0054522 3300044735 Bacteria 1714
343 Ga0466970_0126676 3300044765 Bacteria 1401
344 Ga0466957_0029478 3300044842 Bacteria 3272
345 Ga0466960_0005900 3300044901 Bacteria 4883
346 Ga0466960_0227311 3300044901 Bacteria 1029
347 Ga0466958_0191852 3300045836 Bacteria 1299
348 Ga0466967_0007871 3300045976 Bacteria 7744
349 Ga0495592_0001467 3300046454 Bacteria 16409
350 Ga0495592_0027382 3300046454 Bacteria 4322
351 Ga0495638_0137757 3300046460 Bacteria 1427
352 Ga0495651_0005926 3300046462 Bacteria 9326
353 Ga0495651_0034339 3300046462 Bacteria 3953
354 Ga0495653_0060278 3300046463 Bacteria 2876
355 Ga0495580_0119296 3300046472 Unclassified 1832
356 Ga0495639_0006734 3300046475 Bacteria 4942
357 Ga0495664_0172520 3300046477 Bacteria 1312
358 Ga0495584_0062166 3300046491 Bacteria 1877
359 Ga0495594_0270326 3300046499 Bacteria 968
360 Ga0495608_0010996 3300046511 Bacteria 6308
361 Ga0495608_0033982 3300046511 Bacteria 3444
362 Ga0495628_0001714 3300046516 Bacteria 19985
363 Ga0495632_0123917 3300046519 Bacteria 1206
364 Ga0495652_0062838 3300046529 Bacteria 3129
365 Ga0495665_0053409 3300046531 Bacteria 2137
366 Ga0495587_0000561 3300046536 Bacteria 25626
367 Ga0495587_0016959 3300046536 Bacteria 4529
368 Ga0495587_0020579 3300046536 Bacteria 4071
369 Ga0495645_0000223 3300046543 Bacteria 40729
370 Ga0495635_0047278 3300046663 Bacteria 2968
371 Ga0495657_0021350 3300046675 Bacteria 4646
372 Ga0495599_0001359 3300046678 Bacteria 13977
373 Ga0495599_0016748 3300046678 Bacteria 4552
374 Ga0495623_0032010 3300046679 Bacteria 3381
375 Ga0495623_0218516 3300046679 Bacteria 1087
376 Ga0495646_0044814 3300046680 Bacteria 2704
377 Ga0495658_0139907 3300046683 Bacteria 1480
378 Ga0495613_0094991 3300046689 Bacteria 2157
379 Ga0495604_0001128 3300047317 Bacteria 22177
380 Ga0495680_0006632 3300047322 Bacteria 10716
381 Ga0495680_0061489 3300047322 Bacteria 2889
382 Ga0495675_0054421 3300047444 Bacteria 2539
383 Ga0495675_0125804 3300047444 Bacteria 1595
384 Ga0495684_0003073 3300047471 Bacteria 13120
385 Ga0495602_0003250 3300048088 Bacteria 16775
386 Ga0495602_0030168 3300048088 Bacteria 5149
387 Ga0496104_0000537 3300048907 Bacteria 32588
388 Ga0496104_0067273 3300048907 Bacteria 3403
389 Ga0496104_0101005 3300048907 Bacteria 2762
390 Ga0496105_0004684 3300048908 Bacteria 10311
391 Ga0496112_0131970 3300048915 Bacteria 2469
392 Ga0496119_0000198 3300048922 Bacteria 84746
393 Ga0496121_0119133 3300048924 Bacteria 1997
394 Ga0501031_0023094 3300049568 Bacteria 4056
395 Ga0501031_0114978 3300049568 Bacteria 1758
396 Ga0501032_0078902 3300049569 Bacteria 2192
397 Ga0501032_0082801 3300049569 Bacteria 2134
398 Ga0501032_0205755 3300049569 Bacteria 1284
399 Ga0501032_0209463 3300049569 Bacteria 1271
400 Ga0501033_0023597 3300049570 Bacteria 4639
401 Ga0501033_0077168 3300049570 Bacteria 2445
402 Ga0501034_0050979 3300049571 Bacteria 4174
403 Ga0501034_0143114 3300049571 Bacteria 2370
404 Ga0501034_0347774 3300049571 Bacteria 1411
405 Ga0501036_0029209 3300049572 Bacteria 4661
406 Ga0501037_0022301 3300049573 Bacteria 4684
407 Ga0501038_0071272 3300049574 Bacteria 2948
408 Ga0501039_0057166 3300049575 Bacteria 3021
409 Ga0501039_0196777 3300049575 Bacteria 1585
410 Ga0501046_0106575 3300049580 Bacteria 2145
411 Ga0501047_0004012 3300049581 Bacteria 13837
412 Ga0501047_0034657 3300049581 Bacteria 4874
413 Ga0501047_0054565 3300049581 Bacteria 3865
414 Ga0501047_0428713 3300049581 Bacteria 1153
415 Ga0501067_0002501 3300049583 Bacteria 10154
416 Ga0501067_0053439 3300049583 Bacteria 2238
417 Ga0501068_0206311 3300049584 Bacteria 1247
418 Ga0501069_0013536 3300049585 Bacteria 4350
419 Ga0501069_0046124 3300049585 Bacteria 2416
420 Ga0501070_0011213 3300049586 Bacteria 7567
421 Ga0501070_0012528 3300049586 Bacteria 7152
422 Ga0501070_0028668 3300049586 Bacteria 4668
423 Ga0501070_0357738 3300049586 Bacteria 1184
424 Ga0501070_0423274 3300049586 Bacteria 1075
425 Ga0501071_0088128 3300049587 Bacteria 2277
426 Ga0501073_0031711 3300049589 Bacteria 3770
427 Ga0501073_0040731 3300049589 Bacteria 3286
428 Ga0501073_0151797 3300049589 Bacteria 1606
429 Ga0501076_0222607 3300049592 Bacteria 1542
430 Ga0501238_002884 3300049671 Bacteria 2089
431 Ga0501252_009647 3300049682 Bacteria 1129
432 Ga0501079_0071931 3300049741 Bacteria 2672
433 Ga0501080_0039777 3300049742 Bacteria 4388
434 Ga0501080_0055640 3300049742 Bacteria 3685
435 Ga0501080_0058452 3300049742 Bacteria 3589
436 Ga0501080_0154616 3300049742 Bacteria 2119
437 Ga0501080_0516724 3300049742 Bacteria 1066
438 Ga0501083_0004629 3300049744 Bacteria 9714
439 Ga0501083_0017118 3300049744 Bacteria 5056
440 Ga0501083_0028855 3300049744 Bacteria 3822
441 Ga0501083_0084963 3300049744 Bacteria 2094
442 Ga0501083_0134454 3300049744 Unclassified 1620
443 Ga0501035_0000453 3300049822 Bacteria 45820
444 Ga0501035_0010167 3300049822 Bacteria 8733
445 Ga0501035_0227064 3300049822 Bacteria 1592
446 Ga0501044_0122142 3300049823 Bacteria 2604
447 Ga0501044_0431031 3300049823 Bacteria 1228
448 nmdc:mga0yw44_214006_c1 3300050492 Bacteria 1275
449 nmdc:mga05p37_688465_c1 3300050507 Bacteria 1138
450 nmdc:mga0qj67_160_c1 3300050509 Bacteria 45393
451 nmdc:mga08y16_233_c1 3300050511 Bacteria 49640
452 nmdc:mga08x19_448361_c1 3300050514 Bacteria 908
453 Ga0495601_0105984 3300053077 Bacteria 1818
454 Ga0495601_0208769 3300053077 Bacteria 1276
455 Ga0495612_0010559 3300053078 Bacteria 3733
456 Ga0495595_0001916 3300053084 Bacteria 8078
457 Ga0495619_0000520 3300053085 Bacteria 25508
458 Ga0495619_0173115 3300053085 Bacteria 1493
459 Ga0500642_0004224 3300053130 Bacteria 4463
460 Ga0500568_0006702 3300053139 Bacteria 5756
461 Ga0500604_0000738 3300053151 Bacteria 8963
462 Ga0500616_0009695 3300053153 Bacteria 5825
463 Ga0500616_0045053 3300053153 Bacteria 2352
464 Ga0500634_0000001 3300053161 Bacteria 258285
465 Ga0500634_0011993 3300053161 Bacteria 4497
466 Ga0501084_0096525 3300054114 Bacteria 2482
467 Ga0501084_0162271 3300054114 Bacteria 1885
468 Ga0501082_0029327 3300060353 Bacteria 4739
469 Ga0501082_0277431 3300060353 Bacteria 1459
470 Ga0501082_0281390 3300060353 Unclassified 1448
471 Ga0466962_0039430 3300061719 Bacteria 2262
472 Ga0466962_0218784 3300061719 Bacteria 933

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035086 Ga0373934_0029549 Ga0373934_0029549_290_1033 244
2 3300005329 Ga0070683_100042834 Ga0070683_1000428343 260
3 3300009174 Ga0105241_10000274 Ga0105241_100002742 260
4 3300013296 Ga0157374_10116022 Ga0157374_101160222 260
5 3300046531 Ga0495665_0053409 Ga0495665_0053409_493_1299 260
6 3300046679 Ga0495623_0218516 Ga0495623_0218516_158_949 260
7 3300046536 Ga0495587_0016959 Ga0495587_0016959_1770_2561 261
8 3300046678 Ga0495599_0016748 Ga0495599_0016748_13_804 261
9 3300005329 Ga0070683_100000407 Ga0070683_10000040720 262
10 3300005336 Ga0070680_100003368 Ga0070680_1000033683 262
11 3300005341 Ga0070691_10000505 Ga0070691_100005056 262
12 3300005444 Ga0070694_100138321 Ga0070694_1001383212 262
13 3300005458 Ga0070681_10000278 Ga0070681_1000027835 262
14 3300005530 Ga0070679_100010630 Ga0070679_1000106308 262
15 3300005535 Ga0070684_100000856 Ga0070684_1000008564 262
16 3300005539 Ga0068853_100074442 Ga0068853_1000744422 262
17 3300005563 Ga0068855_100010388 Ga0068855_1000103883 262
18 3300005577 Ga0068857_100000139 Ga0068857_10000013918 262
19 3300005614 Ga0068856_100003335 Ga0068856_10000333512 262
20 3300005616 Ga0068852_100009656 Ga0068852_1000096563 262
21 3300006914 Ga0075436_100399267 Ga0075436_1003992671 262
22 3300009093 Ga0105240_10006325 Ga0105240_1000632513 262
23 3300009545 Ga0105237_10020637 Ga0105237_100206375 262
24 3300009551 Ga0105238_10001117 Ga0105238_100011179 262
25 3300010375 Ga0105239_10005500 Ga0105239_1000550011 262
26 3300013105 Ga0157369_10005407 Ga0157369_100054073 262
27 3300013307 Ga0157372_10006082 Ga0157372_100060822 262
28 3300025911 Ga0207654_10002301 Ga0207654_100023018 262
29 3300025912 Ga0207707_10002920 Ga0207707_1000292011 262
30 3300025913 Ga0207695_10000471 Ga0207695_1000047115 262
31 3300025917 Ga0207660_10023546 Ga0207660_100235463 262
32 3300025921 Ga0207652_10060734 Ga0207652_100607342 262
33 3300025924 Ga0207694_10006998 Ga0207694_100069989 262
34 3300025942 Ga0207689_10343170 Ga0207689_103431701 262
35 3300025944 Ga0207661_10034172 Ga0207661_100341724 262
36 3300025949 Ga0207667_10000399 Ga0207667_1000039911 262
37 3300026041 Ga0207639_10082434 Ga0207639_100824342 262
38 3300026078 Ga0207702_10011423 Ga0207702_100114234 262
39 3300026116 Ga0207674_10000042 Ga0207674_1000004272 262
40 3300026142 Ga0207698_10007576 Ga0207698_100075765 262
41 3300050514 nmdc:mga08x19_448361_c1 nmdc:mga08x19_448361_c1_46_843 262
42 3300005842 Ga0068858_100076638 Ga0068858_1000766382 268
43 3300013296 Ga0157374_10506347 Ga0157374_105063472 268
44 3300013297 Ga0157378_10766414 Ga0157378_107664141 268
45 3300025934 Ga0207686_10034010 Ga0207686_100340102 268
46 3300025961 Ga0207712_10421072 Ga0207712_104210722 268
47 3300049592 Ga0501076_0222607 Ga0501076_0222607_110_919 268
48 3300005434 Ga0070709_10028528 Ga0070709_100285282 269
49 3300005435 Ga0070714_100000313 Ga0070714_10000031327 269
50 3300005436 Ga0070713_100001282 Ga0070713_10000128211 269
51 3300005439 Ga0070711_100011700 Ga0070711_1000117007 269
52 3300006028 Ga0070717_10050758 Ga0070717_100507582 269
53 3300006358 Ga0068871_100029295 Ga0068871_1000292952 269
54 3300025906 Ga0207699_10065040 Ga0207699_100650403 269
55 3300025916 Ga0207663_10010491 Ga0207663_100104912 269
56 3300025928 Ga0207700_10001997 Ga0207700_1000199710 269
57 3300025929 Ga0207664_10000614 Ga0207664_100006147 269
58 3300035172 Ga0373955_0206552 Ga0373955_0206552_141_959 269
59 3300035692 Ga0373935_0113896 Ga0373935_0113896_834_1652 269
60 3300035692 Ga0373935_0379981 Ga0373935_0379981_176_994 269
61 3300035725 Ga0373947_0035765 Ga0373947_0035765_1489_2307 269
62 3300036401 Ga0373937_0004063 Ga0373937_0004063_8174_8992 269
63 3300005327 Ga0070658_10047509 Ga0070658_100475093 271
64 3300005344 Ga0070661_100011131 Ga0070661_1000111312 271
65 3300005347 Ga0070668_100042325 Ga0070668_1000423254 271
66 3300005366 Ga0070659_100087481 Ga0070659_1000874812 271
67 3300005458 Ga0070681_10529561 Ga0070681_105295612 271
68 3300005539 Ga0068853_100010891 Ga0068853_1000108916 271
69 3300005548 Ga0070665_100386483 Ga0070665_1003864832 271
70 3300009551 Ga0105238_10155277 Ga0105238_101552772 271
71 3300010375 Ga0105239_10170271 Ga0105239_101702712 271
72 3300013102 Ga0157371_10458240 Ga0157371_104582401 271
73 3300013104 Ga0157370_10031524 Ga0157370_100315243 271
74 3300013105 Ga0157369_10027008 Ga0157369_100270085 271
75 3300014325 Ga0163163_10596803 Ga0163163_105968031 271
76 3300025893 Ga0207682_10104201 Ga0207682_101042012 271
77 3300025901 Ga0207688_10084177 Ga0207688_100841772 271
78 3300025932 Ga0207690_10077341 Ga0207690_100773413 271
79 3300025949 Ga0207667_10019609 Ga0207667_100196092 271
80 3300025972 Ga0207668_10036506 Ga0207668_100365063 271
81 3300026041 Ga0207639_10122903 Ga0207639_101229033 271
82 3300026067 Ga0207678_10008694 Ga0207678_100086946 271
83 3300026078 Ga0207702_10073352 Ga0207702_100733523 271
84 3300037466 Ga0395898_0699904 Ga0395898_0699904_78_893 271
85 3300037471 Ga0395905_0459224 Ga0395905_0459224_246_1061 271
86 3300038443 Ga0395901_0451754 Ga0395901_0451754_214_1029 271
87 iso_pu_bacteria 8057160832 8057163460 271
88 3300025919 Ga0207657_10254593 Ga0207657_102545932 272
89 3300049742 Ga0501080_0516724 Ga0501080_0516724_20_838 272
90 3300005331 Ga0070670_100069527 Ga0070670_1000695272 275
91 3300005355 Ga0070671_100250530 Ga0070671_1002505302 275
92 3300005455 Ga0070663_100087760 Ga0070663_1000877602 275
93 3300006038 Ga0075365_10059452 Ga0075365_100594522 275
94 3300025925 Ga0207650_10055394 Ga0207650_100553944 275
95 3300025931 Ga0207644_10014051 Ga0207644_100140514 275
96 3300025945 Ga0207679_10082669 Ga0207679_100826692 275
97 3300026067 Ga0207678_10183352 Ga0207678_101833522 275
98 3300026121 Ga0207683_10094607 Ga0207683_100946073 275
99 3300050492 nmdc:mga0yw44_214006_c1 nmdc:mga0yw44_214006_c1_199_1026 275
100 iso_pu_bacteria 2643221551 2643776190 277
101 iso_pu_bacteria 2643221555 2643794637 277
102 iso_pu_bacteria 2773857925 2774872917 277
103 iso_pu_bacteria 2775506901 2776260537 277
104 iso_pu_bacteria 2835312727 2835319034 277
105 iso_pu_bacteria 2882456835 2882457927 277
106 iso_pu_bacteria 2884298095 2884300656 277
107 iso_pu_bacteria 2888343758 2888345842 277
108 iso_pu_bacteria 2894232714 2894233292 277
109 3300006038 Ga0075365_10193041 Ga0075365_101930412 279
110 3300049744 Ga0501083_0134454 Ga0501083_0134454_261_1148 279
111 3300060353 Ga0501082_0281390 Ga0501082_0281390_166_1053 279
112 iso_pu_bacteria 2508501114 2509075609 279
113 3300009093 Ga0105240_10284146 Ga0105240_102841461 280
114 3300009545 Ga0105237_10396627 Ga0105237_103966272 280
115 3300009551 Ga0105238_10145961 Ga0105238_101459612 280
116 3300028379 Ga0268266_10362142 Ga0268266_103621421 280
117 3300044656 Ga0466969_0038148 Ga0466969_0038148_510_1355 280
118 3300044658 Ga0466972_0007115 Ga0466972_0007115_2281_3126 280
119 3300044684 Ga0466966_0125634 Ga0466966_0125634_79_924 280
120 3300044735 Ga0466968_0054522 Ga0466968_0054522_555_1400 280
121 3300044765 Ga0466970_0126676 Ga0466970_0126676_213_1058 280
122 3300044901 Ga0466960_0005900 Ga0466960_0005900_2956_3801 280
123 3300061719 Ga0466962_0218784 Ga0466962_0218784_50_895 280
124 3300005339 Ga0070660_100205295 Ga0070660_1002052952 281
125 3300005347 Ga0070668_100209142 Ga0070668_1002091422 281
126 3300005548 Ga0070665_100043091 Ga0070665_1000430914 281
127 3300006358 Ga0068871_100478291 Ga0068871_1004782911 281
128 3300009545 Ga0105237_10000301 Ga0105237_1000030124 281
129 3300009545 Ga0105237_10160946 Ga0105237_101609461 281
130 3300010375 Ga0105239_10006926 Ga0105239_100069264 281
131 3300013308 Ga0157375_10428754 Ga0157375_104287542 281
132 3300014968 Ga0157379_10584450 Ga0157379_105844502 281
133 3300014969 Ga0157376_10267249 Ga0157376_102672492 281
134 3300025914 Ga0207671_10000227 Ga0207671_1000022730 281
135 3300028379 Ga0268266_10001992 Ga0268266_1000199212 281
136 3300031616 Ga0307508_10274649 Ga0307508_102746492 281
137 3300031733 Ga0316577_10003985 Ga0316577_100039853 281
138 3300031901 Ga0307406_10092359 Ga0307406_100923593 281
139 3300031903 Ga0307407_10022746 Ga0307407_100227463 281
140 3300032002 Ga0307416_100073875 Ga0307416_1000738751 281
141 3300032139 Ga0316580_10037515 Ga0316580_100375152 281
142 3300036647 Ga0316582_0003350 Ga0316582_0003350_6337_7209 281
143 3300036712 Ga0316584_0001417 Ga0316584_0001417_7517_8389 281
144 3300037471 Ga0395905_0044491 Ga0395905_0044491_294_1139 281
145 3300044901 Ga0466960_0227311 Ga0466960_0227311_99_944 281
146 3300045836 Ga0466958_0191852 Ga0466958_0191852_49_894 281
147 3300047322 Ga0495680_0061489 Ga0495680_0061489_1948_2865 281
148 3300048907 Ga0496104_0067273 Ga0496104_0067273_822_1670 281
149 3300049568 Ga0501031_0114978 Ga0501031_0114978_95_940 281
150 3300049671 Ga0501238_002884 Ga0501238_002884_824_1669 281
151 3300049682 Ga0501252_009647 Ga0501252_009647_71_916 281
152 3300053139 Ga0500568_0006702 Ga0500568_0006702_4323_5168 281
153 3300053151 Ga0500604_0000738 Ga0500604_0000738_5880_6725 281
154 3300053153 Ga0500616_0009695 Ga0500616_0009695_4110_4958 281
155 3300053153 Ga0500616_0045053 Ga0500616_0045053_1419_2267 281
156 3300053161 Ga0500634_0000001 Ga0500634_0000001_80051_80896 281
157 3300053161 Ga0500634_0011993 Ga0500634_0011993_1657_2502 281
158 iso_pu_bacteria 3004334049 3004336794 281
159 iso_pu_bacteria 8045864390 8045866613 281
160 3300003323 rootH1_10098140 rootH1_100981405 282
161 3300005329 Ga0070683_100014241 Ga0070683_1000142416 282
162 3300005330 Ga0070690_100092798 Ga0070690_1000927982 282
163 3300005337 Ga0070682_100092142 Ga0070682_1000921422 282
164 3300005338 Ga0068868_100080907 Ga0068868_1000809072 282
165 3300005340 Ga0070689_100049793 Ga0070689_1000497932 282
166 3300005344 Ga0070661_100000540 Ga0070661_10000054025 282
167 3300005344 Ga0070661_100035485 Ga0070661_1000354853 282
168 3300005355 Ga0070671_100299929 Ga0070671_1002999292 282
169 3300005364 Ga0070673_100055058 Ga0070673_1000550583 282
170 3300005366 Ga0070659_100002010 Ga0070659_1000020107 282
171 3300005366 Ga0070659_100053804 Ga0070659_1000538042 282
172 3300005435 Ga0070714_100040448 Ga0070714_1000404482 282
173 3300005436 Ga0070713_100085185 Ga0070713_1000851854 282
174 3300005456 Ga0070678_100128626 Ga0070678_1001286262 282
175 3300005535 Ga0070684_100010398 Ga0070684_1000103986 282
176 3300005535 Ga0070684_100590462 Ga0070684_1005904621 282
177 3300005539 Ga0068853_100004900 Ga0068853_1000049009 282
178 3300005539 Ga0068853_100014976 Ga0068853_1000149763 282
179 3300005539 Ga0068853_100161375 Ga0068853_1001613752 282
180 3300005547 Ga0070693_100027846 Ga0070693_1000278462 282
181 3300005563 Ga0068855_100045877 Ga0068855_1000458773 282
182 3300005563 Ga0068855_100100706 Ga0068855_1001007063 282
183 3300005563 Ga0068855_100179572 Ga0068855_1001795722 282
184 3300005563 Ga0068855_100279673 Ga0068855_1002796732 282
185 3300005564 Ga0070664_100342213 Ga0070664_1003422132 282
186 3300005564 Ga0070664_100503128 Ga0070664_1005031281 282
187 3300005577 Ga0068857_100055671 Ga0068857_1000556712 282
188 3300005577 Ga0068857_100063978 Ga0068857_1000639783 282
189 3300005577 Ga0068857_100073911 Ga0068857_1000739113 282
190 3300005577 Ga0068857_100180156 Ga0068857_1001801562 282
191 3300005578 Ga0068854_100005496 Ga0068854_1000054965 282
192 3300005578 Ga0068854_100016209 Ga0068854_1000162093 282
193 3300005578 Ga0068854_100050160 Ga0068854_1000501602 282
194 3300005614 Ga0068856_100095086 Ga0068856_1000950863 282
195 3300005614 Ga0068856_100245009 Ga0068856_1002450092 282
196 3300005614 Ga0068856_100329504 Ga0068856_1003295041 282
197 3300005616 Ga0068852_100000952 Ga0068852_10000095216 282
198 3300005616 Ga0068852_100010635 Ga0068852_1000106354 282
199 3300005616 Ga0068852_100227152 Ga0068852_1002271522 282
200 3300005718 Ga0068866_10238815 Ga0068866_102388151 282
201 3300005834 Ga0068851_10000929 Ga0068851_100009296 282
202 3300005834 Ga0068851_10031083 Ga0068851_100310832 282
203 3300005842 Ga0068858_100029046 Ga0068858_1000290463 282
204 3300006163 Ga0070715_10061247 Ga0070715_100612472 282
205 3300006358 Ga0068871_100006980 Ga0068871_1000069803 282
206 3300006358 Ga0068871_100066256 Ga0068871_1000662563 282
207 3300006358 Ga0068871_100106405 Ga0068871_1001064051 282
208 3300006931 Ga0097620_100004436 Ga0097620_10000443610 282
209 3300009093 Ga0105240_10034029 Ga0105240_100340294 282
210 3300009093 Ga0105240_10267517 Ga0105240_102675172 282
211 3300009093 Ga0105240_10340903 Ga0105240_103409032 282
212 3300009098 Ga0105245_10010569 Ga0105245_100105693 282
213 3300009147 Ga0114129_10877797 Ga0114129_108777972 282
214 3300009148 Ga0105243_10118887 Ga0105243_101188872 282
215 3300009174 Ga0105241_10083233 Ga0105241_100832332 282
216 3300009176 Ga0105242_10052908 Ga0105242_100529083 282
217 3300009176 Ga0105242_10133019 Ga0105242_101330192 282
218 3300009176 Ga0105242_10365068 Ga0105242_103650682 282
219 3300009177 Ga0105248_10001455 Ga0105248_1000145510 282
220 3300009177 Ga0105248_10004780 Ga0105248_100047803 282
221 3300009545 Ga0105237_10047466 Ga0105237_100474664 282
222 3300009551 Ga0105238_10005017 Ga0105238_1000501710 282
223 3300009551 Ga0105238_10007723 Ga0105238_1000772310 282
224 3300009551 Ga0105238_10009735 Ga0105238_100097359 282
225 3300009551 Ga0105238_10033018 Ga0105238_100330184 282
226 3300009551 Ga0105238_10151385 Ga0105238_101513852 282
227 3300009553 Ga0105249_10008628 Ga0105249_100086285 282
228 3300009553 Ga0105249_10069986 Ga0105249_100699862 282
229 3300010375 Ga0105239_10041754 Ga0105239_100417544 282
230 3300010375 Ga0105239_10101977 Ga0105239_101019772 282
231 3300011119 Ga0105246_10023038 Ga0105246_100230381 282
232 3300011119 Ga0105246_10084543 Ga0105246_100845433 282
233 3300013102 Ga0157371_10044871 Ga0157371_100448713 282
234 3300013104 Ga0157370_10035692 Ga0157370_100356924 282
235 3300013105 Ga0157369_10512164 Ga0157369_105121642 282
236 3300013296 Ga0157374_10080140 Ga0157374_100801402 282
237 3300013296 Ga0157374_10308435 Ga0157374_103084352 282
238 3300013297 Ga0157378_10019690 Ga0157378_100196904 282
239 3300013307 Ga0157372_10031558 Ga0157372_100315583 282
240 3300013307 Ga0157372_10172917 Ga0157372_101729173 282
241 3300013307 Ga0157372_10286675 Ga0157372_102866752 282
242 3300014325 Ga0163163_10130677 Ga0163163_101306772 282
243 3300014969 Ga0157376_10047689 Ga0157376_100476893 282
244 3300025231 Ga0207427_104105 Ga0207427_1041054 282
245 3300025261 Ga0209233_1000545 Ga0209233_100054513 282
246 3300025321 Ga0207656_10000992 Ga0207656_100009927 282
247 3300025900 Ga0207710_10136026 Ga0207710_101360262 282
248 3300025903 Ga0207680_10248087 Ga0207680_102480872 282
249 3300025905 Ga0207685_10118558 Ga0207685_101185582 282
250 3300025907 Ga0207645_10053308 Ga0207645_100533083 282
251 3300025911 Ga0207654_10036112 Ga0207654_100361122 282
252 3300025911 Ga0207654_10081386 Ga0207654_100813862 282
253 3300025913 Ga0207695_10269210 Ga0207695_102692102 282
254 3300025914 Ga0207671_10080810 Ga0207671_100808102 282
255 3300025919 Ga0207657_10006492 Ga0207657_1000649210 282
256 3300025919 Ga0207657_10064441 Ga0207657_100644413 282
257 3300025919 Ga0207657_10128967 Ga0207657_101289672 282
258 3300025920 Ga0207649_10021851 Ga0207649_100218512 282
259 3300025920 Ga0207649_10039194 Ga0207649_100391942 282
260 3300025924 Ga0207694_10008356 Ga0207694_100083563 282
261 3300025924 Ga0207694_10040273 Ga0207694_100402733 282
262 3300025924 Ga0207694_10100774 Ga0207694_101007743 282
263 3300025924 Ga0207694_10465605 Ga0207694_104656052 282
264 3300025927 Ga0207687_10001994 Ga0207687_100019948 282
265 3300025931 Ga0207644_10539015 Ga0207644_105390152 282
266 3300025932 Ga0207690_10205206 Ga0207690_102052062 282
267 3300025933 Ga0207706_10025304 Ga0207706_100253042 282
268 3300025934 Ga0207686_10068510 Ga0207686_100685102 282
269 3300025936 Ga0207670_10132185 Ga0207670_101321852 282
270 3300025941 Ga0207711_10001248 Ga0207711_1000124819 282
271 3300025941 Ga0207711_10115785 Ga0207711_101157852 282
272 3300025944 Ga0207661_10200649 Ga0207661_102006491 282
273 3300025949 Ga0207667_10016250 Ga0207667_100162503 282
274 3300025949 Ga0207667_10156484 Ga0207667_101564842 282
275 3300025949 Ga0207667_10186604 Ga0207667_101866042 282
276 3300025949 Ga0207667_10373857 Ga0207667_103738572 282
277 3300025960 Ga0207651_10029982 Ga0207651_100299823 282
278 3300025981 Ga0207640_10102702 Ga0207640_101027022 282
279 3300025981 Ga0207640_10108210 Ga0207640_101082103 282
280 3300025986 Ga0207658_10240373 Ga0207658_102403732 282
281 3300026035 Ga0207703_10003526 Ga0207703_100035262 282
282 3300026035 Ga0207703_10446838 Ga0207703_104468381 282
283 3300026041 Ga0207639_10000588 Ga0207639_100005884 282
284 3300026041 Ga0207639_10072933 Ga0207639_100729332 282
285 3300026078 Ga0207702_10036743 Ga0207702_100367433 282
286 3300026078 Ga0207702_10220547 Ga0207702_102205472 282
287 3300026088 Ga0207641_10134932 Ga0207641_101349322 282
288 3300026116 Ga0207674_10002211 Ga0207674_100022117 282
289 3300026116 Ga0207674_10033773 Ga0207674_100337734 282
290 3300026116 Ga0207674_10238401 Ga0207674_102384013 282
291 3300026142 Ga0207698_10015926 Ga0207698_100159262 282
292 3300028577 Ga0265318_10029052 Ga0265318_100290523 282
293 3300028800 Ga0265338_10026029 Ga0265338_100260293 282
294 3300031235 Ga0265330_10015665 Ga0265330_100156652 282
295 3300031241 Ga0265325_10011187 Ga0265325_100111874 282
296 3300031249 Ga0265339_10000247 Ga0265339_1000024712 282
297 3300031548 Ga0307408_100450186 Ga0307408_1004501861 282
298 3300031595 Ga0265313_10000137 Ga0265313_1000013732 282
299 3300031595 Ga0265313_10007775 Ga0265313_100077756 282
300 3300032002 Ga0307416_100576668 Ga0307416_1005766682 282
301 3300035086 Ga0373934_0002444 Ga0373934_0002444_2901_3791 282
302 3300035111 Ga0373923_0007039 Ga0373923_0007039_593_1483 282
303 3300035117 Ga0373953_0097421 Ga0373953_0097421_237_1127 282
304 3300035118 Ga0373954_0000516 Ga0373954_0000516_8039_8929 282
305 3300035118 Ga0373954_0018927 Ga0373954_0018927_1178_2068 282
306 3300035172 Ga0373955_0012553 Ga0373955_0012553_730_1620 282
307 3300035172 Ga0373955_0147440 Ga0373955_0147440_369_1259 282
308 3300035724 Ga0373933_0007183 Ga0373933_0007183_4234_5157 282
309 3300036401 Ga0373937_0006000 Ga0373937_0006000_985_1875 282
310 3300036401 Ga0373937_0013155 Ga0373937_0013155_1287_2177 282
311 3300036401 Ga0373937_0043445 Ga0373937_0043445_405_1328 282
312 3300038443 Ga0395901_0159534 Ga0395901_0159534_1289_2137 282
313 3300042004 Ga0439445_0005912 Ga0439445_0005912_1138_1986 282
314 3300044694 Ga0466963_0214131 Ga0466963_0214131_208_1056 282
315 3300044694 Ga0466963_0431442 Ga0466963_0431442_40_888 282
316 3300045976 Ga0466967_0007871 Ga0466967_0007871_636_1484 282
317 3300046454 Ga0495592_0027382 Ga0495592_0027382_303_1226 282
318 3300046462 Ga0495651_0034339 Ga0495651_0034339_1262_2152 282
319 3300046472 Ga0495580_0119296 Ga0495580_0119296_70_927 282
320 3300046475 Ga0495639_0006734 Ga0495639_0006734_3282_4154 282
321 3300046499 Ga0495594_0270326 Ga0495594_0270326_60_932 282
322 3300046511 Ga0495608_0033982 Ga0495608_0033982_2435_3325 282
323 3300046519 Ga0495632_0123917 Ga0495632_0123917_70_918 282
324 3300046529 Ga0495652_0062838 Ga0495652_0062838_2223_3113 282
325 3300046536 Ga0495587_0000561 Ga0495587_0000561_23704_24627 282
326 3300046689 Ga0495613_0094991 Ga0495613_0094991_1115_1987 282
327 3300047444 Ga0495675_0125804 Ga0495675_0125804_417_1307 282
328 3300047471 Ga0495684_0003073 Ga0495684_0003073_6559_7449 282
329 3300048088 Ga0495602_0003250 Ga0495602_0003250_5130_6053 282
330 3300048907 Ga0496104_0101005 Ga0496104_0101005_936_1823 282
331 3300049568 Ga0501031_0023094 Ga0501031_0023094_91_939 282
332 3300049569 Ga0501032_0082801 Ga0501032_0082801_854_1702 282
333 3300049569 Ga0501032_0205755 Ga0501032_0205755_78_926 282
334 3300049570 Ga0501033_0023597 Ga0501033_0023597_1283_2131 282
335 3300049570 Ga0501033_0077168 Ga0501033_0077168_416_1264 282
336 3300049571 Ga0501034_0143114 Ga0501034_0143114_233_1081 282
337 3300049571 Ga0501034_0347774 Ga0501034_0347774_229_1077 282
338 3300049572 Ga0501036_0029209 Ga0501036_0029209_2610_3458 282
339 3300049573 Ga0501037_0022301 Ga0501037_0022301_1835_2683 282
340 3300049574 Ga0501038_0071272 Ga0501038_0071272_186_1034 282
341 3300049575 Ga0501039_0057166 Ga0501039_0057166_1093_1941 282
342 3300049581 Ga0501047_0054565 Ga0501047_0054565_563_1411 282
343 3300049581 Ga0501047_0428713 Ga0501047_0428713_239_1087 282
344 3300049584 Ga0501068_0206311 Ga0501068_0206311_200_1048 282
345 3300049586 Ga0501070_0028668 Ga0501070_0028668_985_1833 282
346 3300049586 Ga0501070_0357738 Ga0501070_0357738_321_1169 282
347 3300049589 Ga0501073_0040731 Ga0501073_0040731_164_1012 282
348 3300049742 Ga0501080_0154616 Ga0501080_0154616_1030_1878 282
349 3300049822 Ga0501035_0010167 Ga0501035_0010167_2876_3724 282
350 3300049823 Ga0501044_0122142 Ga0501044_0122142_1667_2515 282
351 3300050507 nmdc:mga05p37_688465_c1 nmdc:mga05p37_688465_c1_196_1053 282
352 3300053077 Ga0495601_0105984 Ga0495601_0105984_59_916 282
353 3300053085 Ga0495619_0173115 Ga0495619_0173115_411_1301 282
354 3300053130 Ga0500642_0004224 Ga0500642_0004224_3001_3849 282
355 3300005347 Ga0070668_100488873 Ga0070668_1004888731 283
356 3300005367 Ga0070667_100139672 Ga0070667_1001396723 283
357 3300005435 Ga0070714_100347366 Ga0070714_1003473662 283
358 3300005437 Ga0070710_10043588 Ga0070710_100435883 283
359 3300005843 Ga0068860_100063237 Ga0068860_1000632373 283
360 3300009553 Ga0105249_10535510 Ga0105249_105355101 283
361 3300013297 Ga0157378_10539648 Ga0157378_105396481 283
362 3300025898 Ga0207692_10064506 Ga0207692_100645062 283
363 3300025901 Ga0207688_10119385 Ga0207688_101193851 283
364 3300025903 Ga0207680_10307182 Ga0207680_103071821 283
365 3300025917 Ga0207660_10248493 Ga0207660_102484931 283
366 3300025924 Ga0207694_10309049 Ga0207694_103090492 283
367 3300025972 Ga0207668_10188418 Ga0207668_101884182 283
368 3300025986 Ga0207658_10042667 Ga0207658_100426672 283
369 3300028381 Ga0268264_10025649 Ga0268264_100256495 283
370 3300028577 Ga0265318_10012180 Ga0265318_100121803 283
371 3300031344 Ga0265316_10012667 Ga0265316_100126676 283
372 3300031595 Ga0265313_10006147 Ga0265313_100061472 283
373 3300031711 Ga0265314_10018720 Ga0265314_100187204 283
374 3300038443 Ga0395901_0172065 Ga0395901_0172065_564_1415 283
375 3300046491 Ga0495584_0062166 Ga0495584_0062166_901_1755 283
376 3300048924 Ga0496121_0119133 Ga0496121_0119133_826_1677 283
377 3300049569 Ga0501032_0209463 Ga0501032_0209463_158_1009 283
378 3300049580 Ga0501046_0106575 Ga0501046_0106575_1083_1934 283
379 3300049583 Ga0501067_0002501 Ga0501067_0002501_5570_6421 283
380 3300049586 Ga0501070_0423274 Ga0501070_0423274_35_886 283
381 3300049742 Ga0501080_0055640 Ga0501080_0055640_2104_2955 283
382 3300049744 Ga0501083_0028855 Ga0501083_0028855_2505_3356 283
383 3300049822 Ga0501035_0227064 Ga0501035_0227064_113_964 283
384 3300054114 Ga0501084_0096525 Ga0501084_0096525_1149_2000 283
385 3300054114 Ga0501084_0162271 Ga0501084_0162271_976_1827 283
386 3300060353 Ga0501082_0029327 Ga0501082_0029327_1595_2446 283
387 3300044684 Ga0466966_0231948 Ga0466966_0231948_94_948 284
388 3300044842 Ga0466957_0029478 Ga0466957_0029478_1899_2753 284
389 3300048922 Ga0496119_0000198 Ga0496119_0000198_36938_37792 284
390 3300053077 Ga0495601_0208769 Ga0495601_0208769_207_1061 284
391 3300061719 Ga0466962_0039430 Ga0466962_0039430_474_1328 284
392 3300003187 JGI25151J46595_10000149 JGI25151J46595_1000014917 285
393 3300005336 Ga0070680_100237958 Ga0070680_1002379582 285
394 3300005434 Ga0070709_10165279 Ga0070709_101652792 285
395 3300005434 Ga0070709_10219003 Ga0070709_102190032 285
396 3300005436 Ga0070713_100050324 Ga0070713_1000503243 285
397 3300005439 Ga0070711_100011205 Ga0070711_1000112054 285
398 3300005439 Ga0070711_100037368 Ga0070711_1000373683 285
399 3300005458 Ga0070681_10035705 Ga0070681_100357051 285
400 3300005518 Ga0070699_100157392 Ga0070699_1001573922 285
401 3300005546 Ga0070696_100250393 Ga0070696_1002503931 285
402 3300005983 Ga0081540_1018129 Ga0081540_10181293 285
403 3300006038 Ga0075365_10192103 Ga0075365_101921032 285
404 3300006173 Ga0070716_100018345 Ga0070716_1000183453 285
405 3300006175 Ga0070712_100029089 Ga0070712_1000290896 285
406 3300006175 Ga0070712_100098340 Ga0070712_1000983402 285
407 3300006175 Ga0070712_100202398 Ga0070712_1002023982 285
408 3300006914 Ga0075436_100351412 Ga0075436_1003514122 285
409 3300009093 Ga0105240_10187642 Ga0105240_101876422 285
410 3300009094 Ga0111539_10000107 Ga0111539_1000010755 285
411 3300009174 Ga0105241_10159343 Ga0105241_101593433 285
412 3300009551 Ga0105238_10076576 Ga0105238_100765762 285
413 3300013307 Ga0157372_10084740 Ga0157372_100847402 285
414 3300025294 Ga0209025_1000270 Ga0209025_1000270104 285
415 3300025297 Ga0209758_1007187 Ga0209758_10071876 285
416 3300025915 Ga0207693_10015201 Ga0207693_100152018 285
417 3300025915 Ga0207693_10015354 Ga0207693_100153545 285
418 3300025915 Ga0207693_10169593 Ga0207693_101695932 285
419 3300025916 Ga0207663_10133027 Ga0207663_101330273 285
420 3300025917 Ga0207660_10145951 Ga0207660_101459512 285
421 3300027682 Ga0209971_1021880 Ga0209971_10218801 285
422 3300027695 Ga0209966_1001356 Ga0209966_10013563 285
423 3300027907 Ga0207428_10000040 Ga0207428_1000004033 285
424 3300031241 Ga0265325_10026567 Ga0265325_100265673 285
425 3300031247 Ga0265340_10069410 Ga0265340_100694102 285
426 3300031595 Ga0265313_10000062 Ga0265313_1000006256 285
427 3300035117 Ga0373953_0017234 Ga0373953_0017234_787_1647 285
428 3300035118 Ga0373954_0118075 Ga0373954_0118075_182_1042 285
429 3300035120 Ga0373957_0014519 Ga0373957_0014519_191_1051 285
430 3300035171 Ga0373946_0005368 Ga0373946_0005368_493_1353 285
431 3300035410 Ga0373924_0036975 Ga0373924_0036975_728_1588 285
432 3300035691 Ga0373931_0025178 Ga0373931_0025178_2044_2904 285
433 3300035724 Ga0373933_0006840 Ga0373933_0006840_5133_5993 285
434 3300037418 Ga0395900_0038991 Ga0395900_0038991_917_1774 285
435 3300042439 Ga0439464_0027513 Ga0439464_0027513_345_1205 285
436 3300046454 Ga0495592_0001467 Ga0495592_0001467_982_1842 285
437 3300046460 Ga0495638_0137757 Ga0495638_0137757_309_1166 285
438 3300046462 Ga0495651_0005926 Ga0495651_0005926_3785_4645 285
439 3300046463 Ga0495653_0060278 Ga0495653_0060278_1404_2264 285
440 3300046477 Ga0495664_0172520 Ga0495664_0172520_366_1226 285
441 3300046511 Ga0495608_0010996 Ga0495608_0010996_3738_4598 285
442 3300046516 Ga0495628_0001714 Ga0495628_0001714_2999_3859 285
443 3300046536 Ga0495587_0020579 Ga0495587_0020579_2367_3227 285
444 3300046543 Ga0495645_0000223 Ga0495645_0000223_6095_6955 285
445 3300046663 Ga0495635_0047278 Ga0495635_0047278_889_1749 285
446 3300046675 Ga0495657_0021350 Ga0495657_0021350_1220_2080 285
447 3300046678 Ga0495599_0001359 Ga0495599_0001359_7555_8415 285
448 3300046679 Ga0495623_0032010 Ga0495623_0032010_1667_2527 285
449 3300046680 Ga0495646_0044814 Ga0495646_0044814_593_1453 285
450 3300046683 Ga0495658_0139907 Ga0495658_0139907_216_1076 285
451 3300047317 Ga0495604_0001128 Ga0495604_0001128_14008_14868 285
452 3300047322 Ga0495680_0006632 Ga0495680_0006632_5593_6453 285
453 3300047444 Ga0495675_0054421 Ga0495675_0054421_638_1498 285
454 3300048088 Ga0495602_0030168 Ga0495602_0030168_3902_4762 285
455 3300048907 Ga0496104_0000537 Ga0496104_0000537_10383_11243 285
456 3300048908 Ga0496105_0004684 Ga0496105_0004684_1705_2565 285
457 3300048915 Ga0496112_0131970 Ga0496112_0131970_909_1769 285
458 3300049569 Ga0501032_0078902 Ga0501032_0078902_919_1779 285
459 3300049571 Ga0501034_0050979 Ga0501034_0050979_2461_3321 285
460 3300049575 Ga0501039_0196777 Ga0501039_0196777_551_1414 285
461 3300049581 Ga0501047_0004012 Ga0501047_0004012_5649_6509 285
462 3300049581 Ga0501047_0034657 Ga0501047_0034657_1747_2610 285
463 3300049583 Ga0501067_0053439 Ga0501067_0053439_403_1266 285
464 3300049585 Ga0501069_0013536 Ga0501069_0013536_2088_2945 285
465 3300049585 Ga0501069_0046124 Ga0501069_0046124_493_1356 285
466 3300049586 Ga0501070_0011213 Ga0501070_0011213_4255_5112 285
467 3300049586 Ga0501070_0012528 Ga0501070_0012528_2625_3482 285
468 3300049587 Ga0501071_0088128 Ga0501071_0088128_1295_2158 285
469 3300049589 Ga0501073_0031711 Ga0501073_0031711_931_1794 285
470 3300049589 Ga0501073_0151797 Ga0501073_0151797_149_1006 285
471 3300049741 Ga0501079_0071931 Ga0501079_0071931_1197_2060 285
472 3300049742 Ga0501080_0039777 Ga0501080_0039777_424_1281 285
473 3300049742 Ga0501080_0058452 Ga0501080_0058452_2366_3229 285
474 3300049744 Ga0501083_0004629 Ga0501083_0004629_739_1599 285
475 3300049744 Ga0501083_0017118 Ga0501083_0017118_2253_3113 285
476 3300049744 Ga0501083_0084963 Ga0501083_0084963_54_914 285
477 3300049822 Ga0501035_0000453 Ga0501035_0000453_22677_23534 285
478 3300049823 Ga0501044_0431031 Ga0501044_0431031_117_974 285
479 3300050509 nmdc:mga0qj67_160_c1 nmdc:mga0qj67_160_c1_6422_7282 285
480 3300050511 nmdc:mga08y16_233_c1 nmdc:mga08y16_233_c1_14499_15356 285
481 3300053078 Ga0495612_0010559 Ga0495612_0010559_930_1790 285
482 3300053084 Ga0495595_0001916 Ga0495595_0001916_6779_7639 285
483 3300053085 Ga0495619_0000520 Ga0495619_0000520_24139_24999 285
484 3300060353 Ga0501082_0277431 Ga0501082_0277431_296_1156 285

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01144

CoA_trans

Coenzyme A transferase

56

277

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
1poi-assembly1.cif.gz_A crystal structure of glutaconate coenzyme a-transferase from acidaminococcus fermentans to 2.55 angstoms resolution 0.8885 2 278
6co9-assembly1.cif.gz_A crystal structure of rhodococcus jostii rha1 ipdab cochea-coa complex 0.8776 1 284
5mzx-assembly1.cif.gz_C crystal structure of the decarboxylase aiba/aibb in complex with 4'-diphospho pantetheine 0.8729 2 268
6co9-assembly1.cif.gz_A crystal structure of rhodococcus jostii rha1 ipdab cochea-coa complex 0.8718 1 284
6con-assembly2.cif.gz_G crystal structure of mycobacterium tuberculosis ipdab 0.8709 1 284
ID Description Score Start End Superfamily
1poiA01 Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase 0.8881 2 278 3.40.1080.10
5dbnA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase 0.8464 1 223 3.40.1080.10
5dbnA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase 0.8357 1 223 3.40.1080.10
1poiA01 Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase 0.8114 2 278 3.40.1080.10
af_Q2G1C6_6_271_3.40.1080.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase 0.8113 1 232 3.40.1080.10
ID Description Score Start End GO Terms
AF-A0A3S1UZU6-F1-model_v4 CoA transferase subunit A 0.9775 1 199 GO:0008410
AF-A0A531YTP3-F1-model_v4 deleted 0.9773 165 233
AF-A0A4U8Z744-F1-model_v4 Putative Glutaconate CoA-transferase (EC 2.8.3.12) 0.9753 1 226 GO:0018730
AF-A0A1I3G4H7-F1-model_v4 Glutaconate CoA-transferase subunit A 0.9736 1 268 GO:0008410
AF-A0A350DJ37-F1-model_v4 3-oxoadipate--succinyl-CoA transferase subunit A 0.9733 1 193 GO:0008410

Feature Viewer

pLDDT pTM Quality
89.81 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map