F452751

General Info

Members Datasets Scaffolds Average Seq Length
483 238 966 199

Family's Representative Sequence

Representative Sequence 3300006846|Ga0075430_100023886|Ga0075430_1000238863
Length 229
Sequence MSGKLKDRNDFEPGPRQPSHQFPPVAQHSSDSSVLTDMAAVAMLEWDSELMLRVRAGDQASFSLLLERHRSPVIHFLYRMVQNQPVAEELAQEVFLRVYRSRETYEPTAKFTTWLFRIATHLALNWIRDNRNTRQQESLDEEIVDGAARQVSDRRPSVEQCMVREARMAEIRQAIESLPAKQRAAVLMHKYEELEYSQIARILECSESAVKSLLFRAYETLRLRLAHFA

Samples

Sample ID Description Type Environment
1 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
48 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
49 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
50 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
76 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
79 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
81 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
83 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
84 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
127 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
128 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
129 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
130 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
131 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
132 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
133 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
134 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
135 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
136 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
137 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
138 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
139 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
140 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
141 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
142 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
143 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
144 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
145 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
146 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
147 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
148 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
149 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
150 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
151 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
152 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
153 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
154 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
155 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
156 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
157 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
158 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
159 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
160 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
161 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
162 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
163 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
164 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
165 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
166 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
167 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
168 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
169 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
170 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
171 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
172 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
173 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
174 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
175 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
176 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
177 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
178 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
179 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
180 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
181 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
182 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
183 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
184 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
185 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
186 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
187 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
188 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
189 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
190 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
191 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
192 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
193 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
194 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
195 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
196 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
197 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
198 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
199 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
200 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
201 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
202 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
216 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
217 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
218 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
219 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
220 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
221 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
222 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
223 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
224 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
225 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
226 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
229 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
230 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
231 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
232 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
233 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
234 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
235 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
236 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
237 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
238 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.14
Metatranscriptomes 1.86
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.41
Rhizosphere 97.93
Stem 0
Stem Tuber 0
Unclassified 34.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075430_100023886 3300006846 Bacteria 5206
2 Ga0065707_10328412 3300005295 Unclassified 954
3 Ga0070658_10028752 3300005327 Bacteria 4464
4 Ga0070658_10036329 3300005327 Bacteria 3971
5 Ga0070658_10564560 3300005327 Bacteria 985
6 Ga0070676_10555852 3300005328 Bacteria 822
7 Ga0070683_100190853 3300005329 Unclassified 1945
8 Ga0070670_100353245 3300005331 Bacteria 1292
9 Ga0068869_100106103 3300005334 Bacteria 2131
10 Ga0070666_10510408 3300005335 Unclassified 872
11 Ga0070680_100025899 3300005336 Bacteria 4690
12 Ga0070680_100462204 3300005336 Unclassified 1084
13 Ga0070682_100786178 3300005337 Unclassified 772
14 Ga0068868_100240423 3300005338 Bacteria 1521
15 Ga0070689_100201776 3300005340 Bacteria 1624
16 Ga0070671_100140993 3300005355 Bacteria 2034
17 Ga0070673_100389951 3300005364 Bacteria 1243
18 Ga0070667_100735887 3300005367 Unclassified 914
19 Ga0070709_10334327 3300005434 Bacteria 1115
20 Ga0070714_100000699 3300005435 Bacteria 23768
21 Ga0070714_100063013 3300005435 Bacteria 3187
22 Ga0070714_100325584 3300005435 Bacteria 1438
23 Ga0070714_100531583 3300005435 Unclassified 1124
24 Ga0070714_101073640 3300005435 Unclassified 784
25 Ga0070713_100351361 3300005436 Bacteria 1368
26 Ga0070713_100471085 3300005436 Unclassified 1182
27 Ga0070711_100002951 3300005439 Bacteria 9810
28 Ga0070705_100217830 3300005440 Bacteria 1320
29 Ga0070700_100633324 3300005441 Bacteria 842
30 Ga0070708_100387310 3300005445 Bacteria 1318
31 Ga0070708_100501784 3300005445 Bacteria 1145
32 Ga0070681_10001713 3300005458 Bacteria 19631
33 Ga0070681_10361450 3300005458 Bacteria 1362
34 Ga0070681_10388541 3300005458 Unclassified 1306
35 Ga0068867_100052292 3300005459 Bacteria 3014
36 Ga0068867_100368049 3300005459 Bacteria 1204
37 Ga0068867_100588097 3300005459 Unclassified 969
38 Ga0070706_100142764 3300005467 Bacteria 2235
39 Ga0070706_100333359 3300005467 Bacteria 1415
40 Ga0070706_100473136 3300005467 Unclassified 1166
41 Ga0070698_100252454 3300005471 Bacteria 1696
42 Ga0070698_101412879 3300005471 Bacteria 647
43 Ga0070699_100031563 3300005518 Bacteria 4573
44 Ga0070679_100081405 3300005530 Unclassified 3227
45 Ga0070679_100341201 3300005530 Bacteria 1446
46 Ga0070679_100437146 3300005530 Unclassified 1253
47 Ga0070684_100108092 3300005535 Bacteria 2492
48 Ga0070684_100220498 3300005535 Bacteria 1730
49 Ga0070684_100339082 3300005535 Unclassified 1382
50 Ga0070684_100435985 3300005535 Unclassified 1210
51 Ga0070684_100506106 3300005535 Bacteria 1119
52 Ga0070697_100071682 3300005536 Bacteria 2842
53 Ga0070697_100163560 3300005536 Bacteria 1881
54 Ga0068853_100445141 3300005539 Bacteria 1218
55 Ga0068853_100797364 3300005539 Bacteria 904
56 Ga0070695_100176060 3300005545 Bacteria 1512
57 Ga0070696_100001903 3300005546 Bacteria 13736
58 Ga0070665_100119153 3300005548 Unclassified 2642
59 Ga0070665_100122364 3300005548 Unclassified 2604
60 Ga0068855_100024889 3300005563 Bacteria 7163
61 Ga0068855_100100173 3300005563 Unclassified 3336
62 Ga0068855_100141854 3300005563 Unclassified 2738
63 Ga0070664_100841775 3300005564 Unclassified 859
64 Ga0070664_100955935 3300005564 Bacteria 804
65 Ga0068857_100575641 3300005577 Unclassified 1062
66 Ga0068857_100909513 3300005577 Unclassified 844
67 Ga0068856_100174233 3300005614 Bacteria 2164
68 Ga0068856_100178526 3300005614 Unclassified 2136
69 Ga0070702_100463539 3300005615 Bacteria 922
70 Ga0068852_100012886 3300005616 Bacteria 6374
71 Ga0068859_100012694 3300005617 Bacteria 8470
72 Ga0068864_100619530 3300005618 Bacteria 1052
73 Ga0068864_100729215 3300005618 Unclassified 970
74 Ga0068861_100088558 3300005719 Bacteria 2438
75 Ga0068863_100060379 3300005841 Bacteria 3586
76 Ga0068863_100820438 3300005841 Unclassified 928
77 Ga0068858_100292081 3300005842 Unclassified 1554
78 Ga0068858_100387381 3300005842 Bacteria 1342
79 Ga0068858_100944326 3300005842 Unclassified 844
80 Ga0068860_100033457 3300005843 Bacteria 4932
81 Ga0068860_100354785 3300005843 Bacteria 1444
82 Ga0068860_100577200 3300005843 Unclassified 1128
83 Ga0068860_100987968 3300005843 Unclassified 859
84 Ga0081540_1121104 3300005983 Bacteria 1085
85 Ga0081539_10045578 3300005985 Bacteria 2520
86 Ga0070717_10044068 3300006028 Bacteria 3643
87 Ga0070717_10126975 3300006028 Bacteria 2190
88 Ga0070717_10608986 3300006028 Bacteria 991
89 Ga0070717_10846897 3300006028 Unclassified 832
90 Ga0070717_10907260 3300006028 Unclassified 802
91 Ga0070712_100056900 3300006175 Unclassified 2745
92 Ga0097621_100219843 3300006237 Bacteria 1655
93 Ga0097621_100265473 3300006237 Unclassified 1507
94 Ga0097621_100728386 3300006237 Bacteria 915
95 Ga0097621_100737310 3300006237 Unclassified 909
96 Ga0068871_100509033 3300006358 Bacteria 1086
97 Ga0068871_100525967 3300006358 Unclassified 1069
98 Ga0068871_100833154 3300006358 Unclassified 852
99 Ga0068871_101429197 3300006358 Bacteria 652
100 Ga0075430_100046557 3300006846 Unclassified 3663
101 Ga0075431_100094907 3300006847 Unclassified 3079
102 Ga0075431_100491924 3300006847 Unclassified 1218
103 Ga0075429_100364452 3300006880 Unclassified 1265
104 Ga0068865_100024920 3300006881 Bacteria 3929
105 Ga0075436_100001863 3300006914 Bacteria 14472
106 Ga0075436_100614850 3300006914 Unclassified 801
107 Ga0097620_100012694 3300006931 Bacteria 8470
108 Ga0097620_101146378 3300006931 Bacteria 856
109 Ga0105240_10002535 3300009093 Bacteria 29306
110 Ga0105240_10006661 3300009093 Bacteria 16936
111 Ga0105240_10023287 3300009093 Bacteria 8196
112 Ga0105240_10210370 3300009093 Unclassified 2273
113 Ga0105240_10279143 3300009093 Bacteria 1920
114 Ga0105240_10354677 3300009093 Bacteria 1663
115 Ga0105240_10585762 3300009093 Bacteria 1230
116 Ga0105245_10404947 3300009098 Bacteria 1364
117 Ga0105245_11795258 3300009098 Unclassified 666
118 Ga0105247_10278209 3300009101 Bacteria 1154
119 Ga0114129_10037402 3300009147 Bacteria 6853
120 Ga0114129_10317920 3300009147 Unclassified 2070
121 Ga0114129_10571406 3300009147 Unclassified 1468
122 Ga0105243_10365692 3300009148 Bacteria 1329
123 Ga0105243_11213794 3300009148 Bacteria 768
124 Ga0105242_10056826 3300009176 Unclassified 3202
125 Ga0105242_10732637 3300009176 Unclassified 971
126 Ga0105242_11267322 3300009176 Bacteria 759
127 Ga0105248_10033117 3300009177 Bacteria 5772
128 Ga0105248_10160574 3300009177 Bacteria 2535
129 Ga0105248_10389102 3300009177 Unclassified 1570
130 Ga0105248_10418099 3300009177 Bacteria 1510
131 Ga0105248_10585556 3300009177 Bacteria 1259
132 Ga0105248_10609005 3300009177 Unclassified 1232
133 Ga0105248_10707036 3300009177 Unclassified 1137
134 Ga0105248_10927973 3300009177 Unclassified 983
135 Ga0105248_11055329 3300009177 Unclassified 918
136 Ga0105248_11347935 3300009177 Bacteria 807
137 Ga0105237_10015646 3300009545 Bacteria 7886
138 Ga0105237_10024913 3300009545 Bacteria 6120
139 Ga0105237_10060308 3300009545 Bacteria 3795
140 Ga0105237_10070671 3300009545 Unclassified 3486
141 Ga0105237_10750472 3300009545 Unclassified 982
142 Ga0105238_10070452 3300009551 Unclassified 3495
143 Ga0105238_10092606 3300009551 Bacteria 3010
144 Ga0105238_10150669 3300009551 Bacteria 2301
145 Ga0105238_10187116 3300009551 Unclassified 2047
146 Ga0105238_10208360 3300009551 Unclassified 1931
147 Ga0105238_10233146 3300009551 Bacteria 1817
148 Ga0105238_10389615 3300009551 Bacteria 1385
149 Ga0105238_11593506 3300009551 Bacteria 683
150 Ga0105238_11773742 3300009551 Unclassified 649
151 Ga0105239_10194067 3300010375 Unclassified 2273
152 Ga0157370_10014478 3300013104 Bacteria 8063
153 Ga0157369_10044199 3300013105 Bacteria 4850
154 Ga0157369_10088744 3300013105 Bacteria 3301
155 Ga0157369_10284678 3300013105 Bacteria 1721
156 Ga0157369_10798752 3300013105 Unclassified 970
157 Ga0157369_11538702 3300013105 Bacteria 676
158 Ga0157374_10176239 3300013296 Unclassified 2087
159 Ga0157374_10336672 3300013296 Bacteria 1497
160 Ga0157374_10612342 3300013296 Unclassified 1099
161 Ga0157374_10642869 3300013296 Bacteria 1072
162 Ga0157378_10540615 3300013297 Bacteria 1169
163 Ga0157378_10842375 3300013297 Unclassified 945
164 Ga0157378_10934813 3300013297 Bacteria 899
165 Ga0163162_10712292 3300013306 Archaea 1125
166 Ga0163162_10848428 3300013306 Bacteria 1029
167 Ga0163162_11202955 3300013306 Unclassified 860
168 Ga0157372_10084676 3300013307 Bacteria 3594
169 Ga0157372_10087996 3300013307 Bacteria 3526
170 Ga0157372_10183055 3300013307 Bacteria 2425
171 Ga0157372_10430992 3300013307 Bacteria 1537
172 Ga0157372_10518773 3300013307 Bacteria 1389
173 Ga0163163_10137059 3300014325 Bacteria 2489
174 Ga0163163_10151029 3300014325 Bacteria 2366
175 Ga0163163_10166050 3300014325 Bacteria 2254
176 Ga0163163_10265255 3300014325 Unclassified 1768
177 Ga0163163_10460054 3300014325 Bacteria 1333
178 Ga0163163_10706546 3300014325 Bacteria 1072
179 Ga0163163_10968094 3300014325 Unclassified 914
180 Ga0163163_11333448 3300014325 Unclassified 779
181 Ga0163163_11391276 3300014325 Bacteria 763
182 Ga0157380_10064139 3300014326 Bacteria 2948
183 Ga0157377_10899387 3300014745 Unclassified 662
184 Ga0157376_10003232 3300014969 Bacteria 11211
185 Ga0157376_11381573 3300014969 Bacteria 735
186 Ga0157376_11535575 3300014969 Unclassified 699
187 Ga0163161_10259142 3300017792 Bacteria 1358
188 Ga0206356_11354221 3300020070 Bacteria 1112
189 Ga0206355_1359470 3300020076 Bacteria 2780
190 Ga0206355_1717628 3300020076 Bacteria 1129
191 Ga0206354_11172972 3300020081 Bacteria 1165
192 Ga0213876_10004741 3300021384 Bacteria 7558
193 Ga0213875_10086837 3300021388 Bacteria 1459
194 Ga0224712_10070896 3300022467 Unclassified 1415
195 Ga0207710_10127478 3300025900 Bacteria 1220
196 Ga0207699_10470498 3300025906 Bacteria 904
197 Ga0207645_10334590 3300025907 Bacteria 1012
198 Ga0207705_10078824 3300025909 Unclassified 2398
199 Ga0207705_10101019 3300025909 Bacteria 2121
200 Ga0207684_10234366 3300025910 Bacteria 1584
201 Ga0207684_10256463 3300025910 Bacteria 1509
202 Ga0207684_10382132 3300025910 Bacteria 1211
203 Ga0207707_10020971 3300025912 Bacteria 5708
204 Ga0207707_10033268 3300025912 Bacteria 4513
205 Ga0207707_10351426 3300025912 Unclassified 1270
206 Ga0207695_10060975 3300025913 Bacteria 3901
207 Ga0207695_10161157 3300025913 Unclassified 2175
208 Ga0207695_10165144 3300025913 Bacteria 2143
209 Ga0207695_10295246 3300025913 Unclassified 1512
210 Ga0207695_10323708 3300025913 Bacteria 1431
211 Ga0207671_10015068 3300025914 Bacteria 6076
212 Ga0207671_10016608 3300025914 Bacteria 5716
213 Ga0207671_10115107 3300025914 Bacteria 2050
214 Ga0207671_10859794 3300025914 Unclassified 718
215 Ga0207693_10047613 3300025915 Bacteria 3368
216 Ga0207663_10012087 3300025916 Bacteria 4656
217 Ga0207660_10020762 3300025917 Bacteria 4413
218 Ga0207649_10105814 3300025920 Unclassified 1870
219 Ga0207652_10265655 3300025921 Bacteria 1548
220 Ga0207652_10297466 3300025921 Bacteria 1457
221 Ga0207694_10047118 3300025924 Unclassified 3333
222 Ga0207694_10113080 3300025924 Bacteria 2161
223 Ga0207694_10279997 3300025924 Bacteria 1370
224 Ga0207694_10339952 3300025924 Unclassified 1241
225 Ga0207650_10383935 3300025925 Bacteria 1160
226 Ga0207700_10003927 3300025928 Bacteria 8686
227 Ga0207700_10314857 3300025928 Bacteria 1355
228 Ga0207700_10875623 3300025928 Unclassified 804
229 Ga0207664_10001251 3300025929 Bacteria 16774
230 Ga0207664_10128569 3300025929 Bacteria 2130
231 Ga0207644_10083830 3300025931 Bacteria 2362
232 Ga0207686_10089372 3300025934 Unclassified 2030
233 Ga0207670_10407034 3300025936 Bacteria 1089
234 Ga0207670_10590990 3300025936 Bacteria 911
235 Ga0207704_10068787 3300025938 Bacteria 2234
236 Ga0207704_10137517 3300025938 Bacteria 1703
237 Ga0207665_10724667 3300025939 Unclassified 783
238 Ga0207711_10024490 3300025941 Bacteria 5059
239 Ga0207711_10073747 3300025941 Unclassified 2967
240 Ga0207711_10262077 3300025941 Bacteria 1589
241 Ga0207711_10309244 3300025941 Unclassified 1459
242 Ga0207711_10471859 3300025941 Unclassified 1169
243 Ga0207711_10578159 3300025941 Unclassified 1048
244 Ga0207711_10682931 3300025941 Unclassified 958
245 Ga0207711_10948503 3300025941 Unclassified 799
246 Ga0207661_10021703 3300025944 Bacteria 4816
247 Ga0207661_10027987 3300025944 Bacteria 4312
248 Ga0207661_10062323 3300025944 Unclassified 3017
249 Ga0207679_10827348 3300025945 Unclassified 845
250 Ga0207667_10026692 3300025949 Bacteria 6304
251 Ga0207667_10036316 3300025949 Bacteria 5282
252 Ga0207667_10063580 3300025949 Bacteria 3856
253 Ga0207651_10277117 3300025960 Bacteria 1384
254 Ga0207651_10652898 3300025960 Unclassified 924
255 Ga0207712_10498902 3300025961 Unclassified 1040
256 Ga0207677_10276870 3300026023 Bacteria 1375
257 Ga0207639_10112245 3300026041 Bacteria 2224
258 Ga0207708_10569966 3300026075 Bacteria 956
259 Ga0207702_10151634 3300026078 Bacteria 2109
260 Ga0207641_10012834 3300026088 Bacteria 6869
261 Ga0207641_10093341 3300026088 Bacteria 2638
262 Ga0207641_10561285 3300026088 Bacteria 1114
263 Ga0207648_10093851 3300026089 Bacteria 2624
264 Ga0207648_10593473 3300026089 Bacteria 1020
265 Ga0207674_10804413 3300026116 Unclassified 907
266 Ga0207675_100636488 3300026118 Bacteria 1072
267 Ga0207683_10527610 3300026121 Bacteria 1091
268 Ga0207698_10057364 3300026142 Bacteria 3012
269 Ga0268266_10084253 3300028379 Unclassified 2776
270 Ga0268266_10104699 3300028379 Bacteria 2499
271 Ga0268266_10461852 3300028379 Unclassified 1208
272 Ga0268265_10380020 3300028380 Bacteria 1299
273 Ga0268264_10029421 3300028381 Bacteria 4498
274 Ga0268264_10734499 3300028381 Bacteria 983
275 Ga0268264_11129605 3300028381 Unclassified 792
276 Ga0265323_10001449 3300028653 Bacteria 11642
277 Ga0265336_10020948 3300028666 Bacteria 2093
278 Ga0265338_10080092 3300028800 Bacteria 2745
279 Ga0265762_1048931 3300030760 Unclassified 844
280 Ga0265762_1055306 3300030760 Unclassified 805
281 Ga0265760_10067752 3300031090 Unclassified 1092
282 Ga0265760_10095191 3300031090 Unclassified 936
283 Ga0265330_10017570 3300031235 Bacteria 3292
284 Ga0265332_10049890 3300031238 Bacteria 1799
285 Ga0265328_10056296 3300031239 Bacteria 1443
286 Ga0265320_10012674 3300031240 Bacteria 4890
287 Ga0265325_10000615 3300031241 Bacteria 25980
288 Ga0265329_10012258 3300031242 Bacteria 3086
289 Ga0265340_10023080 3300031247 Bacteria 3174
290 Ga0265340_10059210 3300031247 Bacteria 1838
291 Ga0265331_10015023 3300031250 Bacteria 4102
292 Ga0265331_10045376 3300031250 Unclassified 2122
293 Ga0265316_10002140 3300031344 Bacteria 20772
294 Ga0265316_10020430 3300031344 Bacteria 5635
295 Ga0265316_10023659 3300031344 Bacteria 5157
296 Ga0265316_10031727 3300031344 Bacteria 4317
297 Ga0265316_10059706 3300031344 Bacteria 2965
298 Ga0265316_10119476 3300031344 Bacteria 1991
299 Ga0265316_10455265 3300031344 Bacteria 917
300 Ga0265316_10574984 3300031344 Bacteria 800
301 Ga0265314_10014059 3300031711 Bacteria 6429
302 Ga0265314_10045062 3300031711 Bacteria 3121
303 Ga0265342_10071230 3300031712 Unclassified 2026
304 Ga0265342_10189739 3300031712 Unclassified 1122
305 Ga0373926_0006844 3300035083 Bacteria 3791
306 Ga0373934_0025113 3300035086 Bacteria 2306
307 Ga0373934_0122565 3300035086 Bacteria 1058
308 Ga0373923_0146424 3300035111 Unclassified 1070
309 Ga0373923_0331996 3300035111 Unclassified 723
310 Ga0373945_0221729 3300035116 Unclassified 791
311 Ga0373954_0003818 3300035118 Bacteria 6438
312 Ga0373954_0095674 3300035118 Bacteria 1430
313 Ga0373954_0130173 3300035118 Unclassified 1225
314 Ga0373954_0247460 3300035118 Bacteria 877
315 Ga0373957_0041701 3300035120 Bacteria 1729
316 Ga0373943_0008691 3300035170 Bacteria 4554
317 Ga0373946_0241672 3300035171 Bacteria 878
318 Ga0373955_0111457 3300035172 Bacteria 1582
319 Ga0373935_0025691 3300035692 Bacteria 3630
320 Ga0373935_0253910 3300035692 Bacteria 1231
321 Ga0373927_0000718 3300035695 Bacteria 25341
322 Ga0373927_0002847 3300035695 Bacteria 12622
323 Ga0373927_0007946 3300035695 Bacteria 7162
324 Ga0373927_0117853 3300035695 Unclassified 1732
325 Ga0373927_0196570 3300035695 Unclassified 1323
326 Ga0373933_0086043 3300035724 Bacteria 1934
327 Ga0373947_0009613 3300035725 Bacteria 5550
328 Ga0373947_0217761 3300035725 Unclassified 1254
329 Ga0373937_0002395 3300036401 Bacteria 15605
330 Ga0373937_0169747 3300036401 Unclassified 2047
331 Ga0373937_0274939 3300036401 Unclassified 1590
332 Ga0373937_0440395 3300036401 Bacteria 1237
333 Ga0373937_0957725 3300036401 Unclassified 805
334 Ga0373925_0000045 3300037068 Bacteria 131371
335 Ga0373925_0130346 3300037068 Bacteria 1960
336 Ga0373925_0134775 3300037068 Unclassified 1929
337 Ga0373925_0191975 3300037068 Bacteria 1621
338 Ga0373925_0209193 3300037068 Unclassified 1554
339 Ga0373925_0246122 3300037068 Unclassified 1433
340 Ga0395898_0567480 3300037466 Unclassified 1077
341 Ga0436364_0544992 3300037853 Unclassified 2525
342 Ga0436364_0813769 3300037853 Bacteria 2496
343 Ga0436364_0950029 3300037853 Unclassified 977
344 Ga0436365_0039688 3300039437 Unclassified 891
345 Ga0436365_0671981 3300039437 Bacteria 14445
346 Ga0436361_0515496 3300039447 Bacteria 1043
347 Ga0436363_0739917 3300039450 Bacteria 14272
348 Ga0436362_0509964 3300039453 Bacteria 1483
349 Ga0451577_1251166 3300042876 Bacteria 661
350 Ga0466963_0326697 3300044694 Bacteria 1080
351 Ga0451576_0131017 3300045051 Bacteria 2614
352 Ga0451576_0630291 3300045051 Bacteria 1127
353 Ga0495592_0061520 3300046454 Unclassified 2759
354 Ga0495629_0098601 3300046459 Unclassified 2039
355 Ga0495629_0359323 3300046459 Unclassified 993
356 Ga0495651_0031585 3300046462 Bacteria 4129
357 Ga0495651_0285535 3300046462 Unclassified 1113
358 Ga0495651_0419674 3300046462 Unclassified 870
359 Ga0495653_0142345 3300046463 Unclassified 1685
360 Ga0495580_0002547 3300046472 Bacteria 15885
361 Ga0495580_0016165 3300046472 Bacteria 5608
362 Ga0495580_0092733 3300046472 Unclassified 2102
363 Ga0495580_0132944 3300046472 Unclassified 1725
364 Ga0495582_0224422 3300046473 Bacteria 1075
365 Ga0495582_0355176 3300046473 Unclassified 844
366 Ga0495662_0014296 3300046476 Bacteria 3861
367 Ga0495664_0003304 3300046477 Bacteria 8768
368 Ga0495664_0118292 3300046477 Bacteria 1602
369 Ga0495664_0292858 3300046477 Bacteria 983
370 Ga0495664_0366627 3300046477 Bacteria 867
371 Ga0495594_0070458 3300046499 Bacteria 1944
372 Ga0495608_0248505 3300046511 Bacteria 1109
373 Ga0495608_0285021 3300046511 Bacteria 1025
374 Ga0495608_0612170 3300046511 Unclassified 653
375 Ga0495628_0049947 3300046516 Bacteria 3310
376 Ga0495628_0106839 3300046516 Unclassified 2155
377 Ga0495630_0046372 3300046517 Unclassified 3249
378 Ga0495652_0030559 3300046529 Bacteria 4723
379 Ga0495652_0209877 3300046529 Bacteria 1471
380 Ga0495652_0224111 3300046529 Bacteria 1411
381 Ga0495652_0492552 3300046529 Unclassified 851
382 Ga0495665_0060369 3300046531 Unclassified 2002
383 Ga0495665_0070917 3300046531 Unclassified 1836
384 Ga0495665_0275285 3300046531 Bacteria 864
385 Ga0495640_0258509 3300046533 Bacteria 1089
386 Ga0495586_0202638 3300046535 Bacteria 1125
387 Ga0495587_0047319 3300046536 Bacteria 2551
388 Ga0495587_0066302 3300046536 Unclassified 2106
389 Ga0495645_0007051 3300046543 Bacteria 7819
390 Ga0495645_0083228 3300046543 Unclassified 2294
391 Ga0495645_0142375 3300046543 Bacteria 1672
392 Ga0495645_0168496 3300046543 Bacteria 1509
393 Ga0495645_0189249 3300046543 Bacteria 1404
394 Ga0495645_0374889 3300046543 Unclassified 912
395 Ga0495667_0166424 3300046559 Unclassified 1417
396 Ga0495667_0308270 3300046559 Bacteria 1002
397 Ga0495667_0362875 3300046559 Unclassified 914
398 Ga0495634_0072812 3300046642 Unclassified 2260
399 Ga0495635_0295486 3300046663 Bacteria 1086
400 Ga0495635_0435542 3300046663 Bacteria 868
401 Ga0495635_0488794 3300046663 Unclassified 811
402 Ga0495657_0074889 3300046675 Unclassified 2202
403 Ga0495657_0287466 3300046675 Unclassified 983
404 Ga0495599_0034531 3300046678 Bacteria 3177
405 Ga0495599_0615773 3300046678 Unclassified 631
406 Ga0495623_0032274 3300046679 Bacteria 3366
407 Ga0495623_0093701 3300046679 Unclassified 1838
408 Ga0495623_0128093 3300046679 Bacteria 1523
409 Ga0495646_0044703 3300046680 Unclassified 2708
410 Ga0495646_0485070 3300046680 Unclassified 636
411 Ga0495613_0054362 3300046689 Unclassified 2944
412 Ga0495613_0172006 3300046689 Bacteria 1537
413 Ga0495600_0013561 3300046809 Bacteria 5125
414 Ga0495600_0177259 3300046809 Unclassified 1374
415 Ga0495581_0274413 3300047315 Bacteria 986
416 Ga0495604_0068259 3300047317 Bacteria 2699
417 Ga0495604_0265174 3300047317 Bacteria 1166
418 Ga0495604_0289644 3300047317 Unclassified 1103
419 Ga0495674_0009769 3300047319 Bacteria 9112
420 Ga0495674_0033787 3300047319 Bacteria 4629
421 Ga0495674_0083642 3300047319 Unclassified 2735
422 Ga0495674_0493493 3300047319 Bacteria 980
423 Ga0495680_0338199 3300047322 Bacteria 1050
424 Ga0495675_0041618 3300047444 Bacteria 2928
425 Ga0495675_0064964 3300047444 Unclassified 2308
426 Ga0495675_0104789 3300047444 Bacteria 1768
427 Ga0495675_0167714 3300047444 Bacteria 1350
428 Ga0495675_0335115 3300047444 Unclassified 892
429 Ga0495684_0002407 3300047471 Bacteria 14922
430 Ga0495684_0043836 3300047471 Bacteria 3425
431 Ga0495684_0060712 3300047471 Bacteria 2877
432 Ga0495684_0149491 3300047471 Bacteria 1747
433 Ga0495602_0059238 3300048088 Unclassified 3344
434 Ga0495602_0114479 3300048088 Bacteria 2184
435 Ga0495602_0335665 3300048088 Bacteria 1095
436 Ga0496104_0701597 3300048907 Unclassified 920
437 Ga0496112_0258896 3300048915 Unclassified 1690
438 Ga0501031_0001368 3300049568 Bacteria 15070
439 Ga0501032_0002878 3300049569 Bacteria 13389
440 Ga0501033_0004213 3300049570 Bacteria 11573
441 Ga0501034_0002377 3300049571 Bacteria 22855
442 Ga0501036_0000269 3300049572 Bacteria 35431
443 Ga0501037_0002546 3300049573 Bacteria 13178
444 Ga0501038_0009121 3300049574 Bacteria 9100
445 Ga0501039_0008437 3300049575 Bacteria 7852
446 Ga0501040_0321044 3300049576 Bacteria 1108
447 Ga0501043_0000778 3300049579 Bacteria 28342
448 Ga0501046_0001354 3300049580 Bacteria 23706
449 Ga0501046_0422121 3300049580 Unclassified 961
450 Ga0501047_0008837 3300049581 Bacteria 9501
451 Ga0501047_0065518 3300049581 Bacteria 3502
452 Ga0501048_0004660 3300049582 Bacteria 10437
453 Ga0501067_0004122 3300049583 Bacteria 8013
454 Ga0501068_0000465 3300049584 Bacteria 20465
455 Ga0501068_0081559 3300049584 Bacteria 1986
456 Ga0501070_0008330 3300049586 Bacteria 8759
457 Ga0501072_0001367 3300049588 Bacteria 18319
458 Ga0501073_0001058 3300049589 Bacteria 19857
459 Ga0501074_0001394 3300049590 Bacteria 16055
460 Ga0501076_0059463 3300049592 Bacteria 3040
461 Ga0501077_0169403 3300049593 Bacteria 1387
462 Ga0501079_0007257 3300049741 Bacteria 8366
463 Ga0501080_0000639 3300049742 Bacteria 27765
464 Ga0501080_0859328 3300049742 Unclassified 793
465 Ga0501083_0005533 3300049744 Bacteria 8951
466 Ga0501083_0084465 3300049744 Bacteria 2102
467 Ga0501035_0003086 3300049822 Bacteria 15993
468 Ga0501044_0002406 3300049823 Bacteria 21342
469 Ga0501045_0447622 3300049824 Bacteria 960
470 nmdc:mga05p37_394769_c1 3300050507 Unclassified 1617
471 nmdc:mga05p37_54151_c1 3300050507 Bacteria 4935
472 nmdc:mga09592_282942_c1 3300050508 Bacteria 1438
473 nmdc:mga09592_359133_c1 3300050508 Unclassified 1261
474 nmdc:mga0qj67_133394_c1 3300050509 Unclassified 2012
475 nmdc:mga06r32_100532_c1 3300050510 Bacteria 2837
476 nmdc:mga06r32_243740_c1 3300050510 Unclassified 1785
477 nmdc:mga08x19_13569_c1 3300050514 Bacteria 4927
478 Ga0495601_0078475 3300053077 Bacteria 2116
479 Ga0495595_0276263 3300053084 Unclassified 843
480 Ga0501084_0000102 3300054114 Bacteria 63120
481 Ga0501082_0000500 3300060353 Bacteria 34726
482 Ga0501082_0007723 3300060353 Bacteria 9284
483 Ga0530510_0233414 3300061734 Unclassified 1369
484 Ga0075430_100023886
485 Ga0065707_10328412
486 Ga0070658_10028752
487 Ga0070658_10036329
488 Ga0070658_10564560
489 Ga0070676_10555852
490 Ga0070683_100190853
491 Ga0070670_100353245
492 Ga0068869_100106103
493 Ga0070666_10510408
494 Ga0070680_100025899
495 Ga0070680_100462204
496 Ga0070682_100786178
497 Ga0068868_100240423
498 Ga0070689_100201776
499 Ga0070671_100140993
500 Ga0070673_100389951
501 Ga0070667_100735887
502 Ga0070709_10334327
503 Ga0070714_100000699
504 Ga0070714_100063013
505 Ga0070714_100325584
506 Ga0070714_100531583
507 Ga0070714_101073640
508 Ga0070713_100351361
509 Ga0070713_100471085
510 Ga0070711_100002951
511 Ga0070705_100217830
512 Ga0070700_100633324
513 Ga0070708_100387310
514 Ga0070708_100501784
515 Ga0070681_10001713
516 Ga0070681_10361450
517 Ga0070681_10388541
518 Ga0068867_100052292
519 Ga0068867_100368049
520 Ga0068867_100588097
521 Ga0070706_100142764
522 Ga0070706_100333359
523 Ga0070706_100473136
524 Ga0070698_100252454
525 Ga0070698_101412879
526 Ga0070699_100031563
527 Ga0070679_100081405
528 Ga0070679_100341201
529 Ga0070679_100437146
530 Ga0070684_100108092
531 Ga0070684_100220498
532 Ga0070684_100339082
533 Ga0070684_100435985
534 Ga0070684_100506106
535 Ga0070697_100071682
536 Ga0070697_100163560
537 Ga0068853_100445141
538 Ga0068853_100797364
539 Ga0070695_100176060
540 Ga0070696_100001903
541 Ga0070665_100119153
542 Ga0070665_100122364
543 Ga0068855_100024889
544 Ga0068855_100100173
545 Ga0068855_100141854
546 Ga0070664_100841775
547 Ga0070664_100955935
548 Ga0068857_100575641
549 Ga0068857_100909513
550 Ga0068856_100174233
551 Ga0068856_100178526
552 Ga0070702_100463539
553 Ga0068852_100012886
554 Ga0068859_100012694
555 Ga0068864_100619530
556 Ga0068864_100729215
557 Ga0068861_100088558
558 Ga0068863_100060379
559 Ga0068863_100820438
560 Ga0068858_100292081
561 Ga0068858_100387381
562 Ga0068858_100944326
563 Ga0068860_100033457
564 Ga0068860_100354785
565 Ga0068860_100577200
566 Ga0068860_100987968
567 Ga0081540_1121104
568 Ga0081539_10045578
569 Ga0070717_10044068
570 Ga0070717_10126975
571 Ga0070717_10608986
572 Ga0070717_10846897
573 Ga0070717_10907260
574 Ga0070712_100056900
575 Ga0097621_100219843
576 Ga0097621_100265473
577 Ga0097621_100728386
578 Ga0097621_100737310
579 Ga0068871_100509033
580 Ga0068871_100525967
581 Ga0068871_100833154
582 Ga0068871_101429197
583 Ga0075430_100046557
584 Ga0075431_100094907
585 Ga0075431_100491924
586 Ga0075429_100364452
587 Ga0068865_100024920
588 Ga0075436_100001863
589 Ga0075436_100614850
590 Ga0097620_100012694
591 Ga0097620_101146378
592 Ga0105240_10002535
593 Ga0105240_10006661
594 Ga0105240_10023287
595 Ga0105240_10210370
596 Ga0105240_10279143
597 Ga0105240_10354677
598 Ga0105240_10585762
599 Ga0105245_10404947
600 Ga0105245_11795258
601 Ga0105247_10278209
602 Ga0114129_10037402
603 Ga0114129_10317920
604 Ga0114129_10571406
605 Ga0105243_10365692
606 Ga0105243_11213794
607 Ga0105242_10056826
608 Ga0105242_10732637
609 Ga0105242_11267322
610 Ga0105248_10033117
611 Ga0105248_10160574
612 Ga0105248_10389102
613 Ga0105248_10418099
614 Ga0105248_10585556
615 Ga0105248_10609005
616 Ga0105248_10707036
617 Ga0105248_10927973
618 Ga0105248_11055329
619 Ga0105248_11347935
620 Ga0105237_10015646
621 Ga0105237_10024913
622 Ga0105237_10060308
623 Ga0105237_10070671
624 Ga0105237_10750472
625 Ga0105238_10070452
626 Ga0105238_10092606
627 Ga0105238_10150669
628 Ga0105238_10187116
629 Ga0105238_10208360
630 Ga0105238_10233146
631 Ga0105238_10389615
632 Ga0105238_11593506
633 Ga0105238_11773742
634 Ga0105239_10194067
635 Ga0157370_10014478
636 Ga0157369_10044199
637 Ga0157369_10088744
638 Ga0157369_10284678
639 Ga0157369_10798752
640 Ga0157369_11538702
641 Ga0157374_10176239
642 Ga0157374_10336672
643 Ga0157374_10612342
644 Ga0157374_10642869
645 Ga0157378_10540615
646 Ga0157378_10842375
647 Ga0157378_10934813
648 Ga0163162_10712292
649 Ga0163162_10848428
650 Ga0163162_11202955
651 Ga0157372_10084676
652 Ga0157372_10087996
653 Ga0157372_10183055
654 Ga0157372_10430992
655 Ga0157372_10518773
656 Ga0163163_10137059
657 Ga0163163_10151029
658 Ga0163163_10166050
659 Ga0163163_10265255
660 Ga0163163_10460054
661 Ga0163163_10706546
662 Ga0163163_10968094
663 Ga0163163_11333448
664 Ga0163163_11391276
665 Ga0157380_10064139
666 Ga0157377_10899387
667 Ga0157376_10003232
668 Ga0157376_11381573
669 Ga0157376_11535575
670 Ga0163161_10259142
671 Ga0206356_11354221
672 Ga0206355_1359470
673 Ga0206355_1717628
674 Ga0206354_11172972
675 Ga0213876_10004741
676 Ga0213875_10086837
677 Ga0224712_10070896
678 Ga0207710_10127478
679 Ga0207699_10470498
680 Ga0207645_10334590
681 Ga0207705_10078824
682 Ga0207705_10101019
683 Ga0207684_10234366
684 Ga0207684_10256463
685 Ga0207684_10382132
686 Ga0207707_10020971
687 Ga0207707_10033268
688 Ga0207707_10351426
689 Ga0207695_10060975
690 Ga0207695_10161157
691 Ga0207695_10165144
692 Ga0207695_10295246
693 Ga0207695_10323708
694 Ga0207671_10015068
695 Ga0207671_10016608
696 Ga0207671_10115107
697 Ga0207671_10859794
698 Ga0207693_10047613
699 Ga0207663_10012087
700 Ga0207660_10020762
701 Ga0207649_10105814
702 Ga0207652_10265655
703 Ga0207652_10297466
704 Ga0207694_10047118
705 Ga0207694_10113080
706 Ga0207694_10279997
707 Ga0207694_10339952
708 Ga0207650_10383935
709 Ga0207700_10003927
710 Ga0207700_10314857
711 Ga0207700_10875623
712 Ga0207664_10001251
713 Ga0207664_10128569
714 Ga0207644_10083830
715 Ga0207686_10089372
716 Ga0207670_10407034
717 Ga0207670_10590990
718 Ga0207704_10068787
719 Ga0207704_10137517
720 Ga0207665_10724667
721 Ga0207711_10024490
722 Ga0207711_10073747
723 Ga0207711_10262077
724 Ga0207711_10309244
725 Ga0207711_10471859
726 Ga0207711_10578159
727 Ga0207711_10682931
728 Ga0207711_10948503
729 Ga0207661_10021703
730 Ga0207661_10027987
731 Ga0207661_10062323
732 Ga0207679_10827348
733 Ga0207667_10026692
734 Ga0207667_10036316
735 Ga0207667_10063580
736 Ga0207651_10277117
737 Ga0207651_10652898
738 Ga0207712_10498902
739 Ga0207677_10276870
740 Ga0207639_10112245
741 Ga0207708_10569966
742 Ga0207702_10151634
743 Ga0207641_10012834
744 Ga0207641_10093341
745 Ga0207641_10561285
746 Ga0207648_10093851
747 Ga0207648_10593473
748 Ga0207674_10804413
749 Ga0207675_100636488
750 Ga0207683_10527610
751 Ga0207698_10057364
752 Ga0268266_10084253
753 Ga0268266_10104699
754 Ga0268266_10461852
755 Ga0268265_10380020
756 Ga0268264_10029421
757 Ga0268264_10734499
758 Ga0268264_11129605
759 Ga0265323_10001449
760 Ga0265336_10020948
761 Ga0265338_10080092
762 Ga0265762_1048931
763 Ga0265762_1055306
764 Ga0265760_10067752
765 Ga0265760_10095191
766 Ga0265330_10017570
767 Ga0265332_10049890
768 Ga0265328_10056296
769 Ga0265320_10012674
770 Ga0265325_10000615
771 Ga0265329_10012258
772 Ga0265340_10023080
773 Ga0265340_10059210
774 Ga0265331_10015023
775 Ga0265331_10045376
776 Ga0265316_10002140
777 Ga0265316_10020430
778 Ga0265316_10023659
779 Ga0265316_10031727
780 Ga0265316_10059706
781 Ga0265316_10119476
782 Ga0265316_10455265
783 Ga0265316_10574984
784 Ga0265314_10014059
785 Ga0265314_10045062
786 Ga0265342_10071230
787 Ga0265342_10189739
788 Ga0373926_0006844
789 Ga0373934_0025113
790 Ga0373934_0122565
791 Ga0373923_0146424
792 Ga0373923_0331996
793 Ga0373945_0221729
794 Ga0373954_0003818
795 Ga0373954_0095674
796 Ga0373954_0130173
797 Ga0373954_0247460
798 Ga0373957_0041701
799 Ga0373943_0008691
800 Ga0373946_0241672
801 Ga0373955_0111457
802 Ga0373935_0025691
803 Ga0373935_0253910
804 Ga0373927_0000718
805 Ga0373927_0002847
806 Ga0373927_0007946
807 Ga0373927_0117853
808 Ga0373927_0196570
809 Ga0373933_0086043
810 Ga0373947_0009613
811 Ga0373947_0217761
812 Ga0373937_0002395
813 Ga0373937_0169747
814 Ga0373937_0274939
815 Ga0373937_0440395
816 Ga0373937_0957725
817 Ga0373925_0000045
818 Ga0373925_0130346
819 Ga0373925_0134775
820 Ga0373925_0191975
821 Ga0373925_0209193
822 Ga0373925_0246122
823 Ga0395898_0567480
824 Ga0436364_0544992
825 Ga0436364_0813769
826 Ga0436364_0950029
827 Ga0436365_0039688
828 Ga0436365_0671981
829 Ga0436361_0515496
830 Ga0436363_0739917
831 Ga0436362_0509964
832 Ga0451577_1251166
833 Ga0466963_0326697
834 Ga0451576_0131017
835 Ga0451576_0630291
836 Ga0495592_0061520
837 Ga0495629_0098601
838 Ga0495629_0359323
839 Ga0495651_0031585
840 Ga0495651_0285535
841 Ga0495651_0419674
842 Ga0495653_0142345
843 Ga0495580_0002547
844 Ga0495580_0016165
845 Ga0495580_0092733
846 Ga0495580_0132944
847 Ga0495582_0224422
848 Ga0495582_0355176
849 Ga0495662_0014296
850 Ga0495664_0003304
851 Ga0495664_0118292
852 Ga0495664_0292858
853 Ga0495664_0366627
854 Ga0495594_0070458
855 Ga0495608_0248505
856 Ga0495608_0285021
857 Ga0495608_0612170
858 Ga0495628_0049947
859 Ga0495628_0106839
860 Ga0495630_0046372
861 Ga0495652_0030559
862 Ga0495652_0209877
863 Ga0495652_0224111
864 Ga0495652_0492552
865 Ga0495665_0060369
866 Ga0495665_0070917
867 Ga0495665_0275285
868 Ga0495640_0258509
869 Ga0495586_0202638
870 Ga0495587_0047319
871 Ga0495587_0066302
872 Ga0495645_0007051
873 Ga0495645_0083228
874 Ga0495645_0142375
875 Ga0495645_0168496
876 Ga0495645_0189249
877 Ga0495645_0374889
878 Ga0495667_0166424
879 Ga0495667_0308270
880 Ga0495667_0362875
881 Ga0495634_0072812
882 Ga0495635_0295486
883 Ga0495635_0435542
884 Ga0495635_0488794
885 Ga0495657_0074889
886 Ga0495657_0287466
887 Ga0495599_0034531
888 Ga0495599_0615773
889 Ga0495623_0032274
890 Ga0495623_0093701
891 Ga0495623_0128093
892 Ga0495646_0044703
893 Ga0495646_0485070
894 Ga0495613_0054362
895 Ga0495613_0172006
896 Ga0495600_0013561
897 Ga0495600_0177259
898 Ga0495581_0274413
899 Ga0495604_0068259
900 Ga0495604_0265174
901 Ga0495604_0289644
902 Ga0495674_0009769
903 Ga0495674_0033787
904 Ga0495674_0083642
905 Ga0495674_0493493
906 Ga0495680_0338199
907 Ga0495675_0041618
908 Ga0495675_0064964
909 Ga0495675_0104789
910 Ga0495675_0167714
911 Ga0495675_0335115
912 Ga0495684_0002407
913 Ga0495684_0043836
914 Ga0495684_0060712
915 Ga0495684_0149491
916 Ga0495602_0059238
917 Ga0495602_0114479
918 Ga0495602_0335665
919 Ga0496104_0701597
920 Ga0496112_0258896
921 Ga0501031_0001368
922 Ga0501032_0002878
923 Ga0501033_0004213
924 Ga0501034_0002377
925 Ga0501036_0000269
926 Ga0501037_0002546
927 Ga0501038_0009121
928 Ga0501039_0008437
929 Ga0501040_0321044
930 Ga0501043_0000778
931 Ga0501046_0001354
932 Ga0501046_0422121
933 Ga0501047_0008837
934 Ga0501047_0065518
935 Ga0501048_0004660
936 Ga0501067_0004122
937 Ga0501068_0000465
938 Ga0501068_0081559
939 Ga0501070_0008330
940 Ga0501072_0001367
941 Ga0501073_0001058
942 Ga0501074_0001394
943 Ga0501076_0059463
944 Ga0501077_0169403
945 Ga0501079_0007257
946 Ga0501080_0000639
947 Ga0501080_0859328
948 Ga0501083_0005533
949 Ga0501083_0084465
950 Ga0501035_0003086
951 Ga0501044_0002406
952 Ga0501045_0447622
953 nmdc:mga05p37_394769_c1
954 nmdc:mga05p37_54151_c1
955 nmdc:mga09592_282942_c1
956 nmdc:mga09592_359133_c1
957 nmdc:mga0qj67_133394_c1
958 nmdc:mga06r32_100532_c1
959 nmdc:mga06r32_243740_c1
960 nmdc:mga08x19_13569_c1
961 Ga0495601_0078475
962 Ga0495595_0276263
963 Ga0501084_0000102
964 Ga0501082_0000500
965 Ga0501082_0007723
966 Ga0530510_0233414

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04545

Sigma70_r4

Sigma-70, region 4

174

223

0.98

PF08281

Sigma70_r4_2

Sigma-70, region 4

168

221

0.96

PF04542

Sigma70_r2

Sigma-70 region 2

65

133

0.94

Map