F452832

General Info

Members Datasets Scaffolds Average Seq Length
483 265 966 137

Family's Representative Sequence

Representative Sequence 3300048914|Ga0496111_0329099|Ga0496111_0329099_611_1102
Length 163
Sequence MKTLNTRAPTLIPPRLRLRASGRVSTMSHVDLMAGPPPTHLPEDPASAELDSGDAPAAVVRRHPSSPSAWAALADQAREEGADDVTVYAYARVGYHRSLDLLRRNGWKGHGPVPWEHEPNRGFLRCLATLALSARAIGETAEWERCSEFLRDSSPAAADALLG

Samples

Sample ID Description Type Environment
1 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
46 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
47 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
48 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
49 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
50 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
51 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
52 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
53 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
54 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
55 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
56 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
78 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
88 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
127 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
128 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
131 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
132 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
133 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
134 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
135 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
136 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
137 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
138 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
139 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
140 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
141 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
142 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
143 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
144 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
145 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
146 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
147 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
148 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
149 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
150 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
151 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
152 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
153 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
154 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
155 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
156 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
157 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
158 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
159 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
160 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
161 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
162 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
163 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
164 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
165 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
166 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
167 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
168 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
169 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
170 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
171 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
172 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
173 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
174 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
175 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
176 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
177 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
178 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
179 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
180 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
181 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
182 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
183 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
184 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
185 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
186 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
187 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
188 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
189 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
190 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
191 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
192 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
193 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
194 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
195 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
196 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
197 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
198 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
199 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
200 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
201 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
216 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
217 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
218 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
219 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
220 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
221 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
222 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
223 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
224 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
225 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
226 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
229 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
230 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
231 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
232 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
233 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
234 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
235 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
236 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
237 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
238 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
239 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
240 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
241 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
242 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
243 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
244 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
245 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
246 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
247 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
248 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
249 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
250 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
251 2643221641 Nocardioides sp. Root122 Isolate Unclassified
252 2643221670 Streptomyces sp. Root431 Isolate Unclassified
253 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
254 2739367898 Nocardioides sp. CF479 Isolate Unclassified
255 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
256 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
257 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
258 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
259 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
260 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
261 2891562705 Microbispora tritici MT50 Isolate Unclassified
262 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
263 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
264 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
265 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.48
Metatranscriptomes 0.21
Isolates 3.31

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.49
Nodule 0
Rhizoplane 12.42
Rhizosphere 75.57
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496111_0329099 3300048914 Bacteria 1131
2 JGI24740J21852_10008710 3300001979 Bacteria 4028
3 JGI24735J21928_10047531 3300002067 Bacteria 1244
4 JGI24738J21930_10110650 3300002075 Bacteria 592
5 JGI25405J52794_10143695 3300003911 Bacteria 543
6 Ga0070658_10222404 3300005327 Bacteria 1597
7 Ga0070683_100002429 3300005329 Bacteria 14809
8 Ga0070683_100035332 3300005329 Bacteria 4569
9 Ga0070683_101147134 3300005329 Bacteria 747
10 Ga0070683_102165161 3300005329 Bacteria 534
11 Ga0070670_100390675 3300005331 Bacteria 1227
12 Ga0070680_100364166 3300005336 Bacteria 1230
13 Ga0070682_100065327 3300005337 Bacteria 2312
14 Ga0070682_100644150 3300005337 Bacteria 843
15 Ga0068868_100851629 3300005338 Bacteria 826
16 Ga0070660_100063073 3300005339 Bacteria 2880
17 Ga0070660_100849356 3300005339 Bacteria 769
18 Ga0070687_100013284 3300005343 Bacteria 3665
19 Ga0070687_100119505 3300005343 Bacteria 1505
20 Ga0070692_10027273 3300005345 Bacteria 2830
21 Ga0070675_100236796 3300005354 Bacteria 1594
22 Ga0070675_100339091 3300005354 Bacteria 1331
23 Ga0070671_101932375 3300005355 Bacteria 525
24 Ga0070688_100334527 3300005365 Bacteria 1104
25 Ga0070688_101143487 3300005365 Bacteria 624
26 Ga0070659_100400381 3300005366 Bacteria 1159
27 Ga0070667_101839482 3300005367 Bacteria 570
28 Ga0070667_102331919 3300005367 Bacteria 504
29 Ga0070709_10039810 3300005434 Bacteria 2886
30 Ga0070714_100162377 3300005435 Bacteria 2022
31 Ga0070713_100025007 3300005436 Bacteria 4661
32 Ga0070713_100365432 3300005436 Bacteria 1341
33 Ga0070710_10016793 3300005437 Bacteria 3732
34 Ga0070705_101069083 3300005440 Bacteria 658
35 Ga0070700_100381050 3300005441 Bacteria 1055
36 Ga0070663_100553745 3300005455 Bacteria 962
37 Ga0070678_100350803 3300005456 Bacteria 1269
38 Ga0070678_100475983 3300005456 Bacteria 1098
39 Ga0070678_101459475 3300005456 Bacteria 640
40 Ga0070681_11038092 3300005458 Bacteria 740
41 Ga0070679_100017508 3300005530 Bacteria 6936
42 Ga0070679_100238130 3300005530 Bacteria 1778
43 Ga0070679_101064850 3300005530 Bacteria 753
44 Ga0070684_100008070 3300005535 Bacteria 8219
45 Ga0068853_100131005 3300005539 Bacteria 2245
46 Ga0068853_101170271 3300005539 Bacteria 742
47 Ga0068853_101468780 3300005539 Bacteria 660
48 Ga0070686_100192363 3300005544 Bacteria 1457
49 Ga0070693_100704310 3300005547 Bacteria 740
50 Ga0070665_100001394 3300005548 Bacteria 28474
51 Ga0070665_100265275 3300005548 Bacteria 1719
52 Ga0070665_101848794 3300005548 Bacteria 610
53 Ga0068857_100098408 3300005577 Bacteria 2624
54 Ga0068857_100306107 3300005577 Bacteria 1465
55 Ga0068857_100784715 3300005577 Bacteria 909
56 Ga0068854_101887043 3300005578 Bacteria 549
57 Ga0068856_100244467 3300005614 Bacteria 1810
58 Ga0070702_100443834 3300005615 Bacteria 940
59 Ga0068852_100424551 3300005616 Bacteria 1312
60 Ga0068864_100087358 3300005618 Bacteria 2745
61 Ga0068866_10116997 3300005718 Bacteria 1496
62 Ga0068861_100578289 3300005719 Bacteria 1028
63 Ga0068861_101493460 3300005719 Bacteria 663
64 Ga0068858_100066620 3300005842 Bacteria 3334
65 Ga0068858_100449337 3300005842 Bacteria 1242
66 Ga0068860_100000955 3300005843 Bacteria 31984
67 Ga0081455_10015659 3300005937 Bacteria 7354
68 Ga0081455_10033830 3300005937 Bacteria 4587
69 Ga0081538_10000139 3300005981 Bacteria 75075
70 Ga0081539_10150517 3300005985 Bacteria 1120
71 Ga0070717_10510135 3300006028 Bacteria 1087
72 Ga0075365_10004080 3300006038 Bacteria 7669
73 Ga0075365_10008325 3300006038 Bacteria 5877
74 Ga0075365_10367182 3300006038 Bacteria 1015
75 Ga0075365_10468073 3300006038 Bacteria 890
76 Ga0075365_10844093 3300006038 Bacteria 646
77 Ga0075368_10007911 3300006042 Bacteria 3769
78 Ga0075363_100017223 3300006048 Bacteria 3580
79 Ga0075363_100099943 3300006048 Bacteria 1604
80 Ga0075363_100205003 3300006048 Bacteria 1127
81 Ga0075364_10029436 3300006051 Bacteria 3522
82 Ga0075364_10030146 3300006051 Bacteria 3481
83 Ga0070715_10052779 3300006163 Bacteria 1755
84 Ga0070712_100192878 3300006175 Bacteria 1595
85 Ga0075367_10004262 3300006178 Bacteria 6955
86 Ga0075367_10022882 3300006178 Bacteria 3511
87 Ga0075367_10234719 3300006178 Bacteria 1149
88 Ga0075367_10318015 3300006178 Bacteria 981
89 Ga0075370_10006196 3300006353 Bacteria 6002
90 Ga0075370_10108502 3300006353 Bacteria 1611
91 Ga0075370_10174651 3300006353 Bacteria 1263
92 Ga0075370_10397545 3300006353 Bacteria 826
93 Ga0075428_100038115 3300006844 Bacteria 5290
94 Ga0075430_100017897 3300006846 Bacteria 6031
95 Ga0075431_100027499 3300006847 Bacteria 5837
96 Ga0075433_10153408 3300006852 Bacteria 2049
97 Ga0075434_100562375 3300006871 Bacteria 1160
98 Ga0075429_100005041 3300006880 Bacteria 11363
99 Ga0068865_100185238 3300006881 Bacteria 1606
100 Ga0068865_100568993 3300006881 Bacteria 954
101 Ga0097620_100796960 3300006931 Bacteria 1033
102 Ga0075435_100340464 3300007076 Bacteria 1285
103 Ga0111539_10119218 3300009094 Bacteria 3093
104 Ga0105245_10003081 3300009098 Bacteria 14922
105 Ga0105245_10241580 3300009098 Bacteria 1751
106 Ga0105245_10934045 3300009098 Bacteria 910
107 Ga0105247_10070510 3300009101 Bacteria 2183
108 Ga0105247_11032633 3300009101 Bacteria 644
109 Ga0114129_10005782 3300009147 Bacteria 17514
110 Ga0114129_11218207 3300009147 Bacteria 937
111 Ga0105243_11056759 3300009148 Bacteria 818
112 Ga0105241_10971377 3300009174 Bacteria 793
113 Ga0105241_12572557 3300009174 Bacteria 511
114 Ga0105242_10211659 3300009176 Bacteria 1728
115 Ga0105242_11188268 3300009176 Bacteria 781
116 Ga0105242_11789303 3300009176 Bacteria 652
117 Ga0105238_11094763 3300009551 Bacteria 819
118 Ga0105238_12516616 3300009551 Bacteria 551
119 Ga0105238_12632653 3300009551 Bacteria 539
120 Ga0105249_10048616 3300009553 Bacteria 3867
121 Ga0105239_10010829 3300010375 Bacteria 10190
122 Ga0105246_10001965 3300011119 Bacteria 12389
123 Ga0105246_10373774 3300011119 Bacteria 1175
124 Ga0157371_10068059 3300013102 Bacteria 2520
125 Ga0157370_11972312 3300013104 Bacteria 523
126 Ga0157369_10009466 3300013105 Bacteria 11140
127 Ga0157369_11243715 3300013105 Bacteria 759
128 Ga0163162_10006439 3300013306 Bacteria 11375
129 Ga0163162_10494897 3300013306 Bacteria 1353
130 Ga0163162_11006573 3300013306 Bacteria 942
131 Ga0163162_11757832 3300013306 Bacteria 709
132 Ga0157372_10099771 3300013307 Bacteria 3312
133 Ga0157372_12904103 3300013307 Bacteria 549
134 Ga0157375_10002144 3300013308 Bacteria 17045
135 Ga0157375_10196568 3300013308 Bacteria 2172
136 Ga0157375_10248006 3300013308 Bacteria 1941
137 Ga0157375_10338975 3300013308 Bacteria 1669
138 Ga0157375_11470779 3300013308 Bacteria 804
139 Ga0157375_11745562 3300013308 Bacteria 737
140 Ga0163163_10274360 3300014325 Bacteria 1737
141 Ga0163163_10301891 3300014325 Bacteria 1653
142 Ga0163163_10355689 3300014325 Bacteria 1521
143 Ga0163163_10693600 3300014325 Bacteria 1082
144 Ga0157380_10320316 3300014326 Bacteria 1437
145 Ga0157377_10041907 3300014745 Bacteria 2541
146 Ga0157377_10328027 3300014745 Bacteria 1019
147 Ga0157377_10991586 3300014745 Bacteria 635
148 Ga0157379_10066389 3300014968 Bacteria 3225
149 Ga0157379_11449650 3300014968 Bacteria 667
150 Ga0163161_10036898 3300017792 Bacteria 3502
151 Ga0163161_10128305 3300017792 Bacteria 1911
152 Ga0163161_10689163 3300017792 Bacteria 850
153 Ga0206353_11356936 3300020082 Bacteria 4402
154 Ga0207692_10020174 3300025898 Bacteria 3026
155 Ga0207642_10161943 3300025899 Bacteria 1202
156 Ga0207688_10024883 3300025901 Bacteria 3284
157 Ga0207688_10203954 3300025901 Bacteria 1186
158 Ga0207688_10471274 3300025901 Bacteria 784
159 Ga0207647_10123875 3300025904 Bacteria 1523
160 Ga0207647_10161953 3300025904 Bacteria 1305
161 Ga0207685_10010044 3300025905 Bacteria 2776
162 Ga0207699_10026731 3300025906 Bacteria 3185
163 Ga0207705_10085180 3300025909 Bacteria 2309
164 Ga0207705_10925087 3300025909 Bacteria 675
165 Ga0207693_10018481 3300025915 Bacteria 5553
166 Ga0207693_10125592 3300025915 Bacteria 2016
167 Ga0207660_10211871 3300025917 Bacteria 1518
168 Ga0207660_10362727 3300025917 Bacteria 1162
169 Ga0207662_10225782 3300025918 Bacteria 1221
170 Ga0207657_10072752 3300025919 Bacteria 2907
171 Ga0207657_10189181 3300025919 Bacteria 1662
172 Ga0207652_10032616 3300025921 Bacteria 4381
173 Ga0207694_11222360 3300025924 Bacteria 636
174 Ga0207650_11541786 3300025925 Bacteria 564
175 Ga0207659_10099858 3300025926 Bacteria 2186
176 Ga0207659_10492659 3300025926 Bacteria 1037
177 Ga0207687_10014201 3300025927 Bacteria 5211
178 Ga0207687_10652032 3300025927 Bacteria 890
179 Ga0207700_10031545 3300025928 Bacteria 3766
180 Ga0207664_10014682 3300025929 Bacteria 5666
181 Ga0207644_11047136 3300025931 Bacteria 685
182 Ga0207690_10341000 3300025932 Bacteria 1183
183 Ga0207690_11754264 3300025932 Bacteria 518
184 Ga0207686_10108232 3300025934 Bacteria 1869
185 Ga0207709_10291925 3300025935 Bacteria 1209
186 Ga0207704_10057798 3300025938 Bacteria 2385
187 Ga0207704_10128279 3300025938 Bacteria 1751
188 Ga0207665_10005644 3300025939 Bacteria 8338
189 Ga0207661_10051923 3300025944 Bacteria 3273
190 Ga0207661_10083914 3300025944 Bacteria 2637
191 Ga0207661_10304814 3300025944 Bacteria 1429
192 Ga0207661_10939694 3300025944 Bacteria 796
193 Ga0207667_10398944 3300025949 Bacteria 1400
194 Ga0207712_10168521 3300025961 Bacteria 1709
195 Ga0207712_10171286 3300025961 Bacteria 1697
196 Ga0207658_10035647 3300025986 Bacteria 3565
197 Ga0207658_10441726 3300025986 Bacteria 1150
198 Ga0207703_10085443 3300026035 Bacteria 2640
199 Ga0207703_11124326 3300026035 Bacteria 755
200 Ga0207639_10087491 3300026041 Bacteria 2484
201 Ga0207639_10747965 3300026041 Bacteria 909
202 Ga0207702_10245025 3300026078 Bacteria 1681
203 Ga0207702_10504587 3300026078 Bacteria 1180
204 Ga0207648_10134203 3300026089 Bacteria 2179
205 Ga0207676_10061165 3300026095 Bacteria 2981
206 Ga0207674_10021458 3300026116 Bacteria 6953
207 Ga0207674_10320258 3300026116 Bacteria 1500
208 Ga0207674_10679642 3300026116 Bacteria 994
209 Ga0207675_100103511 3300026118 Bacteria 2683
210 Ga0207683_10034971 3300026121 Bacteria 4370
211 Ga0207698_10390623 3300026142 Bacteria 1327
212 Ga0207698_11453360 3300026142 Bacteria 701
213 Ga0209813_10003250 3300027866 Bacteria 3796
214 Ga0209813_10022240 3300027866 Bacteria 1791
215 Ga0207428_10008805 3300027907 Bacteria 9102
216 Ga0268266_10005353 3300028379 Bacteria 11997
217 Ga0268266_10626136 3300028379 Bacteria 1035
218 Ga0268266_10873050 3300028379 Bacteria 870
219 Ga0268266_11546186 3300028379 Bacteria 639
220 Ga0268264_10000249 3300028381 Bacteria 101309
221 Ga0265338_10336642 3300028800 Bacteria 1088
222 Ga0265332_10143627 3300031238 Bacteria 1000
223 Ga0265325_10066557 3300031241 Bacteria 1816
224 Ga0265331_10237200 3300031250 Bacteria 819
225 Ga0265316_10210329 3300031344 Bacteria 1439
226 Ga0307408_100769358 3300031548 Bacteria 871
227 Ga0265313_10122801 3300031595 Bacteria 1131
228 Ga0265314_10073692 3300031711 Bacteria 2276
229 Ga0265342_10331581 3300031712 Bacteria 795
230 Ga0307413_10211733 3300031824 Bacteria 1408
231 Ga0307410_10778135 3300031852 Bacteria 812
232 Ga0307406_10057613 3300031901 Bacteria 2493
233 Ga0307409_100058388 3300031995 Bacteria 2996
234 Ga0307409_100285017 3300031995 Bacteria 1529
235 Ga0307409_100296096 3300031995 Bacteria 1503
236 Ga0307416_100322443 3300032002 Bacteria 1548
237 Ga0307416_101366339 3300032002 Bacteria 814
238 Ga0307414_10223059 3300032004 Bacteria 1549
239 Ga0307411_10025487 3300032005 Bacteria 3544
240 Ga0307411_11597269 3300032005 Bacteria 601
241 Ga0307415_100047952 3300032126 Bacteria 2879
242 Ga0307415_100160271 3300032126 Bacteria 1743
243 Ga0307415_100849699 3300032126 Bacteria 837
244 Ga0307415_100867775 3300032126 Bacteria 829
245 Ga0373952_0034658 3300035092 Bacteria 1139
246 Ga0373955_0513410 3300035172 Bacteria 732
247 Ga0373931_0935225 3300035691 Bacteria 584
248 Ga0373947_0167288 3300035725 Bacteria 1425
249 Ga0373925_0427371 3300037068 Bacteria 1083
250 Ga0395905_0211139 3300037471 Bacteria 1819
251 Ga0395905_0330488 3300037471 Bacteria 1415
252 Ga0395905_0646692 3300037471 Bacteria 959
253 Ga0395901_0043482 3300038443 Bacteria 4660
254 Ga0395901_0185606 3300038443 Bacteria 2181
255 Ga0395901_0369963 3300038443 Bacteria 1477
256 Ga0439436_0042731 3300041404 Bacteria 1295
257 Ga0439438_086624 3300041405 Bacteria 765
258 Ga0439447_094730 3300041407 Bacteria 686
259 Ga0439465_0103696 3300041413 Bacteria 984
260 Ga0451797_0194078 3300041453 Bacteria 563
261 Ga0451833_1108421 3300041491 Bacteria 974
262 Ga0451835_0453203 3300041492 Bacteria 592
263 Ga0439431_0003727 3300041997 Bacteria 3368
264 Ga0439445_0023124 3300042004 Bacteria 1572
265 Ga0439449_0133901 3300042007 Bacteria 922
266 Ga0439457_017933 3300042014 Bacteria 1571
267 Ga0439462_0032177 3300042015 Bacteria 1390
268 Ga0439446_0055982 3300042156 Bacteria 1184
269 Ga0439434_0008361 3300042435 Bacteria 3033
270 Ga0466965_0015211 3300044683 Bacteria 3655
271 Ga0466966_0070280 3300044684 Bacteria 2195
272 Ga0466961_0099483 3300044693 Bacteria 1833
273 Ga0466963_0027742 3300044694 Bacteria 3629
274 Ga0466963_0489367 3300044694 Bacteria 868
275 Ga0466957_0389737 3300044842 Bacteria 951
276 Ga0466960_0014418 3300044901 Bacteria 3383
277 Ga0466960_0065375 3300044901 Bacteria 1796
278 Ga0451576_0162632 3300045051 Bacteria 2330
279 Ga0466967_0010039 3300045976 Bacteria 7073
280 Ga0466967_0075203 3300045976 Bacteria 3035
281 Ga0466967_0079267 3300045976 Bacteria 2960
282 Ga0466967_0145605 3300045976 Bacteria 2210
283 Ga0466967_0636515 3300045976 Bacteria 1054
284 Ga0466967_2043525 3300045976 Bacteria 569
285 Ga0495603_0093134 3300046455 Bacteria 1761
286 Ga0495582_0088820 3300046473 Bacteria 1722
287 Ga0495620_0027012 3300046515 Bacteria 2692
288 Ga0495628_0167333 3300046516 Bacteria 1668
289 Ga0495630_1158482 3300046517 Bacteria 585
290 Ga0495633_0237304 3300046558 Bacteria 833
291 Ga0495657_0038087 3300046675 Bacteria 3311
292 Ga0495676_0608467 3300047321 Bacteria 711
293 Ga0495614_0216410 3300048089 Bacteria 870
294 Ga0496100_0072161 3300048903 Bacteria 2307
295 Ga0496100_0163242 3300048903 Bacteria 1598
296 Ga0496100_0164173 3300048903 Bacteria 1594
297 Ga0496100_0373393 3300048903 Bacteria 1082
298 Ga0496101_0291223 3300048904 Bacteria 1277
299 Ga0496101_0295701 3300048904 Bacteria 1267
300 Ga0496101_0330698 3300048904 Bacteria 1196
301 Ga0496101_0595096 3300048904 Bacteria 874
302 Ga0496102_0011958 3300048905 Bacteria 7496
303 Ga0496102_0110259 3300048905 Bacteria 2565
304 Ga0496102_0210318 3300048905 Bacteria 1834
305 Ga0496103_0008533 3300048906 Bacteria 6089
306 Ga0496103_0162343 3300048906 Bacteria 1433
307 Ga0496104_0005974 3300048907 Bacteria 10665
308 Ga0496104_0098191 3300048907 Bacteria 2803
309 Ga0496104_0408628 3300048907 Bacteria 1270
310 Ga0496104_1204665 3300048907 Bacteria 660
311 Ga0496105_0048827 3300048908 Bacteria 3493
312 Ga0496105_0100799 3300048908 Bacteria 2385
313 Ga0496105_0173125 3300048908 Bacteria 1769
314 Ga0496106_0025503 3300048909 Bacteria 4400
315 Ga0496107_0013339 3300048910 Bacteria 5742
316 Ga0496107_0018002 3300048910 Bacteria 4971
317 Ga0496107_0111578 3300048910 Bacteria 2010
318 Ga0496107_0819517 3300048910 Bacteria 681
319 Ga0496108_0073473 3300048911 Bacteria 2887
320 Ga0496108_0238085 3300048911 Bacteria 1583
321 Ga0496108_1042341 3300048911 Bacteria 697
322 Ga0496109_0045262 3300048912 Bacteria 3992
323 Ga0496109_0050192 3300048912 Bacteria 3800
324 Ga0496109_0196203 3300048912 Bacteria 1897
325 Ga0496109_0688806 3300048912 Bacteria 959
326 Ga0496109_1154156 3300048912 Bacteria 711
327 Ga0496109_1527987 3300048912 Bacteria 602
328 Ga0496110_0007015 3300048913 Bacteria 8963
329 Ga0496110_0289096 3300048913 Bacteria 1493
330 Ga0496110_0984893 3300048913 Bacteria 750
331 Ga0496110_1166971 3300048913 Bacteria 679
332 Ga0496111_0006592 3300048914 Bacteria 7552
333 Ga0496111_0546851 3300048914 Bacteria 850
334 Ga0496111_0599874 3300048914 Bacteria 806
335 Ga0496112_0723567 3300048915 Bacteria 922
336 Ga0496113_0004688 3300048916 Bacteria 8439
337 Ga0496113_0207375 3300048916 Bacteria 1559
338 Ga0496114_0007869 3300048917 Bacteria 8431
339 Ga0496114_0025832 3300048917 Bacteria 4803
340 Ga0496114_0044090 3300048917 Bacteria 3700
341 Ga0496114_0045140 3300048917 Bacteria 3660
342 Ga0496114_0190908 3300048917 Bacteria 1792
343 Ga0496114_0381934 3300048917 Bacteria 1247
344 Ga0496114_0636343 3300048917 Bacteria 939
345 Ga0496114_0674943 3300048917 Bacteria 907
346 Ga0496114_0895317 3300048917 Bacteria 768
347 Ga0496114_1609293 3300048917 Bacteria 538
348 Ga0496115_0022779 3300048918 Bacteria 4856
349 Ga0496115_0106299 3300048918 Bacteria 2304
350 Ga0496115_0190918 3300048918 Bacteria 1692
351 Ga0496115_0244887 3300048918 Bacteria 1477
352 Ga0496124_0110691 3300048927 Bacteria 2211
353 Ga0496124_0888204 3300048927 Bacteria 542
354 Ga0501032_0152052 3300049569 Bacteria 1521
355 Ga0501032_0332675 3300049569 Bacteria 979
356 Ga0501032_0471280 3300049569 Bacteria 803
357 Ga0501032_0473879 3300049569 Bacteria 801
358 Ga0501033_0000908 3300049570 Bacteria 27052
359 Ga0501033_0010692 3300049570 Bacteria 7033
360 Ga0501034_0002448 3300049571 Bacteria 22388
361 Ga0501034_0004679 3300049571 Bacteria 15151
362 Ga0501036_0002091 3300049572 Bacteria 15569
363 Ga0501036_0004031 3300049572 Bacteria 11811
364 Ga0501036_0243232 3300049572 Bacteria 1509
365 Ga0501037_0039211 3300049573 Bacteria 3488
366 Ga0501037_0439129 3300049573 Bacteria 891
367 Ga0501037_0636931 3300049573 Bacteria 713
368 Ga0501038_0000498 3300049574 Bacteria 34537
369 Ga0501038_0038259 3300049574 Bacteria 4202
370 Ga0501038_0221166 3300049574 Bacteria 1511
371 Ga0501038_0495778 3300049574 Bacteria 934
372 Ga0501038_0564904 3300049574 Bacteria 864
373 Ga0501039_0019842 3300049575 Bacteria 5152
374 Ga0501039_0087145 3300049575 Bacteria 2432
375 Ga0501039_0301940 3300049575 Bacteria 1259
376 Ga0501039_0392865 3300049575 Bacteria 1089
377 Ga0501039_0420110 3300049575 Bacteria 1050
378 Ga0501039_0646889 3300049575 Bacteria 828
379 Ga0501039_1004699 3300049575 Bacteria 648
380 Ga0501040_0220674 3300049576 Bacteria 1349
381 Ga0501041_0302423 3300049577 Bacteria 1008
382 Ga0501041_0328712 3300049577 Bacteria 965
383 Ga0501041_0487202 3300049577 Bacteria 784
384 Ga0501042_0039110 3300049578 Bacteria 3370
385 Ga0501042_0200468 3300049578 Bacteria 1439
386 Ga0501042_0419033 3300049578 Bacteria 970
387 Ga0501043_0001081 3300049579 Bacteria 23969
388 Ga0501043_0599960 3300049579 Bacteria 813
389 Ga0501043_0898204 3300049579 Bacteria 635
390 Ga0501046_0084048 3300049580 Bacteria 2456
391 Ga0501046_0130136 3300049580 Bacteria 1909
392 Ga0501047_0229891 3300049581 Bacteria 1708
393 Ga0501048_0218584 3300049582 Bacteria 1351
394 Ga0501048_0380219 3300049582 Bacteria 1008
395 Ga0501048_0523622 3300049582 Bacteria 850
396 Ga0501048_0644968 3300049582 Bacteria 760
397 Ga0501048_1032316 3300049582 Bacteria 591
398 Ga0501048_1316057 3300049582 Bacteria 519
399 Ga0501067_0075436 3300049583 Bacteria 1868
400 Ga0501067_0093057 3300049583 Bacteria 1674
401 Ga0501067_0209744 3300049583 Bacteria 1085
402 Ga0501068_0030357 3300049584 Bacteria 3206
403 Ga0501068_0033765 3300049584 Bacteria 3049
404 Ga0501068_0292570 3300049584 Bacteria 1042
405 Ga0501069_0029399 3300049585 Bacteria 3015
406 Ga0501069_0218948 3300049585 Bacteria 1106
407 Ga0501070_0004832 3300049586 Bacteria 11512
408 Ga0501070_0013963 3300049586 Bacteria 6762
409 Ga0501070_0023853 3300049586 Bacteria 5127
410 Ga0501070_0145971 3300049586 Bacteria 1953
411 Ga0501071_0056448 3300049587 Bacteria 2837
412 Ga0501072_1137906 3300049588 Bacteria 607
413 Ga0501073_0111038 3300049589 Bacteria 1902
414 Ga0501073_0118320 3300049589 Bacteria 1836
415 Ga0501073_0464065 3300049589 Bacteria 875
416 Ga0501074_0040967 3300049590 Bacteria 3353
417 Ga0501074_0494670 3300049590 Bacteria 866
418 Ga0501075_0134724 3300049591 Bacteria 1882
419 Ga0501075_0344874 3300049591 Bacteria 1135
420 Ga0501075_0770821 3300049591 Bacteria 732
421 Ga0501079_1544224 3300049741 Bacteria 522
422 Ga0501083_0593499 3300049744 Bacteria 721
423 Ga0501035_0000307 3300049822 Bacteria 57471
424 Ga0501035_0009824 3300049822 Bacteria 8889
425 Ga0501035_0088940 3300049822 Bacteria 2720
426 Ga0501044_0021234 3300049823 Bacteria 6931
427 Ga0501044_0087317 3300049823 Bacteria 3150
428 Ga0501044_0495108 3300049823 Bacteria 1124
429 Ga0501045_0385223 3300049824 Bacteria 1044
430 Ga0501045_0598568 3300049824 Bacteria 816
431 nmdc:mga03n38_338128_c1 3300050490 Bacteria 817
432 nmdc:mga03n38_48346_c1 3300050490 Bacteria 1887
433 nmdc:mga00v17_185144_c1 3300050491 Bacteria 1344
434 nmdc:mga00v17_205828_c1 3300050491 Bacteria 1273
435 nmdc:mga00v17_25588_c1 3300050491 Bacteria 3431
436 nmdc:mga00v17_65928_c1 3300050491 Bacteria 2235
437 nmdc:mga0yw44_130366_c1 3300050492 Bacteria 587
438 nmdc:mga0yw44_150283_c1 3300050492 Bacteria 1519
439 nmdc:mga0yw44_25066_c1 3300050492 Bacteria 3385
440 nmdc:mga0yw44_425038_c1 3300050492 Bacteria 900
441 nmdc:mga0yw44_829_c1 3300050492 Bacteria 11564
442 nmdc:mga06z11_1366_c1 3300050494 Bacteria 9033
443 nmdc:mga06z11_283933_c1 3300050494 Bacteria 981
444 nmdc:mga06z11_345081_c1 3300050494 Bacteria 891
445 nmdc:mga06z11_837244_c1 3300050494 Bacteria 561
446 nmdc:mga04h51_10708_c1 3300050495 Bacteria 2526
447 nmdc:mga04h51_35032_c1 3300050495 Bacteria 1607
448 nmdc:mga07m45_45177_c1 3300050496 Bacteria 2473
449 nmdc:mga07m45_83579_c1 3300050496 Bacteria 1825
450 nmdc:mga05p37_157_c1 3300050507 Bacteria 65045
451 nmdc:mga09592_6890_c1 3300050508 Bacteria 9245
452 nmdc:mga0qj67_14019_c1 3300050509 Bacteria 6055
453 nmdc:mga06r32_122_c1 3300050510 Bacteria 55812
454 nmdc:mga08y16_10323_c1 3300050511 Bacteria 9802
455 nmdc:mga0n895_286492_c1 3300050512 Bacteria 1670
456 nmdc:mga0rr50_303676_c1 3300050513 Bacteria 1335
457 nmdc:mga0a205_38146_c1 3300050515 Bacteria 4621
458 Ga0495655_0278673 3300053083 Bacteria 569
459 Ga0495595_0084657 3300053084 Bacteria 1515
460 Ga0495619_0029387 3300053085 Bacteria 3550
461 Ga0495619_0100286 3300053085 Bacteria 1970
462 Ga0500573_0001246 3300053140 Bacteria 12009
463 Ga0501084_1563070 3300054114 Bacteria 552
464 Ga0501084_1673904 3300054114 Bacteria 532
465 Ga0501082_0460092 3300060353 Bacteria 1112
466 Ga0501082_0640207 3300060353 Bacteria 930
467 Ga0530510_0628688 3300061734 Bacteria 817
468 2515857289 2515154155 Bacteria 7985436
469 2644228350 2643221641 Bacteria 4490190
470 2644390391 2643221670 Bacteria 6497041
471 2676493434 2675903060 Bacteria 10051191
472 2740165862 2739367898 Bacteria 4367674
473 2774396085 2773857762 Bacteria 5971770
474 2809197724 2808606439 Bacteria 5952208
475 2812347787 2811994878 Bacteria 5992952
476 2812479910 2811994917 Bacteria 7761064
477 2856747161 2856741275 Bacteria 8096094
478 2891402354 2891395885 Bacteria 9251614
479 2891562890 2891562705 Bacteria 8039471
480 2891968804 2891968417 Bacteria 5821697
481 2947228258 2947224130 Bacteria 9938529
482 2990067101 2990059506 Bacteria 9321252
483 8048410809 8048406513 Bacteria 8936924
484 Ga0496111_0329099
485 JGI24740J21852_10008710
486 JGI24735J21928_10047531
487 JGI24738J21930_10110650
488 JGI25405J52794_10143695
489 Ga0070658_10222404
490 Ga0070683_100002429
491 Ga0070683_100035332
492 Ga0070683_101147134
493 Ga0070683_102165161
494 Ga0070670_100390675
495 Ga0070680_100364166
496 Ga0070682_100065327
497 Ga0070682_100644150
498 Ga0068868_100851629
499 Ga0070660_100063073
500 Ga0070660_100849356
501 Ga0070687_100013284
502 Ga0070687_100119505
503 Ga0070692_10027273
504 Ga0070675_100236796
505 Ga0070675_100339091
506 Ga0070671_101932375
507 Ga0070688_100334527
508 Ga0070688_101143487
509 Ga0070659_100400381
510 Ga0070667_101839482
511 Ga0070667_102331919
512 Ga0070709_10039810
513 Ga0070714_100162377
514 Ga0070713_100025007
515 Ga0070713_100365432
516 Ga0070710_10016793
517 Ga0070705_101069083
518 Ga0070700_100381050
519 Ga0070663_100553745
520 Ga0070678_100350803
521 Ga0070678_100475983
522 Ga0070678_101459475
523 Ga0070681_11038092
524 Ga0070679_100017508
525 Ga0070679_100238130
526 Ga0070679_101064850
527 Ga0070684_100008070
528 Ga0068853_100131005
529 Ga0068853_101170271
530 Ga0068853_101468780
531 Ga0070686_100192363
532 Ga0070693_100704310
533 Ga0070665_100001394
534 Ga0070665_100265275
535 Ga0070665_101848794
536 Ga0068857_100098408
537 Ga0068857_100306107
538 Ga0068857_100784715
539 Ga0068854_101887043
540 Ga0068856_100244467
541 Ga0070702_100443834
542 Ga0068852_100424551
543 Ga0068864_100087358
544 Ga0068866_10116997
545 Ga0068861_100578289
546 Ga0068861_101493460
547 Ga0068858_100066620
548 Ga0068858_100449337
549 Ga0068860_100000955
550 Ga0081455_10015659
551 Ga0081455_10033830
552 Ga0081538_10000139
553 Ga0081539_10150517
554 Ga0070717_10510135
555 Ga0075365_10004080
556 Ga0075365_10008325
557 Ga0075365_10367182
558 Ga0075365_10468073
559 Ga0075365_10844093
560 Ga0075368_10007911
561 Ga0075363_100017223
562 Ga0075363_100099943
563 Ga0075363_100205003
564 Ga0075364_10029436
565 Ga0075364_10030146
566 Ga0070715_10052779
567 Ga0070712_100192878
568 Ga0075367_10004262
569 Ga0075367_10022882
570 Ga0075367_10234719
571 Ga0075367_10318015
572 Ga0075370_10006196
573 Ga0075370_10108502
574 Ga0075370_10174651
575 Ga0075370_10397545
576 Ga0075428_100038115
577 Ga0075430_100017897
578 Ga0075431_100027499
579 Ga0075433_10153408
580 Ga0075434_100562375
581 Ga0075429_100005041
582 Ga0068865_100185238
583 Ga0068865_100568993
584 Ga0097620_100796960
585 Ga0075435_100340464
586 Ga0111539_10119218
587 Ga0105245_10003081
588 Ga0105245_10241580
589 Ga0105245_10934045
590 Ga0105247_10070510
591 Ga0105247_11032633
592 Ga0114129_10005782
593 Ga0114129_11218207
594 Ga0105243_11056759
595 Ga0105241_10971377
596 Ga0105241_12572557
597 Ga0105242_10211659
598 Ga0105242_11188268
599 Ga0105242_11789303
600 Ga0105238_11094763
601 Ga0105238_12516616
602 Ga0105238_12632653
603 Ga0105249_10048616
604 Ga0105239_10010829
605 Ga0105246_10001965
606 Ga0105246_10373774
607 Ga0157371_10068059
608 Ga0157370_11972312
609 Ga0157369_10009466
610 Ga0157369_11243715
611 Ga0163162_10006439
612 Ga0163162_10494897
613 Ga0163162_11006573
614 Ga0163162_11757832
615 Ga0157372_10099771
616 Ga0157372_12904103
617 Ga0157375_10002144
618 Ga0157375_10196568
619 Ga0157375_10248006
620 Ga0157375_10338975
621 Ga0157375_11470779
622 Ga0157375_11745562
623 Ga0163163_10274360
624 Ga0163163_10301891
625 Ga0163163_10355689
626 Ga0163163_10693600
627 Ga0157380_10320316
628 Ga0157377_10041907
629 Ga0157377_10328027
630 Ga0157377_10991586
631 Ga0157379_10066389
632 Ga0157379_11449650
633 Ga0163161_10036898
634 Ga0163161_10128305
635 Ga0163161_10689163
636 Ga0206353_11356936
637 Ga0207692_10020174
638 Ga0207642_10161943
639 Ga0207688_10024883
640 Ga0207688_10203954
641 Ga0207688_10471274
642 Ga0207647_10123875
643 Ga0207647_10161953
644 Ga0207685_10010044
645 Ga0207699_10026731
646 Ga0207705_10085180
647 Ga0207705_10925087
648 Ga0207693_10018481
649 Ga0207693_10125592
650 Ga0207660_10211871
651 Ga0207660_10362727
652 Ga0207662_10225782
653 Ga0207657_10072752
654 Ga0207657_10189181
655 Ga0207652_10032616
656 Ga0207694_11222360
657 Ga0207650_11541786
658 Ga0207659_10099858
659 Ga0207659_10492659
660 Ga0207687_10014201
661 Ga0207687_10652032
662 Ga0207700_10031545
663 Ga0207664_10014682
664 Ga0207644_11047136
665 Ga0207690_10341000
666 Ga0207690_11754264
667 Ga0207686_10108232
668 Ga0207709_10291925
669 Ga0207704_10057798
670 Ga0207704_10128279
671 Ga0207665_10005644
672 Ga0207661_10051923
673 Ga0207661_10083914
674 Ga0207661_10304814
675 Ga0207661_10939694
676 Ga0207667_10398944
677 Ga0207712_10168521
678 Ga0207712_10171286
679 Ga0207658_10035647
680 Ga0207658_10441726
681 Ga0207703_10085443
682 Ga0207703_11124326
683 Ga0207639_10087491
684 Ga0207639_10747965
685 Ga0207702_10245025
686 Ga0207702_10504587
687 Ga0207648_10134203
688 Ga0207676_10061165
689 Ga0207674_10021458
690 Ga0207674_10320258
691 Ga0207674_10679642
692 Ga0207675_100103511
693 Ga0207683_10034971
694 Ga0207698_10390623
695 Ga0207698_11453360
696 Ga0209813_10003250
697 Ga0209813_10022240
698 Ga0207428_10008805
699 Ga0268266_10005353
700 Ga0268266_10626136
701 Ga0268266_10873050
702 Ga0268266_11546186
703 Ga0268264_10000249
704 Ga0265338_10336642
705 Ga0265332_10143627
706 Ga0265325_10066557
707 Ga0265331_10237200
708 Ga0265316_10210329
709 Ga0307408_100769358
710 Ga0265313_10122801
711 Ga0265314_10073692
712 Ga0265342_10331581
713 Ga0307413_10211733
714 Ga0307410_10778135
715 Ga0307406_10057613
716 Ga0307409_100058388
717 Ga0307409_100285017
718 Ga0307409_100296096
719 Ga0307416_100322443
720 Ga0307416_101366339
721 Ga0307414_10223059
722 Ga0307411_10025487
723 Ga0307411_11597269
724 Ga0307415_100047952
725 Ga0307415_100160271
726 Ga0307415_100849699
727 Ga0307415_100867775
728 Ga0373952_0034658
729 Ga0373955_0513410
730 Ga0373931_0935225
731 Ga0373947_0167288
732 Ga0373925_0427371
733 Ga0395905_0211139
734 Ga0395905_0330488
735 Ga0395905_0646692
736 Ga0395901_0043482
737 Ga0395901_0185606
738 Ga0395901_0369963
739 Ga0439436_0042731
740 Ga0439438_086624
741 Ga0439447_094730
742 Ga0439465_0103696
743 Ga0451797_0194078
744 Ga0451833_1108421
745 Ga0451835_0453203
746 Ga0439431_0003727
747 Ga0439445_0023124
748 Ga0439449_0133901
749 Ga0439457_017933
750 Ga0439462_0032177
751 Ga0439446_0055982
752 Ga0439434_0008361
753 Ga0466965_0015211
754 Ga0466966_0070280
755 Ga0466961_0099483
756 Ga0466963_0027742
757 Ga0466963_0489367
758 Ga0466957_0389737
759 Ga0466960_0014418
760 Ga0466960_0065375
761 Ga0451576_0162632
762 Ga0466967_0010039
763 Ga0466967_0075203
764 Ga0466967_0079267
765 Ga0466967_0145605
766 Ga0466967_0636515
767 Ga0466967_2043525
768 Ga0495603_0093134
769 Ga0495582_0088820
770 Ga0495620_0027012
771 Ga0495628_0167333
772 Ga0495630_1158482
773 Ga0495633_0237304
774 Ga0495657_0038087
775 Ga0495676_0608467
776 Ga0495614_0216410
777 Ga0496100_0072161
778 Ga0496100_0163242
779 Ga0496100_0164173
780 Ga0496100_0373393
781 Ga0496101_0291223
782 Ga0496101_0295701
783 Ga0496101_0330698
784 Ga0496101_0595096
785 Ga0496102_0011958
786 Ga0496102_0110259
787 Ga0496102_0210318
788 Ga0496103_0008533
789 Ga0496103_0162343
790 Ga0496104_0005974
791 Ga0496104_0098191
792 Ga0496104_0408628
793 Ga0496104_1204665
794 Ga0496105_0048827
795 Ga0496105_0100799
796 Ga0496105_0173125
797 Ga0496106_0025503
798 Ga0496107_0013339
799 Ga0496107_0018002
800 Ga0496107_0111578
801 Ga0496107_0819517
802 Ga0496108_0073473
803 Ga0496108_0238085
804 Ga0496108_1042341
805 Ga0496109_0045262
806 Ga0496109_0050192
807 Ga0496109_0196203
808 Ga0496109_0688806
809 Ga0496109_1154156
810 Ga0496109_1527987
811 Ga0496110_0007015
812 Ga0496110_0289096
813 Ga0496110_0984893
814 Ga0496110_1166971
815 Ga0496111_0006592
816 Ga0496111_0546851
817 Ga0496111_0599874
818 Ga0496112_0723567
819 Ga0496113_0004688
820 Ga0496113_0207375
821 Ga0496114_0007869
822 Ga0496114_0025832
823 Ga0496114_0044090
824 Ga0496114_0045140
825 Ga0496114_0190908
826 Ga0496114_0381934
827 Ga0496114_0636343
828 Ga0496114_0674943
829 Ga0496114_0895317
830 Ga0496114_1609293
831 Ga0496115_0022779
832 Ga0496115_0106299
833 Ga0496115_0190918
834 Ga0496115_0244887
835 Ga0496124_0110691
836 Ga0496124_0888204
837 Ga0501032_0152052
838 Ga0501032_0332675
839 Ga0501032_0471280
840 Ga0501032_0473879
841 Ga0501033_0000908
842 Ga0501033_0010692
843 Ga0501034_0002448
844 Ga0501034_0004679
845 Ga0501036_0002091
846 Ga0501036_0004031
847 Ga0501036_0243232
848 Ga0501037_0039211
849 Ga0501037_0439129
850 Ga0501037_0636931
851 Ga0501038_0000498
852 Ga0501038_0038259
853 Ga0501038_0221166
854 Ga0501038_0495778
855 Ga0501038_0564904
856 Ga0501039_0019842
857 Ga0501039_0087145
858 Ga0501039_0301940
859 Ga0501039_0392865
860 Ga0501039_0420110
861 Ga0501039_0646889
862 Ga0501039_1004699
863 Ga0501040_0220674
864 Ga0501041_0302423
865 Ga0501041_0328712
866 Ga0501041_0487202
867 Ga0501042_0039110
868 Ga0501042_0200468
869 Ga0501042_0419033
870 Ga0501043_0001081
871 Ga0501043_0599960
872 Ga0501043_0898204
873 Ga0501046_0084048
874 Ga0501046_0130136
875 Ga0501047_0229891
876 Ga0501048_0218584
877 Ga0501048_0380219
878 Ga0501048_0523622
879 Ga0501048_0644968
880 Ga0501048_1032316
881 Ga0501048_1316057
882 Ga0501067_0075436
883 Ga0501067_0093057
884 Ga0501067_0209744
885 Ga0501068_0030357
886 Ga0501068_0033765
887 Ga0501068_0292570
888 Ga0501069_0029399
889 Ga0501069_0218948
890 Ga0501070_0004832
891 Ga0501070_0013963
892 Ga0501070_0023853
893 Ga0501070_0145971
894 Ga0501071_0056448
895 Ga0501072_1137906
896 Ga0501073_0111038
897 Ga0501073_0118320
898 Ga0501073_0464065
899 Ga0501074_0040967
900 Ga0501074_0494670
901 Ga0501075_0134724
902 Ga0501075_0344874
903 Ga0501075_0770821
904 Ga0501079_1544224
905 Ga0501083_0593499
906 Ga0501035_0000307
907 Ga0501035_0009824
908 Ga0501035_0088940
909 Ga0501044_0021234
910 Ga0501044_0087317
911 Ga0501044_0495108
912 Ga0501045_0385223
913 Ga0501045_0598568
914 nmdc:mga03n38_338128_c1
915 nmdc:mga03n38_48346_c1
916 nmdc:mga00v17_185144_c1
917 nmdc:mga00v17_205828_c1
918 nmdc:mga00v17_25588_c1
919 nmdc:mga00v17_65928_c1
920 nmdc:mga0yw44_130366_c1
921 nmdc:mga0yw44_150283_c1
922 nmdc:mga0yw44_25066_c1
923 nmdc:mga0yw44_425038_c1
924 nmdc:mga0yw44_829_c1
925 nmdc:mga06z11_1366_c1
926 nmdc:mga06z11_283933_c1
927 nmdc:mga06z11_345081_c1
928 nmdc:mga06z11_837244_c1
929 nmdc:mga04h51_10708_c1
930 nmdc:mga04h51_35032_c1
931 nmdc:mga07m45_45177_c1
932 nmdc:mga07m45_83579_c1
933 nmdc:mga05p37_157_c1
934 nmdc:mga09592_6890_c1
935 nmdc:mga0qj67_14019_c1
936 nmdc:mga06r32_122_c1
937 nmdc:mga08y16_10323_c1
938 nmdc:mga0n895_286492_c1
939 nmdc:mga0rr50_303676_c1
940 nmdc:mga0a205_38146_c1
941 Ga0495655_0278673
942 Ga0495595_0084657
943 Ga0495619_0029387
944 Ga0495619_0100286
945 Ga0500573_0001246
946 Ga0501084_1563070
947 Ga0501084_1673904
948 Ga0501082_0460092
949 Ga0501082_0640207
950 Ga0530510_0628688
951 2515857289
952 2644228350
953 2644390391
954 2676493434
955 2740165862
956 2774396085
957 2809197724
958 2812347787
959 2812479910
960 2856747161
961 2891402354
962 2891562890
963 2891968804
964 2947228258
965 2990067101
966 8048410809

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11349

DUF3151

Protein of unknown function (DUF3151)

34

160

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2xpi-assembly1.cif.gz_A crystal structure of apc/c hetero-tetramer cut9-hcn1 0.8877 30 126
1w3b-assembly1.cif.gz_B the superhelical tpr domain of o-linked glcnac transferase reveals structural similarities to importin alpha. 0.8737 30 129
6vl6-assembly1.cif.gz_B de novo designed tetrahedral nanoparticle t33_dn2 presenting bg505 sosip trimers 0.8677 30 124
6hpg-assembly4.cif.gz_D arabidopsis om64 tpr domain 0.8527 30 134
5hgv-assembly2.cif.gz_C structure of an o-glcnac transferase point mutant, d554n in complex with peptide 0.8491 33 125
ID Description Score Start End Superfamily
af_O06310_16_142_1.10.3450.10 Mainly Alpha;Orthogonal Bundle;Hyaluronidase domain-like;TTHA0068-like 0.9587 8 133 1.10.3450.10
af_O06310_16_142_1.10.3450.10 Mainly Alpha;Orthogonal Bundle;Hyaluronidase domain-like;TTHA0068-like 0.9442 8 133 1.10.3450.10
af_B0G148_3_119_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.8957 30 120 1.25.40.10
af_O16296_409_537_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.894 33 124 1.25.40.10
2vyiA00 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.8884 30 125 1.25.40.10
ID Description Score Start End GO Terms
AF-A0A1V1W4N3-F1-model_v4 DUF3151 domain-containing protein 0.9932 4 137
AF-A0A6G7XT35-F1-model_v4 DUF3151 domain-containing protein 0.9915 1 135
AF-A0A6L7F083-F1-model_v4 DUF3151 family protein 0.9878 2 137
AF-A0A7W0M2A7-F1-model_v4 DUF3151 domain-containing protein 0.9842 11 131
AF-A0A6G6WHL6-F1-model_v4 DUF3151 domain-containing protein 0.9833 3 137

Map