F452783

General Info

Members Datasets Scaffolds Average Seq Length
483 245 966 477

Family's Representative Sequence

Representative Sequence 3300025913|Ga0207695_10203282|Ga0207695_102032821
Length 510
Sequence MSRTSKSAVVKSRSGETTAIGDRETQSAFAKARRNPARNCRIGLFGIGLEAYWSQFKGLKARLENCVRTVEKKLAHPGVEVVNLGLIDSPEKALVAGHDFRTADVDIIFLYVTTYALSSTVLPVVQRAKVPVIILNLSPAPAIDYASFNKMTDRTAMTGEWLAHCAACPVPEIANVFIRAGINFHQVTGMLHDDPGCWNEIDAWIEAARVAHTMSHNRLGLMGHYYSGMLDIYSDTTLQCATFGGHIEILEVDELAALRHEVSKKQIKERVAYFKKVFDVQSDCSQFELERAARTSVALDRLVKEHDLGSLAYFYNGKGSLENKDAISSIILGNSLLTARGIPVAGEYEVKNAQAMKIMDTFGVGGSFTEYYAMDFTDDVVLMGHDGPGHIAIAEGKTKVRPLKVYHGKIGRGLSVEMSVKHGPVTCLSVVETREGKLKLLVAEGESVPGPILEIGNTNSRYKFSIGVRKFVNDWNAHGPAHHCAVGVGHVAHKLDKLGRLLGIEVVKVC

Samples

Sample ID Description Type Environment
1 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
51 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
52 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
53 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
54 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
59 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
76 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
77 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
78 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
88 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
89 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
90 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
91 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
92 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
93 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
94 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
147 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
148 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
149 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
150 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
151 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
152 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
153 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
154 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
155 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
156 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
157 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
158 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
159 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
160 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
161 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
162 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
163 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
164 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
165 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
166 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
167 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
168 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
169 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
170 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
171 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
172 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
173 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
174 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
175 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
176 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
177 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
178 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
179 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
180 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
181 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
182 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
183 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
184 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
185 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
186 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
187 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
188 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
189 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
190 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
191 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
192 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
193 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
194 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
195 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
196 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
197 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
198 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
199 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
200 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
201 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
202 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
203 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
204 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
205 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
206 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
207 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
215 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
217 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
218 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
219 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
220 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
221 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
222 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
223 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
224 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
225 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
226 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
227 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
228 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
229 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
230 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
231 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
232 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
233 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
234 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
235 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
236 2739367663 Pedobacter sp. YR510 Isolate Unclassified
237 2786546940 Opitutaceae bacterium EW11 Isolate Unclassified
238 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
239 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
240 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
241 2884215851 Edaphobacter sp. 12200R-103 Isolate Rhizosphere
242 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
243 2920107658 Aquisphaera insulae JC669 Isolate Rhizosphere
244 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
245 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.72
Metatranscriptomes 0.21
Isolates 2.07

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.31
Nodule 0
Rhizoplane 1.45
Rhizosphere 89.86
Stem 0
Stem Tuber 0
Unclassified 8.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207695_10203282 3300025913 Bacteria 1894
2 JGI24737J22298_10000269 3300001990 Bacteria 17119
3 rootH2_10022676 3300003320 Bacteria 18207
4 rootH2_10049625 3300003320 Bacteria 27114
5 rootH2_10236183 3300003320 Bacteria 2525
6 rootL2_10074723 3300003322 Bacteria 7726
7 rootL2_10222397 3300003322 Bacteria 3978
8 Ga0070658_10005481 3300005327 Bacteria 10293
9 Ga0070658_10006618 3300005327 Bacteria 9391
10 Ga0070658_10155117 3300005327 Unclassified 1919
11 Ga0070683_100048588 3300005329 Bacteria 3923
12 Ga0070683_100063438 3300005329 Unclassified 3437
13 Ga0070683_100256821 3300005329 Bacteria 1662
14 Ga0070670_100024714 3300005331 Bacteria 5167
15 Ga0070670_100028619 3300005331 Unclassified 4795
16 Ga0068869_100000451 3300005334 Bacteria 22562
17 Ga0068869_100005335 3300005334 Bacteria 8079
18 Ga0068869_100062776 3300005334 Bacteria 2727
19 Ga0070666_10007189 3300005335 Bacteria 6863
20 Ga0070666_10024463 3300005335 Bacteria 3934
21 Ga0070666_10034087 3300005335 Bacteria 3374
22 Ga0070666_10076239 3300005335 Bacteria 2287
23 Ga0070680_100117487 3300005336 Bacteria 2217
24 Ga0068868_100008163 3300005338 Bacteria 7492
25 Ga0068868_100045627 3300005338 Bacteria 3429
26 Ga0068868_100075646 3300005338 Bacteria 2691
27 Ga0070660_100020747 3300005339 Bacteria 4835
28 Ga0070689_100060215 3300005340 Bacteria 2951
29 Ga0070661_100003990 3300005344 Bacteria 10149
30 Ga0070675_100056454 3300005354 Unclassified 3236
31 Ga0070671_100163332 3300005355 Bacteria 1882
32 Ga0070674_100174934 3300005356 Bacteria 1639
33 Ga0070673_100143635 3300005364 Unclassified 2015
34 Ga0070688_100055002 3300005365 Bacteria 2495
35 Ga0070667_100028613 3300005367 Unclassified 4640
36 Ga0070667_100168863 3300005367 Bacteria 1930
37 Ga0070703_10010637 3300005406 Bacteria 2594
38 Ga0070714_100015832 3300005435 Bacteria 6079
39 Ga0070714_100060994 3300005435 Bacteria 3238
40 Ga0070713_100000214 3300005436 Bacteria 38538
41 Ga0070711_100000284 3300005439 Bacteria 26259
42 Ga0070678_100017243 3300005456 Plasmid 4644
43 Ga0070681_10018801 3300005458 Bacteria 6914
44 Ga0070681_10054187 3300005458 Unclassified 3996
45 Ga0070681_10088022 3300005458 Bacteria 3058
46 Ga0070685_10007443 3300005466 Bacteria 5603
47 Ga0070706_100019305 3300005467 Bacteria 6287
48 Ga0070706_100032105 3300005467 Bacteria 4843
49 Ga0070706_100040523 3300005467 Bacteria 4300
50 Ga0070706_100120305 3300005467 Bacteria 2447
51 Ga0070707_100013654 3300005468 Bacteria 7607
52 Ga0070698_100017907 3300005471 Bacteria 7463
53 Ga0070679_100002609 3300005530 Bacteria 16389
54 Ga0070679_100028265 3300005530 Bacteria 5528
55 Ga0070679_100054113 3300005530 Unclassified 3995
56 Ga0070684_100005920 3300005535 Bacteria 9415
57 Ga0070684_100232664 3300005535 Unclassified 1683
58 Ga0068853_100000473 3300005539 Bacteria 27417
59 Ga0068853_100073101 3300005539 Unclassified 2989
60 Ga0068853_100184142 3300005539 Bacteria 1895
61 Ga0070686_100026969 3300005544 Unclassified 3472
62 Ga0070665_100005204 3300005548 Bacteria 13456
63 Ga0070665_100026484 3300005548 Bacteria 5838
64 Ga0070665_100037561 3300005548 Plasmid 4870
65 Ga0070665_100120744 3300005548 Bacteria 2622
66 Ga0070704_100053417 3300005549 Bacteria 2855
67 Ga0068855_100002379 3300005563 Bacteria 23193
68 Ga0068855_100006229 3300005563 Bacteria 14539
69 Ga0068855_100160592 3300005563 Bacteria 2551
70 Ga0068855_100247526 3300005563 Bacteria 1989
71 Ga0068857_100005875 3300005577 Bacteria 10478
72 Ga0068854_100053480 3300005578 Bacteria 2900
73 Ga0068856_100000089 3300005614 Bacteria 85631
74 Ga0068856_100001610 3300005614 Bacteria 23604
75 Ga0068856_100001782 3300005614 Bacteria 22500
76 Ga0068856_100020318 3300005614 Bacteria 6451
77 Ga0068856_100037972 3300005614 Bacteria 4727
78 Ga0068856_100095421 3300005614 Bacteria 2962
79 Ga0068852_100000102 3300005616 Bacteria 56718
80 Ga0068852_100000564 3300005616 Bacteria 24452
81 Ga0068852_100004982 3300005616 Bacteria 9447
82 Ga0068852_100053317 3300005616 Bacteria 3481
83 Ga0068852_100108614 3300005616 Bacteria 2518
84 Ga0068859_100024248 3300005617 Bacteria 6087
85 Ga0068864_100020452 3300005618 Bacteria 5537
86 Ga0068866_10070920 3300005718 Bacteria 1841
87 Ga0068851_10013784 3300005834 Unclassified 3828
88 Ga0068851_10064059 3300005834 Bacteria 1889
89 Ga0068863_100027775 3300005841 Bacteria 5400
90 Ga0068863_100050608 3300005841 Bacteria 3938
91 Ga0068858_100012459 3300005842 Bacteria 8019
92 Ga0068858_100016903 3300005842 Bacteria 6851
93 Ga0068858_100026973 3300005842 Bacteria 5336
94 Ga0068858_100047714 3300005842 Bacteria 3970
95 Ga0068858_100144898 3300005842 Bacteria 2230
96 Ga0068860_100008840 3300005843 Bacteria 10033
97 Ga0068862_100069710 3300005844 Bacteria 3035
98 Ga0081540_1002888 3300005983 Bacteria 13865
99 Ga0081540_1047195 3300005983 Bacteria 2168
100 Ga0081539_10009601 3300005985 Bacteria 8037
101 Ga0070717_10003716 3300006028 Bacteria 10966
102 Ga0070717_10010422 3300006028 Bacteria 7018
103 Ga0070715_10011264 3300006163 Bacteria 3216
104 Ga0070712_100000116 3300006175 Bacteria 41529
105 Ga0070712_100039257 3300006175 Bacteria 3239
106 Ga0097621_100001393 3300006237 Bacteria 16644
107 Ga0097621_100014784 3300006237 Bacteria 5852
108 Ga0068871_100002310 3300006358 Bacteria 12973
109 Ga0068871_100008596 3300006358 Bacteria 7341
110 Ga0068871_100035076 3300006358 Unclassified 3984
111 Ga0075428_100012007 3300006844 Bacteria 9637
112 Ga0075433_10020433 3300006852 Bacteria 5536
113 Ga0075433_10053609 3300006852 Bacteria 3517
114 Ga0075434_100000284 3300006871 Bacteria 36051
115 Ga0068865_100000399 3300006881 Bacteria 24214
116 Ga0075436_100052428 3300006914 Bacteria 2816
117 Ga0097620_100024249 3300006931 Bacteria 6087
118 Ga0075435_100043130 3300007076 Unclassified 3610
119 Ga0105240_10000200 3300009093 Bacteria 121941
120 Ga0105240_10000516 3300009093 Bacteria 71158
121 Ga0105240_10000590 3300009093 Bacteria 67365
122 Ga0105240_10001657 3300009093 Bacteria 37800
123 Ga0105240_10003580 3300009093 Bacteria 24104
124 Ga0105240_10004449 3300009093 Bacteria 21378
125 Ga0105240_10012915 3300009093 Bacteria 11504
126 Ga0105240_10028669 3300009093 Bacteria 7265
127 Ga0105240_10044309 3300009093 Bacteria 5654
128 Ga0105240_10049057 3300009093 Bacteria 5332
129 Ga0105240_10063725 3300009093 Bacteria 4583
130 Ga0105240_10156074 3300009093 Bacteria 2714
131 Ga0105240_10200877 3300009093 Bacteria 2336
132 Ga0111539_10005359 3300009094 Bacteria 16586
133 Ga0105245_10002432 3300009098 Bacteria 16850
134 Ga0105245_10005548 3300009098 Bacteria 11085
135 Ga0105245_10031474 3300009098 Bacteria 4695
136 Ga0105245_10052549 3300009098 Bacteria 3654
137 Ga0105247_10096632 3300009101 Bacteria 1883
138 Ga0114129_10033887 3300009147 Bacteria 7213
139 Ga0114129_10297294 3300009147 Bacteria 2153
140 Ga0105241_10000417 3300009174 Bacteria 32174
141 Ga0105241_10000830 3300009174 Bacteria 23439
142 Ga0105241_10000978 3300009174 Bacteria 21636
143 Ga0105241_10029951 3300009174 Bacteria 4065
144 Ga0105241_10034111 3300009174 Unclassified 3822
145 Ga0105241_10207352 3300009174 Bacteria 1641
146 Ga0105241_10221582 3300009174 Bacteria 1590
147 Ga0105248_10000019 3300009177 Bacteria 285766
148 Ga0105248_10001540 3300009177 Bacteria 25663
149 Ga0105248_10035559 3300009177 Bacteria 5573
150 Ga0105248_10094510 3300009177 Bacteria 3366
151 Ga0105248_10293274 3300009177 Bacteria 1832
152 Ga0105237_10000424 3300009545 Bacteria 60086
153 Ga0105237_10002310 3300009545 Bacteria 23700
154 Ga0105237_10002403 3300009545 Bacteria 23250
155 Ga0105237_10003110 3300009545 Bacteria 19993
156 Ga0105237_10004134 3300009545 Bacteria 16907
157 Ga0105237_10007892 3300009545 Bacteria 11597
158 Ga0105237_10021154 3300009545 Bacteria 6691
159 Ga0105237_10025407 3300009545 Bacteria 6058
160 Ga0105237_10043623 3300009545 Bacteria 4517
161 Ga0105238_10000049 3300009551 Bacteria 145016
162 Ga0105238_10001199 3300009551 Bacteria 26146
163 Ga0105238_10002863 3300009551 Bacteria 17244
164 Ga0105238_10013188 3300009551 Bacteria 8342
165 Ga0105238_10022241 3300009551 Bacteria 6464
166 Ga0105238_10025351 3300009551 Bacteria 6045
167 Ga0105238_10032639 3300009551 Bacteria 5298
168 Ga0105238_10200869 3300009551 Bacteria 1969
169 Ga0105249_10066556 3300009553 Bacteria 3317
170 Ga0105239_10000934 3300010375 Bacteria 41248
171 Ga0105239_10002510 3300010375 Bacteria 23344
172 Ga0105239_10002514 3300010375 Bacteria 23317
173 Ga0105239_10002939 3300010375 Bacteria 21260
174 Ga0105239_10005414 3300010375 Bacteria 14971
175 Ga0105239_10005627 3300010375 Bacteria 14645
176 Ga0105239_10030039 3300010375 Bacteria 5977
177 Ga0105239_10159276 3300010375 Bacteria 2521
178 Ga0105246_10000204 3300011119 Bacteria 29974
179 Ga0157373_10022845 3300013100 Bacteria 4536
180 Ga0157370_10000174 3300013104 Bacteria 79990
181 Ga0157370_10011724 3300013104 Bacteria 9151
182 Ga0157370_10076660 3300013104 Bacteria 3149
183 Ga0157370_10259337 3300013104 Bacteria 1607
184 Ga0157369_10000262 3300013105 Bacteria 71158
185 Ga0157369_10000275 3300013105 Bacteria 69270
186 Ga0157369_10035675 3300013105 Bacteria 5451
187 Ga0157374_10002433 3300013296 Bacteria 15699
188 Ga0157374_10285634 3300013296 Bacteria 1630
189 Ga0157378_10002618 3300013297 Bacteria 16017
190 Ga0157378_10005891 3300013297 Bacteria 10737
191 Ga0157378_10039357 3300013297 Bacteria 4193
192 Ga0157378_10045563 3300013297 Unclassified 3897
193 Ga0157378_10051654 3300013297 Unclassified 3658
194 Ga0157378_10051734 3300013297 Bacteria 3655
195 Ga0157378_10146842 3300013297 Unclassified 2194
196 Ga0163162_10014724 3300013306 Bacteria 7643
197 Ga0163162_10053743 3300013306 Bacteria 4049
198 Ga0163162_10104886 3300013306 Bacteria 2921
199 Ga0157372_10000288 3300013307 Bacteria 56031
200 Ga0157372_10000355 3300013307 Bacteria 50293
201 Ga0157372_10000531 3300013307 Bacteria 42253
202 Ga0157372_10002814 3300013307 Bacteria 18794
203 Ga0157372_10010197 3300013307 Bacteria 9977
204 Ga0157372_10028099 3300013307 Bacteria 6136
205 Ga0157372_10033039 3300013307 Bacteria 5680
206 Ga0157372_10065495 3300013307 Bacteria 4080
207 Ga0157372_10319371 3300013307 Unclassified 1808
208 Ga0157375_10002176 3300013308 Bacteria 16941
209 Ga0157375_10007207 3300013308 Bacteria 9724
210 Ga0157375_10025834 3300013308 Bacteria 5464
211 Ga0163163_10034208 3300014325 Bacteria 4919
212 Ga0163163_10269554 3300014325 Bacteria 1754
213 Ga0157379_10010757 3300014968 Bacteria 7974
214 Ga0157379_10024411 3300014968 Bacteria 5367
215 Ga0157379_10026049 3300014968 Bacteria 5202
216 Ga0157376_10001196 3300014969 Bacteria 17137
217 Ga0157376_10001303 3300014969 Bacteria 16425
218 Ga0157376_10006406 3300014969 Bacteria 8317
219 Ga0157376_10070919 3300014969 Bacteria 2959
220 Ga0157376_10073231 3300014969 Bacteria 2917
221 Ga0183373_1001 3300015682 Bacteria 1410374
222 Ga0163161_10000284 3300017792 Bacteria 44309
223 Ga0163161_10037188 3300017792 Bacteria 3489
224 Ga0163161_10082681 3300017792 Bacteria 2366
225 Ga0213872_10002897 3300021361 Bacteria 9752
226 Ga0213874_10005942 3300021377 Unclassified 2866
227 Ga0213876_10000996 3300021384 Bacteria 18478
228 Ga0213871_10019285 3300021441 Bacteria 1678
229 Ga0209233_1011517 3300025261 Bacteria 2603
230 Ga0209050_1001379 3300025298 Bacteria 26506
231 Ga0207656_10032955 3300025321 Bacteria 2155
232 Ga0207656_10037833 3300025321 Bacteria 2032
233 Ga0207642_10058999 3300025899 Bacteria 1773
234 Ga0207680_10039274 3300025903 Bacteria 2745
235 Ga0207647_10021280 3300025904 Bacteria 4332
236 Ga0207647_10022642 3300025904 Bacteria 4170
237 Ga0207647_10033644 3300025904 Bacteria 3281
238 Ga0207645_10005758 3300025907 Bacteria 8941
239 Ga0207643_10059726 3300025908 Bacteria 2175
240 Ga0207705_10083666 3300025909 Bacteria 2328
241 Ga0207684_10005511 3300025910 Bacteria 11658
242 Ga0207684_10016821 3300025910 Bacteria 6279
243 Ga0207654_10000011 3300025911 Bacteria 245470
244 Ga0207654_10000219 3300025911 Bacteria 35241
245 Ga0207654_10005238 3300025911 Bacteria 6546
246 Ga0207654_10005900 3300025911 Bacteria 6167
247 Ga0207654_10006577 3300025911 Bacteria 5843
248 Ga0207707_10001926 3300025912 Bacteria 18866
249 Ga0207695_10000055 3300025913 Bacteria 382776
250 Ga0207695_10000150 3300025913 Bacteria 207099
251 Ga0207695_10000154 3300025913 Bacteria 206200
252 Ga0207695_10000161 3300025913 Bacteria 199839
253 Ga0207695_10000184 3300025913 Bacteria 181201
254 Ga0207695_10000224 3300025913 Bacteria 151136
255 Ga0207695_10003196 3300025913 Bacteria 23339
256 Ga0207695_10004661 3300025913 Bacteria 18583
257 Ga0207695_10010488 3300025913 Bacteria 11334
258 Ga0207695_10011663 3300025913 Bacteria 10621
259 Ga0207695_10015716 3300025913 Bacteria 8898
260 Ga0207695_10019390 3300025913 Bacteria 7833
261 Ga0207695_10109305 3300025913 Bacteria 2747
262 Ga0207671_10000105 3300025914 Bacteria 129160
263 Ga0207671_10000297 3300025914 Bacteria 73234
264 Ga0207671_10000917 3300025914 Bacteria 37182
265 Ga0207671_10003215 3300025914 Bacteria 16442
266 Ga0207671_10062108 3300025914 Unclassified 2773
267 Ga0207671_10096647 3300025914 Bacteria 2232
268 Ga0207671_10110896 3300025914 Bacteria 2087
269 Ga0207693_10000225 3300025915 Bacteria 51527
270 Ga0207693_10039264 3300025915 Bacteria 3727
271 Ga0207663_10000532 3300025916 Bacteria 16711
272 Ga0207660_10031140 3300025917 Bacteria 3670
273 Ga0207662_10030143 3300025918 Bacteria 3147
274 Ga0207657_10013529 3300025919 Bacteria 8003
275 Ga0207652_10000016 3300025921 Bacteria 188815
276 Ga0207652_10006027 3300025921 Bacteria 9815
277 Ga0207652_10019774 3300025921 Bacteria 5542
278 Ga0207646_10007430 3300025922 Bacteria 11136
279 Ga0207694_10000009 3300025924 Bacteria 460687
280 Ga0207694_10004078 3300025924 Bacteria 11486
281 Ga0207694_10004766 3300025924 Bacteria 10545
282 Ga0207694_10030431 3300025924 Bacteria 4123
283 Ga0207694_10121163 3300025924 Bacteria 2089
284 Ga0207650_10122369 3300025925 Unclassified 2027
285 Ga0207687_10016886 3300025927 Bacteria 4798
286 Ga0207700_10000742 3300025928 Bacteria 18761
287 Ga0207664_10039615 3300025929 Bacteria 3659
288 Ga0207644_10032856 3300025931 Bacteria 3623
289 Ga0207706_10014604 3300025933 Bacteria 7112
290 Ga0207709_10041927 3300025935 Bacteria 2750
291 Ga0207704_10000235 3300025938 Bacteria 27349
292 Ga0207665_10113977 3300025939 Bacteria 1903
293 Ga0207691_10035833 3300025940 Unclassified 4601
294 Ga0207691_10043572 3300025940 Unclassified 4135
295 Ga0207711_10004499 3300025941 Bacteria 11878
296 Ga0207711_10099797 3300025941 Unclassified 2567
297 Ga0207689_10000218 3300025942 Bacteria 50700
298 Ga0207689_10000543 3300025942 Bacteria 35857
299 Ga0207689_10017423 3300025942 Bacteria 6078
300 Ga0207661_10022501 3300025944 Bacteria 4750
301 Ga0207661_10023959 3300025944 Bacteria 4618
302 Ga0207679_10038809 3300025945 Bacteria 3397
303 Ga0207667_10001371 3300025949 Bacteria 30536
304 Ga0207667_10003240 3300025949 Bacteria 20075
305 Ga0207667_10003546 3300025949 Bacteria 19298
306 Ga0207667_10006075 3300025949 Bacteria 14674
307 Ga0207667_10029369 3300025949 Bacteria 5963
308 Ga0207667_10032923 3300025949 Bacteria 5579
309 Ga0207667_10224553 3300025949 Bacteria 1924
310 Ga0207667_10265812 3300025949 Bacteria 1754
311 Ga0207651_10032345 3300025960 Unclassified 3359
312 Ga0207640_10184635 3300025981 Bacteria 1567
313 Ga0207658_10031802 3300025986 Unclassified 3751
314 Ga0207677_10023745 3300026023 Bacteria 3794
315 Ga0207677_10024901 3300026023 Bacteria 3725
316 Ga0207703_10010434 3300026035 Bacteria 7266
317 Ga0207639_10000192 3300026041 Bacteria 47328
318 Ga0207639_10006136 3300026041 Bacteria 8159
319 Ga0207708_10010112 3300026075 Bacteria 7006
320 Ga0207702_10002643 3300026078 Bacteria 16821
321 Ga0207702_10003197 3300026078 Bacteria 15129
322 Ga0207702_10063365 3300026078 Bacteria 3161
323 Ga0207702_10112819 3300026078 Bacteria 2420
324 Ga0207702_10176239 3300026078 Bacteria 1965
325 Ga0207641_10002830 3300026088 Bacteria 15764
326 Ga0207641_10025437 3300026088 Bacteria 4881
327 Ga0207648_10182674 3300026089 Bacteria 1857
328 Ga0207674_10000871 3300026116 Bacteria 39535
329 Ga0207675_100153620 3300026118 Bacteria 2192
330 Ga0207683_10003877 3300026121 Bacteria 12970
331 Ga0207683_10095915 3300026121 Unclassified 2644
332 Ga0207698_10000082 3300026142 Bacteria 62831
333 Ga0207698_10000419 3300026142 Bacteria 24433
334 Ga0207698_10001721 3300026142 Bacteria 12751
335 Ga0207698_10065088 3300026142 Bacteria 2861
336 Ga0268266_10002316 3300028379 Bacteria 20650
337 Ga0268266_10006961 3300028379 Bacteria 10279
338 Ga0268265_10120475 3300028380 Unclassified 2161
339 Ga0268264_10009933 3300028381 Bacteria 7879
340 Ga0268264_10012285 3300028381 Bacteria 7048
341 Ga0265326_10008796 3300028558 Bacteria 3029
342 Ga0307517_10024206 3300028786 Bacteria 7500
343 Ga0307515_10000190 3300028794 Bacteria 150300
344 Ga0307515_10002489 3300028794 Bacteria 39983
345 Ga0265338_10000009 3300028800 Bacteria 448611
346 Ga0265338_10000574 3300028800 Bacteria 64844
347 Ga0265338_10000660 3300028800 Bacteria 59683
348 Ga0265338_10000828 3300028800 Bacteria 52193
349 Ga0265338_10002256 3300028800 Bacteria 29355
350 Ga0265338_10015931 3300028800 Bacteria 8224
351 Ga0265338_10034487 3300028800 Unclassified 4890
352 Ga0265338_10078869 3300028800 Unclassified 2775
353 Ga0265338_10105348 3300028800 Bacteria 2286
354 Ga0265324_10000436 3300029957 Bacteria 29666
355 Ga0265324_10015144 3300029957 Bacteria 2840
356 Ga0307511_10000033 3300030521 Bacteria 104421
357 Ga0316177_1079363 3300030731 Bacteria 8057
358 Ga0316176_1177032 3300030732 Bacteria 13943
359 Ga0316183_1180191 3300030742 Bacteria 65717
360 Ga0265760_10006439 3300031090 Bacteria 3358
361 Ga0265325_10011503 3300031241 Bacteria 5083
362 Ga0265339_10018431 3300031249 Bacteria 4115
363 Ga0265339_10032940 3300031249 Bacteria 2922
364 Ga0265339_10048802 3300031249 Bacteria 2320
365 Ga0307513_10036470 3300031456 Bacteria 5485
366 Ga0265313_10002742 3300031595 Bacteria 14868
367 Ga0307508_10000081 3300031616 Bacteria 112337
368 Ga0307508_10000220 3300031616 Bacteria 69518
369 Ga0307514_10065485 3300031649 Bacteria 2752
370 Ga0307516_10046845 3300031730 Bacteria 4264
371 Ga0307510_10011916 3300033180 Bacteria 10307
372 Ga0373934_0015156 3300035086 Unclassified 2922
373 Ga0373954_0001923 3300035118 Bacteria 8598
374 Ga0373933_0001836 3300035724 Bacteria 12293
375 Ga0373937_0000307 3300036401 Bacteria 46169
376 Ga0373937_0002701 3300036401 Bacteria 14816
377 Ga0395898_0220416 3300037466 Bacteria 1809
378 Ga0436364_0904747 3300037853 Bacteria 10138
379 Ga0436365_0054332 3300039437 Bacteria 18529
380 Ga0436360_1093311 3300039438 Bacteria 4454
381 Ga0436361_0219983 3300039447 Bacteria 12099
382 Ga0436361_0437720 3300039447 Bacteria 11499
383 Ga0436363_0035178 3300039450 Bacteria 15109
384 Ga0436363_0865618 3300039450 Bacteria 13849
385 Ga0436363_1602297 3300039450 Unclassified 4690
386 Ga0451577_0042169 3300042876 Bacteria 4093
387 Ga0451577_0054721 3300042876 Bacteria 3562
388 Ga0451577_0080281 3300042876 Bacteria 2908
389 Ga0451577_0121602 3300042876 Bacteria 2339
390 Ga0466972_0002998 3300044658 Bacteria 8364
391 Ga0453683_0034237 3300044673 Bacteria 3203
392 Ga0466966_0072204 3300044684 Unclassified 2162
393 Ga0466961_0013422 3300044693 Bacteria 5246
394 Ga0466963_0033627 3300044694 Unclassified 3331
395 Ga0453684_0074533 3300044712 Bacteria 4271
396 Ga0466968_0017304 3300044735 Bacteria 2880
397 Ga0466970_0032149 3300044765 Bacteria 2772
398 Ga0466959_0016595 3300045049 Bacteria 5385
399 Ga0466959_0033675 3300045049 Bacteria 3789
400 Ga0451576_0101586 3300045051 Bacteria 2991
401 Ga0451576_0352711 3300045051 Bacteria 1540
402 Ga0466967_0002436 3300045976 Bacteria 11579
403 Ga0466967_0074982 3300045976 Bacteria 3040
404 Ga0495638_0000006 3300046460 Bacteria 668846
405 Ga0495651_0034477 3300046462 Unclassified 3945
406 Ga0495650_0000010 3300046471 Bacteria 645599
407 Ga0495580_0000421 3300046472 Bacteria 35130
408 Ga0495607_0008380 3300046501 Bacteria 7070
409 Ga0495587_0003653 3300046536 Bacteria 10243
410 Ga0495668_0003868 3300046616 Bacteria 10938
411 Ga0495611_0000038 3300046648 Bacteria 100121
412 Ga0495625_0000182 3300046660 Bacteria 98244
413 Ga0495625_0045154 3300046660 Bacteria 3187
414 Ga0495661_0026469 3300046665 Bacteria 3736
415 Ga0495646_0001296 3300046680 Bacteria 14750
416 Ga0495613_0004114 3300046689 Bacteria 10881
417 Ga0495604_0001224 3300047317 Bacteria 21051
418 Ga0495674_0020476 3300047319 Bacteria 6122
419 Ga0495674_0220737 3300047319 Bacteria 1567
420 Ga0495672_0007709 3300047320 Bacteria 8060
421 Ga0495672_0047601 3300047320 Bacteria 2549
422 Ga0495602_0001345 3300048088 Bacteria 24269
423 Ga0495602_0089924 3300048088 Bacteria 2552
424 Ga0496102_0056518 3300048905 Bacteria 3580
425 Ga0496105_0039009 3300048908 Bacteria 3914
426 Ga0496106_0102049 3300048909 Bacteria 2225
427 Ga0496109_0136591 3300048912 Bacteria 2291
428 Ga0496115_0037508 3300048918 Bacteria 3841
429 Ga0496115_0084378 3300048918 Unclassified 2590
430 Ga0496115_0087569 3300048918 Bacteria 2541
431 Ga0501031_0000246 3300049568 Bacteria 30314
432 Ga0501032_0000376 3300049569 Bacteria 36746
433 Ga0501032_0002858 3300049569 Bacteria 13419
434 Ga0501032_0035563 3300049569 Unclassified 3404
435 Ga0501033_0000255 3300049570 Bacteria 50989
436 Ga0501033_0005873 3300049570 Bacteria 9647
437 Ga0501034_0185298 3300049571 Bacteria 2045
438 Ga0501043_0008662 3300049579 Bacteria 8009
439 Ga0501046_0000498 3300049580 Bacteria 39183
440 Ga0501046_0005911 3300049580 Bacteria 10901
441 Ga0501046_0015990 3300049580 Bacteria 6294
442 Ga0501047_0055756 3300049581 Bacteria 3821
443 Ga0501080_0123249 3300049742 Bacteria 2401
444 Ga0501035_0001483 3300049822 Bacteria 24028
445 Ga0501035_0004068 3300049822 Bacteria 13909
446 Ga0501035_0010698 3300049822 Bacteria 8492
447 Ga0501044_0000127 3300049823 Bacteria 92724
448 Ga0501044_0000202 3300049823 Bacteria 75472
449 Ga0501044_0080983 3300049823 Bacteria 3287
450 Ga0501044_0086867 3300049823 Bacteria 3159
451 nmdc:mga05p37_100657_c1 3300050507 Bacteria 3560
452 nmdc:mga05p37_222826_c1 3300050507 Bacteria 2275
453 nmdc:mga08y16_136893_c1 3300050511 Bacteria 2545
454 nmdc:mga0n895_1292_c1 3300050512 Bacteria 18532
455 nmdc:mga0n895_331326_c1 3300050512 Bacteria 1542
456 nmdc:mga0rr50_42451_c1 3300050513 Unclassified 3321
457 nmdc:mga0a205_18434_c2 3300050515 Unclassified 4783
458 Ga0500635_0000359 3300053080 Bacteria 14508
459 Ga0495619_0041653 3300053085 Bacteria 3005
460 Ga0500643_010277 3300053087 Bacteria 3496
461 Ga0500644_0000346 3300053088 Bacteria 23379
462 Ga0500555_000544 3300053103 Bacteria 15062
463 Ga0500556_0011096 3300053104 Bacteria 2661
464 Ga0500562_000004 3300053108 Bacteria 270087
465 Ga0500595_017875 3300053119 Unclassified 2605
466 Ga0500568_0011985 3300053139 Bacteria 4000
467 Ga0500588_0007869 3300053146 Bacteria 2470
468 Ga0500616_0000065 3300053153 Bacteria 239287
469 Ga0500622_0001020 3300053156 Bacteria 23524
470 Ga0500622_0003041 3300053156 Bacteria 11586
471 Ga0500622_0049722 3300053156 Bacteria 2161
472 Ga0500645_000041 3300053730 Bacteria 110646
473 Ga0530510_0091791 3300061734 Bacteria 2216
474 2739647256 2739367663 Bacteria 5040914
475 2788436183 2786546940 Bacteria 6396474
476 2842903793 2842903701 Bacteria 6986368
477 2849286809 2849281842 Bacteria 6065644
478 2852624322 2852623160 Bacteria 4376875
479 2884216745 2884215851 Bacteria 4554841
480 2884936730 2884933994 Bacteria 4535041
481 2920108507 2920107658 Bacteria 10042636
482 2929241202 2929239360 Bacteria 7745570
483 2939672930 2939669807 Bacteria 5028511
484 Ga0207695_10203282
485 JGI24737J22298_10000269
486 rootH2_10022676
487 rootH2_10049625
488 rootH2_10236183
489 rootL2_10074723
490 rootL2_10222397
491 Ga0070658_10005481
492 Ga0070658_10006618
493 Ga0070658_10155117
494 Ga0070683_100048588
495 Ga0070683_100063438
496 Ga0070683_100256821
497 Ga0070670_100024714
498 Ga0070670_100028619
499 Ga0068869_100000451
500 Ga0068869_100005335
501 Ga0068869_100062776
502 Ga0070666_10007189
503 Ga0070666_10024463
504 Ga0070666_10034087
505 Ga0070666_10076239
506 Ga0070680_100117487
507 Ga0068868_100008163
508 Ga0068868_100045627
509 Ga0068868_100075646
510 Ga0070660_100020747
511 Ga0070689_100060215
512 Ga0070661_100003990
513 Ga0070675_100056454
514 Ga0070671_100163332
515 Ga0070674_100174934
516 Ga0070673_100143635
517 Ga0070688_100055002
518 Ga0070667_100028613
519 Ga0070667_100168863
520 Ga0070703_10010637
521 Ga0070714_100015832
522 Ga0070714_100060994
523 Ga0070713_100000214
524 Ga0070711_100000284
525 Ga0070678_100017243
526 Ga0070681_10018801
527 Ga0070681_10054187
528 Ga0070681_10088022
529 Ga0070685_10007443
530 Ga0070706_100019305
531 Ga0070706_100032105
532 Ga0070706_100040523
533 Ga0070706_100120305
534 Ga0070707_100013654
535 Ga0070698_100017907
536 Ga0070679_100002609
537 Ga0070679_100028265
538 Ga0070679_100054113
539 Ga0070684_100005920
540 Ga0070684_100232664
541 Ga0068853_100000473
542 Ga0068853_100073101
543 Ga0068853_100184142
544 Ga0070686_100026969
545 Ga0070665_100005204
546 Ga0070665_100026484
547 Ga0070665_100037561
548 Ga0070665_100120744
549 Ga0070704_100053417
550 Ga0068855_100002379
551 Ga0068855_100006229
552 Ga0068855_100160592
553 Ga0068855_100247526
554 Ga0068857_100005875
555 Ga0068854_100053480
556 Ga0068856_100000089
557 Ga0068856_100001610
558 Ga0068856_100001782
559 Ga0068856_100020318
560 Ga0068856_100037972
561 Ga0068856_100095421
562 Ga0068852_100000102
563 Ga0068852_100000564
564 Ga0068852_100004982
565 Ga0068852_100053317
566 Ga0068852_100108614
567 Ga0068859_100024248
568 Ga0068864_100020452
569 Ga0068866_10070920
570 Ga0068851_10013784
571 Ga0068851_10064059
572 Ga0068863_100027775
573 Ga0068863_100050608
574 Ga0068858_100012459
575 Ga0068858_100016903
576 Ga0068858_100026973
577 Ga0068858_100047714
578 Ga0068858_100144898
579 Ga0068860_100008840
580 Ga0068862_100069710
581 Ga0081540_1002888
582 Ga0081540_1047195
583 Ga0081539_10009601
584 Ga0070717_10003716
585 Ga0070717_10010422
586 Ga0070715_10011264
587 Ga0070712_100000116
588 Ga0070712_100039257
589 Ga0097621_100001393
590 Ga0097621_100014784
591 Ga0068871_100002310
592 Ga0068871_100008596
593 Ga0068871_100035076
594 Ga0075428_100012007
595 Ga0075433_10020433
596 Ga0075433_10053609
597 Ga0075434_100000284
598 Ga0068865_100000399
599 Ga0075436_100052428
600 Ga0097620_100024249
601 Ga0075435_100043130
602 Ga0105240_10000200
603 Ga0105240_10000516
604 Ga0105240_10000590
605 Ga0105240_10001657
606 Ga0105240_10003580
607 Ga0105240_10004449
608 Ga0105240_10012915
609 Ga0105240_10028669
610 Ga0105240_10044309
611 Ga0105240_10049057
612 Ga0105240_10063725
613 Ga0105240_10156074
614 Ga0105240_10200877
615 Ga0111539_10005359
616 Ga0105245_10002432
617 Ga0105245_10005548
618 Ga0105245_10031474
619 Ga0105245_10052549
620 Ga0105247_10096632
621 Ga0114129_10033887
622 Ga0114129_10297294
623 Ga0105241_10000417
624 Ga0105241_10000830
625 Ga0105241_10000978
626 Ga0105241_10029951
627 Ga0105241_10034111
628 Ga0105241_10207352
629 Ga0105241_10221582
630 Ga0105248_10000019
631 Ga0105248_10001540
632 Ga0105248_10035559
633 Ga0105248_10094510
634 Ga0105248_10293274
635 Ga0105237_10000424
636 Ga0105237_10002310
637 Ga0105237_10002403
638 Ga0105237_10003110
639 Ga0105237_10004134
640 Ga0105237_10007892
641 Ga0105237_10021154
642 Ga0105237_10025407
643 Ga0105237_10043623
644 Ga0105238_10000049
645 Ga0105238_10001199
646 Ga0105238_10002863
647 Ga0105238_10013188
648 Ga0105238_10022241
649 Ga0105238_10025351
650 Ga0105238_10032639
651 Ga0105238_10200869
652 Ga0105249_10066556
653 Ga0105239_10000934
654 Ga0105239_10002510
655 Ga0105239_10002514
656 Ga0105239_10002939
657 Ga0105239_10005414
658 Ga0105239_10005627
659 Ga0105239_10030039
660 Ga0105239_10159276
661 Ga0105246_10000204
662 Ga0157373_10022845
663 Ga0157370_10000174
664 Ga0157370_10011724
665 Ga0157370_10076660
666 Ga0157370_10259337
667 Ga0157369_10000262
668 Ga0157369_10000275
669 Ga0157369_10035675
670 Ga0157374_10002433
671 Ga0157374_10285634
672 Ga0157378_10002618
673 Ga0157378_10005891
674 Ga0157378_10039357
675 Ga0157378_10045563
676 Ga0157378_10051654
677 Ga0157378_10051734
678 Ga0157378_10146842
679 Ga0163162_10014724
680 Ga0163162_10053743
681 Ga0163162_10104886
682 Ga0157372_10000288
683 Ga0157372_10000355
684 Ga0157372_10000531
685 Ga0157372_10002814
686 Ga0157372_10010197
687 Ga0157372_10028099
688 Ga0157372_10033039
689 Ga0157372_10065495
690 Ga0157372_10319371
691 Ga0157375_10002176
692 Ga0157375_10007207
693 Ga0157375_10025834
694 Ga0163163_10034208
695 Ga0163163_10269554
696 Ga0157379_10010757
697 Ga0157379_10024411
698 Ga0157379_10026049
699 Ga0157376_10001196
700 Ga0157376_10001303
701 Ga0157376_10006406
702 Ga0157376_10070919
703 Ga0157376_10073231
704 Ga0183373_1001
705 Ga0163161_10000284
706 Ga0163161_10037188
707 Ga0163161_10082681
708 Ga0213872_10002897
709 Ga0213874_10005942
710 Ga0213876_10000996
711 Ga0213871_10019285
712 Ga0209233_1011517
713 Ga0209050_1001379
714 Ga0207656_10032955
715 Ga0207656_10037833
716 Ga0207642_10058999
717 Ga0207680_10039274
718 Ga0207647_10021280
719 Ga0207647_10022642
720 Ga0207647_10033644
721 Ga0207645_10005758
722 Ga0207643_10059726
723 Ga0207705_10083666
724 Ga0207684_10005511
725 Ga0207684_10016821
726 Ga0207654_10000011
727 Ga0207654_10000219
728 Ga0207654_10005238
729 Ga0207654_10005900
730 Ga0207654_10006577
731 Ga0207707_10001926
732 Ga0207695_10000055
733 Ga0207695_10000150
734 Ga0207695_10000154
735 Ga0207695_10000161
736 Ga0207695_10000184
737 Ga0207695_10000224
738 Ga0207695_10003196
739 Ga0207695_10004661
740 Ga0207695_10010488
741 Ga0207695_10011663
742 Ga0207695_10015716
743 Ga0207695_10019390
744 Ga0207695_10109305
745 Ga0207671_10000105
746 Ga0207671_10000297
747 Ga0207671_10000917
748 Ga0207671_10003215
749 Ga0207671_10062108
750 Ga0207671_10096647
751 Ga0207671_10110896
752 Ga0207693_10000225
753 Ga0207693_10039264
754 Ga0207663_10000532
755 Ga0207660_10031140
756 Ga0207662_10030143
757 Ga0207657_10013529
758 Ga0207652_10000016
759 Ga0207652_10006027
760 Ga0207652_10019774
761 Ga0207646_10007430
762 Ga0207694_10000009
763 Ga0207694_10004078
764 Ga0207694_10004766
765 Ga0207694_10030431
766 Ga0207694_10121163
767 Ga0207650_10122369
768 Ga0207687_10016886
769 Ga0207700_10000742
770 Ga0207664_10039615
771 Ga0207644_10032856
772 Ga0207706_10014604
773 Ga0207709_10041927
774 Ga0207704_10000235
775 Ga0207665_10113977
776 Ga0207691_10035833
777 Ga0207691_10043572
778 Ga0207711_10004499
779 Ga0207711_10099797
780 Ga0207689_10000218
781 Ga0207689_10000543
782 Ga0207689_10017423
783 Ga0207661_10022501
784 Ga0207661_10023959
785 Ga0207679_10038809
786 Ga0207667_10001371
787 Ga0207667_10003240
788 Ga0207667_10003546
789 Ga0207667_10006075
790 Ga0207667_10029369
791 Ga0207667_10032923
792 Ga0207667_10224553
793 Ga0207667_10265812
794 Ga0207651_10032345
795 Ga0207640_10184635
796 Ga0207658_10031802
797 Ga0207677_10023745
798 Ga0207677_10024901
799 Ga0207703_10010434
800 Ga0207639_10000192
801 Ga0207639_10006136
802 Ga0207708_10010112
803 Ga0207702_10002643
804 Ga0207702_10003197
805 Ga0207702_10063365
806 Ga0207702_10112819
807 Ga0207702_10176239
808 Ga0207641_10002830
809 Ga0207641_10025437
810 Ga0207648_10182674
811 Ga0207674_10000871
812 Ga0207675_100153620
813 Ga0207683_10003877
814 Ga0207683_10095915
815 Ga0207698_10000082
816 Ga0207698_10000419
817 Ga0207698_10001721
818 Ga0207698_10065088
819 Ga0268266_10002316
820 Ga0268266_10006961
821 Ga0268265_10120475
822 Ga0268264_10009933
823 Ga0268264_10012285
824 Ga0265326_10008796
825 Ga0307517_10024206
826 Ga0307515_10000190
827 Ga0307515_10002489
828 Ga0265338_10000009
829 Ga0265338_10000574
830 Ga0265338_10000660
831 Ga0265338_10000828
832 Ga0265338_10002256
833 Ga0265338_10015931
834 Ga0265338_10034487
835 Ga0265338_10078869
836 Ga0265338_10105348
837 Ga0265324_10000436
838 Ga0265324_10015144
839 Ga0307511_10000033
840 Ga0316177_1079363
841 Ga0316176_1177032
842 Ga0316183_1180191
843 Ga0265760_10006439
844 Ga0265325_10011503
845 Ga0265339_10018431
846 Ga0265339_10032940
847 Ga0265339_10048802
848 Ga0307513_10036470
849 Ga0265313_10002742
850 Ga0307508_10000081
851 Ga0307508_10000220
852 Ga0307514_10065485
853 Ga0307516_10046845
854 Ga0307510_10011916
855 Ga0373934_0015156
856 Ga0373954_0001923
857 Ga0373933_0001836
858 Ga0373937_0000307
859 Ga0373937_0002701
860 Ga0395898_0220416
861 Ga0436364_0904747
862 Ga0436365_0054332
863 Ga0436360_1093311
864 Ga0436361_0219983
865 Ga0436361_0437720
866 Ga0436363_0035178
867 Ga0436363_0865618
868 Ga0436363_1602297
869 Ga0451577_0042169
870 Ga0451577_0054721
871 Ga0451577_0080281
872 Ga0451577_0121602
873 Ga0466972_0002998
874 Ga0453683_0034237
875 Ga0466966_0072204
876 Ga0466961_0013422
877 Ga0466963_0033627
878 Ga0453684_0074533
879 Ga0466968_0017304
880 Ga0466970_0032149
881 Ga0466959_0016595
882 Ga0466959_0033675
883 Ga0451576_0101586
884 Ga0451576_0352711
885 Ga0466967_0002436
886 Ga0466967_0074982
887 Ga0495638_0000006
888 Ga0495651_0034477
889 Ga0495650_0000010
890 Ga0495580_0000421
891 Ga0495607_0008380
892 Ga0495587_0003653
893 Ga0495668_0003868
894 Ga0495611_0000038
895 Ga0495625_0000182
896 Ga0495625_0045154
897 Ga0495661_0026469
898 Ga0495646_0001296
899 Ga0495613_0004114
900 Ga0495604_0001224
901 Ga0495674_0020476
902 Ga0495674_0220737
903 Ga0495672_0007709
904 Ga0495672_0047601
905 Ga0495602_0001345
906 Ga0495602_0089924
907 Ga0496102_0056518
908 Ga0496105_0039009
909 Ga0496106_0102049
910 Ga0496109_0136591
911 Ga0496115_0037508
912 Ga0496115_0084378
913 Ga0496115_0087569
914 Ga0501031_0000246
915 Ga0501032_0000376
916 Ga0501032_0002858
917 Ga0501032_0035563
918 Ga0501033_0000255
919 Ga0501033_0005873
920 Ga0501034_0185298
921 Ga0501043_0008662
922 Ga0501046_0000498
923 Ga0501046_0005911
924 Ga0501046_0015990
925 Ga0501047_0055756
926 Ga0501080_0123249
927 Ga0501035_0001483
928 Ga0501035_0004068
929 Ga0501035_0010698
930 Ga0501044_0000127
931 Ga0501044_0000202
932 Ga0501044_0080983
933 Ga0501044_0086867
934 nmdc:mga05p37_100657_c1
935 nmdc:mga05p37_222826_c1
936 nmdc:mga08y16_136893_c1
937 nmdc:mga0n895_1292_c1
938 nmdc:mga0n895_331326_c1
939 nmdc:mga0rr50_42451_c1
940 nmdc:mga0a205_18434_c2
941 Ga0500635_0000359
942 Ga0495619_0041653
943 Ga0500643_010277
944 Ga0500644_0000346
945 Ga0500555_000544
946 Ga0500556_0011096
947 Ga0500562_000004
948 Ga0500595_017875
949 Ga0500568_0011985
950 Ga0500588_0007869
951 Ga0500616_0000065
952 Ga0500622_0001020
953 Ga0500622_0003041
954 Ga0500622_0049722
955 Ga0500645_000041
956 Ga0530510_0091791
957 2739647256
958 2788436183
959 2842903793
960 2849286809
961 2852624322
962 2884216745
963 2884936730
964 2920108507
965 2929241202
966 2939672930

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11762

Arabinose_Iso_C

L-arabinose isomerase C-terminal domain

365

505

0.95

PF02952

Fucose_iso_C

L-fucose isomerase, C-terminal domain

396

509

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
7cyy-assembly1.cif.gz_E crystal structure of arabinose isomerase from hybrid ai8 with adonitol 0.9039 17 486
7ch3-assembly1.cif.gz_F crystal structure of arabinose isomerase from hyper thermophilic bacterium thermotoga maritima (tmai) triple mutant (k264a, e265a, k266a) 0.8959 17 486
7cx7-assembly1.cif.gz_F-2 crystal structure of arabinose isomerase from hybrid ai8 0.8941 18 486
7chl-assembly1.cif.gz_D crystal structure of hybrid arabinose isomerase ai-10 0.8936 17 486
7cxo-assembly1.cif.gz_C crystal structure of arabinose isomerase from hybrid ai10 0.8925 17 486
ID Description Score Start End Superfamily
4lqlD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8235 18 190 3.40.50.10940
4f2dC01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.7935 18 186 3.40.50.10940
1fuiF03 Alpha Beta;Alpha-Beta Barrel;L-fucose Isomerase; Chain A, domain 3;L-fucose/L-arabinose isomerase, C-terminal 0.7924 330 486 3.20.14.10
4lqlD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.7769 18 190 3.40.50.10940
af_P02924_26_131_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.7401 18 114 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A7V4IFZ3-F1-model_v4 Arabinose isomerase 0.9924 16 486 GO:0005829
GO:0008733
GO:0019569
GO:0046872
AF-A0A519XS50-F1-model_v4 Arabinose isomerase 0.9921 24 389 GO:0005829
GO:0008733
GO:0019569
GO:0046872
AF-Q28MP9-F1-model_v4 L-arabinose isomerase protein 0.9913 15 488 GO:0005829
GO:0008733
GO:0019569
GO:0046872
AF-A0A1V5J954-F1-model_v4 L-arabinose isomerase 0.9905 170 488 GO:0005829
GO:0008733
GO:0019569
GO:0046872
AF-A0A645JF31-F1-model_v4 L-arabinose isomerase 0.9881 334 488 GO:0005829
GO:0008733
GO:0019569

Map