F452727

General Info

Members Datasets Scaffolds Average Seq Length
483 236 966 389

Family's Representative Sequence

Representative Sequence 3300005436|Ga0070713_100044974|Ga0070713_1000449743
Length 421
Sequence MVGMVVRKPGVQPDEAFYLRLMTERAATKGLDRRTILQTLGATGALAALSGAADVRAQSATQEVLAPAPQFKPRHSIRFGVCGMSHDHIHGMIKAIERGGGELVAAWGAEPDKLATFVTRYPNVPIVKDQDAILDDKSLQLVLSSQIANERAGIGVRAMKRGKDFLADKPGITTLEDLALIRSTIAETGRMYAIMYSERLEVPAAVHAGELIRQGAIGKVIQTINIAPHQIQQGSAAGDAGGASKRPDWFWNEVQFGGILCDIGSHQIDQFLYYTGSTSADVVASQVANVHHPNRPHFQDFGDMMLRGNQGFGYVRLDWFTPDGLGTWGDGRLFILGTQGYIEARKYTNVGVSKAGNQLFVVDGHRARHIDCSQGPLPFGPQFVADILDRTHQAQDQEQCLLAAELSIRAQRNATRVALQL

Samples

Sample ID Description Type Environment
1 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
38 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
45 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
49 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
50 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
51 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
58 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
59 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
60 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
67 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
68 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
69 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
70 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
72 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
113 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
114 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
115 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
116 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
117 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
118 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
119 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
120 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
121 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
122 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
123 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
124 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
125 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
126 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
127 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
128 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
129 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
130 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
131 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
132 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
133 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
134 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
135 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
136 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
137 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
138 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
139 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
140 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
141 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
142 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
143 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
144 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
145 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
146 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
147 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
148 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
149 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
150 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
151 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
152 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
153 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
154 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
155 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
156 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
157 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
158 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
159 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
160 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
161 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
162 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
163 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
164 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
165 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
166 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
167 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
168 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
169 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
170 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
171 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
172 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
173 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
174 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
175 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
176 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
177 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
178 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
179 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
180 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
181 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
182 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
183 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
184 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
185 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
186 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
200 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
201 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
202 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
203 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
204 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
205 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
206 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
207 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
208 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
209 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
212 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
213 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
214 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
215 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
216 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
217 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
218 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
219 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
220 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
221 2524023129 Paenibacillus pinihumi DSM 23905 Isolate Rhizosphere
222 2585428059 Paenibacillus chondroitinus OK414 Isolate Rhizosphere
223 2593339198 Paenibacillus sp. UNCCL117 Isolate Unclassified
224 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
225 2786546548 Spartobacteria bacterium LR76 Isolate Unclassified
226 2791355222 Paenibacillus oryzae 1DrF-4 Isolate Unclassified
227 2821111986 Paenibacillus illinoisensis 582 Isolate Unclassified
228 2857453340 Paenibacillus sp. R-74130 Isolate Unclassified
229 2884215851 Edaphobacter sp. 12200R-103 Isolate Rhizosphere
230 2888578766 Paenibacillus lycopersici 12200R-189 Isolate Rhizosphere
231 2889049205 Paenibacillus rhizovicinus 14171R-81 Isolate Rhizosphere
232 2956897341 Ectobacillus funiculus W18-2 Isolate Rhizosphere
233 2971410472 Paenibacillus oryzisoli 1ZS3-15 Isolate Unclassified
234 3001267043 Bacillus sp. FJAT-49870 Isolate Rhizosphere
235 3006988479 Bacillus sp. FJAT-49711 Isolate Rhizosphere
236 8056533031 Paenibacillus qinlingensis TEGT-2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.69
Metatranscriptomes 0
Isolates 3.31

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.9
Nodule 0.21
Rhizoplane 1.24
Rhizosphere 90.89
Stem 0
Stem Tuber 0
Unclassified 2.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070713_100044974 3300005436 Bacteria 3616
2 JGI25153J46596_10003404 3300003215 Bacteria 8913
3 rootH1_10119014 3300003316 Bacteria 1415
4 rootH2_10029369 3300003320 Bacteria 6864
5 Ga0070658_10014507 3300005327 Bacteria 6324
6 Ga0070658_10078346 3300005327 Bacteria 2712
7 Ga0070676_10050263 3300005328 Bacteria 2444
8 Ga0070683_100000105 3300005329 Bacteria 54897
9 Ga0070683_100090264 3300005329 Bacteria 2877
10 Ga0070683_100226035 3300005329 Unclassified 1779
11 Ga0070683_100275226 3300005329 Bacteria 1601
12 Ga0070690_100072598 3300005330 Bacteria 2238
13 Ga0070670_100029708 3300005331 Bacteria 4707
14 Ga0070670_100314869 3300005331 Bacteria 1370
15 Ga0068869_100000217 3300005334 Bacteria 29938
16 Ga0068869_100010164 3300005334 Bacteria 6127
17 Ga0070680_100027813 3300005336 Bacteria 4531
18 Ga0070680_100057801 3300005336 Bacteria 3172
19 Ga0070680_100059460 3300005336 Bacteria 3127
20 Ga0070680_100095505 3300005336 Bacteria 2464
21 Ga0068868_100001487 3300005338 Bacteria 16175
22 Ga0068868_100014526 3300005338 Bacteria 5805
23 Ga0068868_100089383 3300005338 Bacteria 2480
24 Ga0070660_100007629 3300005339 Bacteria 7540
25 Ga0070661_100002157 3300005344 Bacteria 13569
26 Ga0070661_100020553 3300005344 Bacteria 4710
27 Ga0070661_100060157 3300005344 Bacteria 2787
28 Ga0070671_100002811 3300005355 Bacteria 13525
29 Ga0070671_100020993 3300005355 Bacteria 5329
30 Ga0070659_100191994 3300005366 Bacteria 1679
31 Ga0070667_100002458 3300005367 Bacteria 16177
32 Ga0070714_100065267 3300005435 Bacteria 3135
33 Ga0070713_100083503 3300005436 Bacteria 2731
34 Ga0070663_100070653 3300005455 Bacteria 2539
35 Ga0070678_100010482 3300005456 Bacteria 5667
36 Ga0070662_100062008 3300005457 Bacteria 2731
37 Ga0070681_10012279 3300005458 Bacteria 8496
38 Ga0070681_10029424 3300005458 Bacteria 5517
39 Ga0070681_10044478 3300005458 Bacteria 4445
40 Ga0070681_10056744 3300005458 Bacteria 3897
41 Ga0070681_10180609 3300005458 Bacteria 2032
42 Ga0070681_10278730 3300005458 Bacteria 1583
43 Ga0068867_100011759 3300005459 Bacteria 6181
44 Ga0070679_100050183 3300005530 Bacteria 4156
45 Ga0070684_100000161 3300005535 Bacteria 45787
46 Ga0070684_100069303 3300005535 Bacteria 3102
47 Ga0068853_100000550 3300005539 Bacteria 25571
48 Ga0068853_100028452 3300005539 Unclassified 4701
49 Ga0070672_100334991 3300005543 Bacteria 1288
50 Ga0070665_100000184 3300005548 Bacteria 111222
51 Ga0070665_100016838 3300005548 Bacteria 7329
52 Ga0070665_100055423 3300005548 Bacteria 3976
53 Ga0070665_100134576 3300005548 Unclassified 2473
54 Ga0068855_100000255 3300005563 Bacteria 67204
55 Ga0068855_100009681 3300005563 Bacteria 11633
56 Ga0068855_100261448 3300005563 Bacteria 1928
57 Ga0068855_100264223 3300005563 Bacteria 1916
58 Ga0070664_100247413 3300005564 Bacteria 1602
59 Ga0068857_100000590 3300005577 Bacteria 26594
60 Ga0068857_100002496 3300005577 Bacteria 15042
61 Ga0068857_100248322 3300005577 Bacteria 1631
62 Ga0068857_100325012 3300005577 Bacteria 1421
63 Ga0068854_100097703 3300005578 Bacteria 2196
64 Ga0068856_100002932 3300005614 Bacteria 17472
65 Ga0068856_100022734 3300005614 Bacteria 6096
66 Ga0068856_100083541 3300005614 Bacteria 3171
67 Ga0068856_100100194 3300005614 Bacteria 2889
68 Ga0068856_100114276 3300005614 Bacteria 2699
69 Ga0068852_100000004 3300005616 Bacteria 179746
70 Ga0068852_100000115 3300005616 Bacteria 54428
71 Ga0068859_100005449 3300005617 Bacteria 12940
72 Ga0068864_100000524 3300005618 Bacteria 33081
73 Ga0068864_100011734 3300005618 Bacteria 7234
74 Ga0068851_10002968 3300005834 Bacteria 7493
75 Ga0068870_10015235 3300005840 Bacteria 3644
76 Ga0068863_100000589 3300005841 Bacteria 37008
77 Ga0068863_100012299 3300005841 Bacteria 8262
78 Ga0068858_100001558 3300005842 Bacteria 23497
79 Ga0068860_100000853 3300005843 Bacteria 34017
80 Ga0068862_100010649 3300005844 Bacteria 7597
81 Ga0068862_100026327 3300005844 Bacteria 4888
82 Ga0097621_100002564 3300006237 Bacteria 12447
83 Ga0097621_100067539 3300006237 Bacteria 2947
84 Ga0068871_100000735 3300006358 Bacteria 22253
85 Ga0068871_100266009 3300006358 Bacteria 1497
86 Ga0097620_100005449 3300006931 Bacteria 12940
87 Ga0105240_10000001 3300009093 Bacteria 2887840
88 Ga0105240_10000111 3300009093 Bacteria 171005
89 Ga0105240_10002651 3300009093 Bacteria 28481
90 Ga0105240_10014163 3300009093 Bacteria 10894
91 Ga0105240_10016696 3300009093 Bacteria 9929
92 Ga0105240_10025054 3300009093 Bacteria 7852
93 Ga0105240_10029383 3300009093 Bacteria 7162
94 Ga0105240_10057751 3300009093 Bacteria 4846
95 Ga0105240_10158089 3300009093 Bacteria 2694
96 Ga0105245_10000769 3300009098 Bacteria 29064
97 Ga0105245_10007445 3300009098 Bacteria 9587
98 Ga0105245_10017566 3300009098 Bacteria 6244
99 Ga0105245_10019750 3300009098 Bacteria 5904
100 Ga0105247_10000309 3300009101 Bacteria 43841
101 Ga0105243_10016748 3300009148 Bacteria 5542
102 Ga0105241_10000633 3300009174 Bacteria 26500
103 Ga0105241_10001362 3300009174 Bacteria 18615
104 Ga0105241_10010087 3300009174 Bacteria 6935
105 Ga0105241_10019444 3300009174 Bacteria 5008
106 Ga0105241_10174632 3300009174 Bacteria 1777
107 Ga0105242_10006874 3300009176 Bacteria 8775
108 Ga0105248_10000011 3300009177 Bacteria 339183
109 Ga0105248_10012263 3300009177 Bacteria 9452
110 Ga0105248_10103778 3300009177 Bacteria 3205
111 Ga0105248_10241952 3300009177 Bacteria 2031
112 Ga0105237_10002630 3300009545 Bacteria 22095
113 Ga0105237_10002839 3300009545 Bacteria 21072
114 Ga0105237_10057484 3300009545 Unclassified 3893
115 Ga0105238_10000383 3300009551 Bacteria 47415
116 Ga0105238_10000631 3300009551 Bacteria 37036
117 Ga0105238_10014930 3300009551 Bacteria 7862
118 Ga0105238_10019836 3300009551 Bacteria 6843
119 Ga0105238_10045667 3300009551 Bacteria 4425
120 Ga0105238_10353756 3300009551 Bacteria 1458
121 Ga0105238_10388929 3300009551 Bacteria 1387
122 Ga0105249_10040073 3300009553 Bacteria 4254
123 Ga0105249_10103630 3300009553 Bacteria 2680
124 Ga0105249_10149842 3300009553 Bacteria 2245
125 Ga0105239_10000737 3300010375 Bacteria 46497
126 Ga0105239_10002973 3300010375 Bacteria 21140
127 Ga0105239_10005827 3300010375 Bacteria 14367
128 Ga0105239_10049556 3300010375 Bacteria 4605
129 Ga0105239_10121130 3300010375 Unclassified 2905
130 Ga0105239_10173336 3300010375 Bacteria 2413
131 Ga0105246_10001302 3300011119 Bacteria 14655
132 Ga0105246_10065551 3300011119 Bacteria 2540
133 Ga0157370_10000016 3300013104 Bacteria 179999
134 Ga0157370_10021162 3300013104 Bacteria 6486
135 Ga0157370_10097563 3300013104 Bacteria 2757
136 Ga0157369_10000010 3300013105 Bacteria 273443
137 Ga0157369_10000182 3300013105 Bacteria 87266
138 Ga0157369_10000527 3300013105 Bacteria 50543
139 Ga0157369_10001496 3300013105 Bacteria 28650
140 Ga0157369_10023922 3300013105 Bacteria 6800
141 Ga0157369_10044419 3300013105 Bacteria 4837
142 Ga0157369_10048208 3300013105 Bacteria 4623
143 Ga0157369_10063224 3300013105 Bacteria 3988
144 Ga0157369_10198324 3300013105 Bacteria 2107
145 Ga0157369_10263534 3300013105 Bacteria 1797
146 Ga0157374_10001075 3300013296 Bacteria 23658
147 Ga0157374_10001087 3300013296 Bacteria 23433
148 Ga0157374_10008655 3300013296 Bacteria 8709
149 Ga0157374_10014112 3300013296 Bacteria 6983
150 Ga0157374_10032178 3300013296 Bacteria 4774
151 Ga0157378_10002149 3300013297 Bacteria 17505
152 Ga0157378_10010457 3300013297 Bacteria 8105
153 Ga0157378_10075019 3300013297 Bacteria 3044
154 Ga0163162_10015785 3300013306 Bacteria 7381
155 Ga0163162_10223792 3300013306 Bacteria 2011
156 Ga0157372_10000036 3300013307 Bacteria 172504
157 Ga0157372_10002675 3300013307 Bacteria 19284
158 Ga0157372_10003462 3300013307 Bacteria 17030
159 Ga0157372_10008962 3300013307 Bacteria 10633
160 Ga0157372_10011652 3300013307 Bacteria 9360
161 Ga0157372_10011710 3300013307 Bacteria 9341
162 Ga0157372_10017603 3300013307 Bacteria 7670
163 Ga0157372_10018756 3300013307 Bacteria 7444
164 Ga0157372_10022991 3300013307 Bacteria 6754
165 Ga0157372_10036493 3300013307 Bacteria 5418
166 Ga0157372_10058206 3300013307 Bacteria 4319
167 Ga0157375_10002123 3300013308 Bacteria 17125
168 Ga0157375_10003549 3300013308 Bacteria 13550
169 Ga0163163_10000015 3300014325 Bacteria 214881
170 Ga0163163_10001254 3300014325 Bacteria 21395
171 Ga0163163_10008106 3300014325 Bacteria 9308
172 Ga0163163_10035785 3300014325 Bacteria 4819
173 Ga0157379_10000549 3300014968 Bacteria 30325
174 Ga0157379_10001160 3300014968 Bacteria 21462
175 Ga0157376_10001719 3300014969 Bacteria 14556
176 Ga0157376_10004668 3300014969 Bacteria 9551
177 Ga0157376_10007102 3300014969 Bacteria 7950
178 Ga0157376_10114903 3300014969 Bacteria 2375
179 Ga0209437_103677 3300025233 Bacteria 2745
180 Ga0209233_1000732 3300025261 Bacteria 15063
181 Ga0209233_1021748 3300025261 Bacteria 1654
182 Ga0209455_1010389 3300025272 Bacteria 2369
183 Ga0209758_1000085 3300025297 Bacteria 256191
184 Ga0207710_10000259 3300025900 Bacteria 43990
185 Ga0207647_10016065 3300025904 Bacteria 5114
186 Ga0207645_10039428 3300025907 Bacteria 3027
187 Ga0207643_10036230 3300025908 Bacteria 2766
188 Ga0207705_10038868 3300025909 Bacteria 3409
189 Ga0207654_10000101 3300025911 Bacteria 56442
190 Ga0207654_10003407 3300025911 Bacteria 8036
191 Ga0207654_10020381 3300025911 Bacteria 3514
192 Ga0207654_10101922 3300025911 Bacteria 1770
193 Ga0207707_10053107 3300025912 Bacteria 3527
194 Ga0207707_10092803 3300025912 Bacteria 2637
195 Ga0207695_10000001 3300025913 Bacteria 2888630
196 Ga0207695_10000050 3300025913 Bacteria 405727
197 Ga0207695_10000188 3300025913 Bacteria 178721
198 Ga0207695_10000332 3300025913 Bacteria 112161
199 Ga0207695_10010236 3300025913 Bacteria 11499
200 Ga0207695_10033897 3300025913 Bacteria 5559
201 Ga0207695_10151598 3300025913 Bacteria 2257
202 Ga0207695_10252118 3300025913 Bacteria 1664
203 Ga0207671_10001384 3300025914 Bacteria 28203
204 Ga0207671_10002433 3300025914 Bacteria 19927
205 Ga0207657_10013177 3300025919 Bacteria 8117
206 Ga0207657_10016772 3300025919 Bacteria 7052
207 Ga0207657_10023308 3300025919 Bacteria 5767
208 Ga0207649_10032653 3300025920 Bacteria 3105
209 Ga0207652_10004634 3300025921 Bacteria 11144
210 Ga0207652_10139401 3300025921 Bacteria 2168
211 Ga0207694_10000102 3300025924 Bacteria 94003
212 Ga0207694_10000965 3300025924 Bacteria 25347
213 Ga0207694_10022718 3300025924 Bacteria 4758
214 Ga0207694_10087635 3300025924 Bacteria 2452
215 Ga0207694_10112720 3300025924 Bacteria 2164
216 Ga0207650_10001984 3300025925 Bacteria 14346
217 Ga0207687_10002774 3300025927 Bacteria 11882
218 Ga0207687_10011090 3300025927 Bacteria 5892
219 Ga0207700_10007431 3300025928 Bacteria 6693
220 Ga0207644_10008502 3300025931 Bacteria 6717
221 Ga0207644_10013983 3300025931 Bacteria 5364
222 Ga0207690_10056226 3300025932 Bacteria 2653
223 Ga0207686_10016762 3300025934 Bacteria 4114
224 Ga0207709_10163296 3300025935 Bacteria 1556
225 Ga0207711_10000028 3300025941 Bacteria 214107
226 Ga0207711_10016525 3300025941 Bacteria 6129
227 Ga0207689_10001335 3300025942 Bacteria 23803
228 Ga0207661_10002706 3300025944 Bacteria 12195
229 Ga0207661_10023196 3300025944 Bacteria 4687
230 Ga0207661_10054648 3300025944 Unclassified 3200
231 Ga0207661_10112721 3300025944 Bacteria 2303
232 Ga0207667_10002277 3300025949 Bacteria 24132
233 Ga0207667_10004635 3300025949 Bacteria 16865
234 Ga0207667_10006935 3300025949 Bacteria 13691
235 Ga0207667_10012231 3300025949 Bacteria 9911
236 Ga0207667_10136268 3300025949 Bacteria 2528
237 Ga0207712_10114157 3300025961 Bacteria 2031
238 Ga0207640_10039373 3300025981 Bacteria 2991
239 Ga0207658_10002487 3300025986 Bacteria 13429
240 Ga0207677_10000798 3300026023 Bacteria 18075
241 Ga0207639_10000027 3300026041 Bacteria 197829
242 Ga0207678_10006398 3300026067 Bacteria 10461
243 Ga0207702_10001474 3300026078 Bacteria 23343
244 Ga0207702_10005113 3300026078 Bacteria 11536
245 Ga0207702_10054972 3300026078 Unclassified 3375
246 Ga0207641_10001119 3300026088 Bacteria 26941
247 Ga0207648_10025822 3300026089 Bacteria 5227
248 Ga0207676_10003661 3300026095 Bacteria 10867
249 Ga0207674_10000385 3300026116 Bacteria 57430
250 Ga0207674_10001812 3300026116 Bacteria 27271
251 Ga0207674_10163903 3300026116 Bacteria 2177
252 Ga0207674_10293908 3300026116 Bacteria 1573
253 Ga0207683_10117023 3300026121 Bacteria 2390
254 Ga0207698_10000008 3300026142 Bacteria 281991
255 Ga0207698_10000123 3300026142 Bacteria 48520
256 Ga0268266_10002268 3300028379 Bacteria 20908
257 Ga0268266_10002554 3300028379 Bacteria 19322
258 Ga0268266_10011330 3300028379 Bacteria 7755
259 Ga0268266_10023899 3300028379 Bacteria 5201
260 Ga0268266_10089544 3300028379 Bacteria 2695
261 Ga0268266_10369779 3300028379 Bacteria 1350
262 Ga0268265_10006954 3300028380 Bacteria 7654
263 Ga0268265_10079288 3300028380 Bacteria 2586
264 Ga0268264_10005386 3300028381 Bacteria 10834
265 Ga0265336_10029438 3300028666 Unclassified 1713
266 Ga0307515_10001513 3300028794 Bacteria 52028
267 Ga0265338_10001393 3300028800 Bacteria 39373
268 Ga0265338_10002775 3300028800 Bacteria 25641
269 Ga0265338_10023830 3300028800 Bacteria 6276
270 Ga0265338_10081542 3300028800 Bacteria 2712
271 Ga0265330_10000109 3300031235 Bacteria 69230
272 Ga0265330_10001640 3300031235 Bacteria 12738
273 Ga0265330_10022469 3300031235 Bacteria 2870
274 Ga0265332_10014119 3300031238 Bacteria 3535
275 Ga0265328_10030242 3300031239 Unclassified 2018
276 Ga0265325_10000806 3300031241 Bacteria 22686
277 Ga0265325_10002733 3300031241 Bacteria 11785
278 Ga0265340_10012894 3300031247 Bacteria 4404
279 Ga0265339_10004529 3300031249 Bacteria 9461
280 Ga0265339_10010966 3300031249 Bacteria 5603
281 Ga0265339_10044116 3300031249 Unclassified 2461
282 Ga0265339_10065264 3300031249 Bacteria 1952
283 Ga0265331_10027043 3300031250 Bacteria 2879
284 Ga0265316_10002545 3300031344 Bacteria 18843
285 Ga0265316_10006060 3300031344 Bacteria 11612
286 Ga0265316_10007944 3300031344 Bacteria 9925
287 Ga0265316_10032393 3300031344 Bacteria 4265
288 Ga0265316_10257274 3300031344 Bacteria 1281
289 Ga0265313_10005161 3300031595 Bacteria 9704
290 Ga0265313_10008547 3300031595 Bacteria 6784
291 Ga0265313_10012472 3300031595 Bacteria 5183
292 Ga0265313_10042005 3300031595 Bacteria 2248
293 Ga0265314_10000027 3300031711 Bacteria 278331
294 Ga0265314_10021521 3300031711 Bacteria 4955
295 Ga0265314_10055480 3300031711 Bacteria 2735
296 Ga0265314_10094101 3300031711 Bacteria 1943
297 Ga0265342_10000396 3300031712 Bacteria 48193
298 Ga0265342_10004149 3300031712 Bacteria 11534
299 Ga0265342_10004961 3300031712 Bacteria 10278
300 Ga0265342_10007783 3300031712 Bacteria 7793
301 Ga0265342_10014396 3300031712 Bacteria 5251
302 Ga0265342_10014521 3300031712 Bacteria 5225
303 Ga0307510_10045241 3300033180 Bacteria 4755
304 Ga0373953_0058268 3300035117 Unclassified 1575
305 Ga0373933_0061836 3300035724 Unclassified 2260
306 Ga0373937_0081799 3300036401 Bacteria 2988
307 Ga0395900_0223657 3300037418 Bacteria 1896
308 Ga0395898_0076139 3300037466 Bacteria 3240
309 Ga0395898_0139499 3300037466 Bacteria 2321
310 Ga0395901_0194532 3300038443 Bacteria 2127
311 Ga0395901_0388091 3300038443 Bacteria 1436
312 Ga0436365_0725595 3300039437 Unclassified 1118
313 Ga0466963_0003167 3300044694 Bacteria 9346
314 Ga0466967_0003740 3300045976 Bacteria 10027
315 Ga0495592_0053535 3300046454 Bacteria 2993
316 Ga0495629_0011149 3300046459 Bacteria 6530
317 Ga0495629_0090048 3300046459 Bacteria 2140
318 Ga0495651_0026802 3300046462 Bacteria 4488
319 Ga0495651_0033258 3300046462 Bacteria 4022
320 Ga0495650_0000009 3300046471 Bacteria 653845
321 Ga0495650_0006524 3300046471 Bacteria 7252
322 Ga0495580_0068042 3300046472 Bacteria 2491
323 Ga0495580_0139126 3300046472 Bacteria 1683
324 Ga0495582_0044600 3300046473 Bacteria 2442
325 Ga0495582_0060566 3300046473 Bacteria 2089
326 Ga0495662_0004056 3300046476 Bacteria 7374
327 Ga0495664_0013919 3300046477 Bacteria 4559
328 Ga0495585_0035865 3300046492 Bacteria 2800
329 Ga0495594_0000906 3300046499 Bacteria 15360
330 Ga0495594_0003677 3300046499 Bacteria 7875
331 Ga0495594_0076904 3300046499 Bacteria 1861
332 Ga0495583_0007938 3300046506 Bacteria 6572
333 Ga0495606_0055054 3300046507 Bacteria 2574
334 Ga0495628_0058968 3300046516 Bacteria 3015
335 Ga0495644_0000109 3300046523 Bacteria 39201
336 Ga0495642_0011153 3300046528 Bacteria 3447
337 Ga0495652_0005468 3300046529 Bacteria 11968
338 Ga0495652_0061767 3300046529 Bacteria 3161
339 Ga0495665_0024710 3300046531 Bacteria 3227
340 Ga0495640_0023530 3300046533 Bacteria 4484
341 Ga0495586_0011292 3300046535 Bacteria 4749
342 Ga0495645_0004760 3300046543 Bacteria 9277
343 Ga0495645_0063718 3300046543 Bacteria 2668
344 Ga0495667_0009997 3300046559 Bacteria 6424
345 Ga0495634_0014718 3300046642 Bacteria 5630
346 Ga0495611_0009927 3300046648 Bacteria 4029
347 Ga0495625_0002756 3300046660 Bacteria 18581
348 Ga0495625_0030194 3300046660 Unclassified 4047
349 Ga0495625_0062302 3300046660 Bacteria 2637
350 Ga0495635_0020001 3300046663 Bacteria 4665
351 Ga0495599_0025196 3300046678 Bacteria 3723
352 Ga0495623_0078577 3300046679 Bacteria 2045
353 Ga0495646_0013306 3300046680 Bacteria 5228
354 Ga0495669_0017285 3300046684 Bacteria 3094
355 Ga0495613_0005174 3300046689 Bacteria 9796
356 Ga0495613_0007647 3300046689 Bacteria 8041
357 Ga0495624_0009608 3300046690 Bacteria 6697
358 Ga0495649_0045719 3300046694 Bacteria 2386
359 Ga0495600_0031922 3300046809 Bacteria 3414
360 Ga0495581_0006539 3300047315 Bacteria 6756
361 Ga0495604_0008730 3300047317 Bacteria 8009
362 Ga0495604_0010493 3300047317 Bacteria 7343
363 Ga0495604_0024215 3300047317 Bacteria 4845
364 Ga0495674_0054578 3300047319 Bacteria 3508
365 Ga0495676_0061874 3300047321 Bacteria 2925
366 Ga0495686_0000009 3300047472 Bacteria 661643
367 Ga0495686_0001610 3300047472 Bacteria 23773
368 Ga0495686_0004813 3300047472 Bacteria 10902
369 Ga0495686_0009368 3300047472 Bacteria 7060
370 Ga0495686_0149451 3300047472 Bacteria 1372
371 Ga0495614_0015251 3300048089 Bacteria 3351
372 Ga0496104_0000072 3300048907 Bacteria 106074
373 Ga0496104_0009733 3300048907 Bacteria 8567
374 Ga0496105_0026383 3300048908 Bacteria 4738
375 Ga0496105_0104158 3300048908 Bacteria 2343
376 Ga0496114_0039435 3300048917 Bacteria 3908
377 Ga0496115_0176131 3300048918 Bacteria 1768
378 Ga0496116_0032665 3300048919 Bacteria 3705
379 Ga0496116_0090378 3300048919 Bacteria 1864
380 Ga0496120_0114583 3300048923 Bacteria 1403
381 Ga0496122_0007373 3300048925 Bacteria 12257
382 Ga0496122_0079934 3300048925 Bacteria 2282
383 Ga0496123_0016745 3300048926 Bacteria 5932
384 Ga0496124_0028270 3300048927 Bacteria 5019
385 Ga0496125_0001581 3300048928 Bacteria 32367
386 Ga0496126_0000074 3300048929 Bacteria 235643
387 Ga0496126_0003786 3300048929 Bacteria 18776
388 Ga0496126_0009009 3300048929 Bacteria 10675
389 Ga0501031_0001488 3300049568 Bacteria 14568
390 Ga0501031_0014948 3300049568 Bacteria 5043
391 Ga0501031_0040280 3300049568 Bacteria 3050
392 Ga0501032_0006524 3300049569 Bacteria 8572
393 Ga0501033_0004614 3300049570 Bacteria 11032
394 Ga0501033_0063902 3300049570 Bacteria 2708
395 Ga0501034_0034661 3300049571 Bacteria 5118
396 Ga0501034_0056091 3300049571 Bacteria 3965
397 Ga0501034_0121285 3300049571 Bacteria 2601
398 Ga0501034_0123842 3300049571 Bacteria 2571
399 Ga0501036_0000552 3300049572 Bacteria 26879
400 Ga0501036_0001290 3300049572 Bacteria 19191
401 Ga0501036_0134889 3300049572 Bacteria 2083
402 Ga0501037_0001039 3300049573 Bacteria 20546
403 Ga0501037_0002761 3300049573 Bacteria 12706
404 Ga0501037_0005671 3300049573 Bacteria 9103
405 Ga0501037_0111332 3300049573 Bacteria 1972
406 Ga0501037_0246327 3300049573 Bacteria 1251
407 Ga0501038_0004260 3300049574 Bacteria 13301
408 Ga0501038_0021715 3300049574 Bacteria 5759
409 Ga0501039_0005559 3300049575 Bacteria 9538
410 Ga0501039_0043411 3300049575 Bacteria 3473
411 Ga0501039_0181263 3300049575 Bacteria 1656
412 Ga0501042_0060857 3300049578 Bacteria 2697
413 Ga0501043_0004290 3300049579 Bacteria 11606
414 Ga0501043_0010185 3300049579 Bacteria 7369
415 Ga0501043_0079049 3300049579 Bacteria 2584
416 Ga0501043_0163674 3300049579 Bacteria 1737
417 Ga0501046_0000217 3300049580 Bacteria 60109
418 Ga0501046_0001415 3300049580 Bacteria 23077
419 Ga0501046_0021253 3300049580 Bacteria 5357
420 Ga0501046_0022500 3300049580 Bacteria 5193
421 Ga0501046_0030422 3300049580 Bacteria 4382
422 Ga0501047_0000630 3300049581 Bacteria 37158
423 Ga0501047_0001996 3300049581 Bacteria 19568
424 Ga0501047_0002481 3300049581 Bacteria 17613
425 Ga0501047_0017729 3300049581 Bacteria 6821
426 Ga0501048_0034627 3300049582 Bacteria 3641
427 Ga0501067_0005240 3300049583 Bacteria 7206
428 Ga0501068_0005578 3300049584 Bacteria 6893
429 Ga0501068_0083822 3300049584 Bacteria 1960
430 Ga0501069_0001899 3300049585 Bacteria 10426
431 Ga0501070_0006508 3300049586 Bacteria 9931
432 Ga0501070_0093794 3300049586 Bacteria 2483
433 Ga0501071_0056772 3300049587 Bacteria 2829
434 Ga0501073_0001319 3300049589 Bacteria 18263
435 Ga0501073_0008434 3300049589 Bacteria 7643
436 Ga0501073_0042213 3300049589 Bacteria 3220
437 Ga0501074_0004442 3300049590 Bacteria 10038
438 Ga0501079_0006166 3300049741 Bacteria 8993
439 Ga0501080_0034322 3300049742 Bacteria 4734
440 Ga0501080_0038570 3300049742 Bacteria 4459
441 Ga0501080_0082073 3300049742 Bacteria 2994
442 Ga0501083_0007616 3300049744 Bacteria 7672
443 Ga0501083_0010560 3300049744 Bacteria 6500
444 Ga0501083_0102809 3300049744 Bacteria 1883
445 Ga0501035_0002865 3300049822 Bacteria 16659
446 Ga0501035_0020899 3300049822 Bacteria 6015
447 Ga0501035_0047822 3300049822 Bacteria 3838
448 Ga0501035_0151782 3300049822 Bacteria 2010
449 Ga0501035_0153748 3300049822 Bacteria 1995
450 Ga0501044_0000753 3300049823 Bacteria 39179
451 Ga0501044_0016290 3300049823 Bacteria 7987
452 Ga0501044_0095600 3300049823 Bacteria 2993
453 Ga0501045_0039255 3300049824 Bacteria 3445
454 Ga0501045_0046847 3300049824 Bacteria 3148
455 Ga0500643_000003 3300053087 Bacteria 876659
456 Ga0500651_0000010 3300053093 Bacteria 253038
457 Ga0500595_000071 3300053119 Bacteria 72563
458 Ga0500595_004739 3300053119 Bacteria 6036
459 Ga0500568_0027666 3300053139 Bacteria 2369
460 Ga0500573_0000054 3300053140 Bacteria 85434
461 Ga0500622_0039378 3300053156 Bacteria 2464
462 Ga0501084_0006993 3300054114 Bacteria 9297
463 Ga0501084_0014055 3300054114 Bacteria 6628
464 Ga0501084_0197680 3300054114 Bacteria 1696
465 Ga0500661_005305 3300055283 Bacteria 2411
466 Ga0501082_0000640 3300060353 Bacteria 30915
467 Ga0501082_0176013 3300060353 Bacteria 1860
468 2524189940 2524023129 Bacteria 6762600
469 2587742116 2585428059 Bacteria 8696589
470 2595316262 2593339198 Bacteria 7267884
471 2757572239 2757320392 Bacteria 3737298
472 2787509594 2786546548 Bacteria 4745694
473 2793183556 2791355222 Bacteria 5898266
474 2821113440 2821111986 Bacteria 6894338
475 2857459908 2857453340 Bacteria 8090534
476 2884217502 2884215851 Bacteria 4554841
477 2888583930 2888578766 Bacteria 6743310
478 2889053625 2889049205 Bacteria 7524325
479 2956899286 2956897341 Bacteria 5447711
480 2971412704 2971410472 Bacteria 8311090
481 3001269735 3001267043 Bacteria 4823521
482 3006990794 3006988479 Bacteria 4767936
483 8056538681 8056533031 Bacteria 8964429
484 Ga0070713_100044974
485 JGI25153J46596_10003404
486 rootH1_10119014
487 rootH2_10029369
488 Ga0070658_10014507
489 Ga0070658_10078346
490 Ga0070676_10050263
491 Ga0070683_100000105
492 Ga0070683_100090264
493 Ga0070683_100226035
494 Ga0070683_100275226
495 Ga0070690_100072598
496 Ga0070670_100029708
497 Ga0070670_100314869
498 Ga0068869_100000217
499 Ga0068869_100010164
500 Ga0070680_100027813
501 Ga0070680_100057801
502 Ga0070680_100059460
503 Ga0070680_100095505
504 Ga0068868_100001487
505 Ga0068868_100014526
506 Ga0068868_100089383
507 Ga0070660_100007629
508 Ga0070661_100002157
509 Ga0070661_100020553
510 Ga0070661_100060157
511 Ga0070671_100002811
512 Ga0070671_100020993
513 Ga0070659_100191994
514 Ga0070667_100002458
515 Ga0070714_100065267
516 Ga0070713_100083503
517 Ga0070663_100070653
518 Ga0070678_100010482
519 Ga0070662_100062008
520 Ga0070681_10012279
521 Ga0070681_10029424
522 Ga0070681_10044478
523 Ga0070681_10056744
524 Ga0070681_10180609
525 Ga0070681_10278730
526 Ga0068867_100011759
527 Ga0070679_100050183
528 Ga0070684_100000161
529 Ga0070684_100069303
530 Ga0068853_100000550
531 Ga0068853_100028452
532 Ga0070672_100334991
533 Ga0070665_100000184
534 Ga0070665_100016838
535 Ga0070665_100055423
536 Ga0070665_100134576
537 Ga0068855_100000255
538 Ga0068855_100009681
539 Ga0068855_100261448
540 Ga0068855_100264223
541 Ga0070664_100247413
542 Ga0068857_100000590
543 Ga0068857_100002496
544 Ga0068857_100248322
545 Ga0068857_100325012
546 Ga0068854_100097703
547 Ga0068856_100002932
548 Ga0068856_100022734
549 Ga0068856_100083541
550 Ga0068856_100100194
551 Ga0068856_100114276
552 Ga0068852_100000004
553 Ga0068852_100000115
554 Ga0068859_100005449
555 Ga0068864_100000524
556 Ga0068864_100011734
557 Ga0068851_10002968
558 Ga0068870_10015235
559 Ga0068863_100000589
560 Ga0068863_100012299
561 Ga0068858_100001558
562 Ga0068860_100000853
563 Ga0068862_100010649
564 Ga0068862_100026327
565 Ga0097621_100002564
566 Ga0097621_100067539
567 Ga0068871_100000735
568 Ga0068871_100266009
569 Ga0097620_100005449
570 Ga0105240_10000001
571 Ga0105240_10000111
572 Ga0105240_10002651
573 Ga0105240_10014163
574 Ga0105240_10016696
575 Ga0105240_10025054
576 Ga0105240_10029383
577 Ga0105240_10057751
578 Ga0105240_10158089
579 Ga0105245_10000769
580 Ga0105245_10007445
581 Ga0105245_10017566
582 Ga0105245_10019750
583 Ga0105247_10000309
584 Ga0105243_10016748
585 Ga0105241_10000633
586 Ga0105241_10001362
587 Ga0105241_10010087
588 Ga0105241_10019444
589 Ga0105241_10174632
590 Ga0105242_10006874
591 Ga0105248_10000011
592 Ga0105248_10012263
593 Ga0105248_10103778
594 Ga0105248_10241952
595 Ga0105237_10002630
596 Ga0105237_10002839
597 Ga0105237_10057484
598 Ga0105238_10000383
599 Ga0105238_10000631
600 Ga0105238_10014930
601 Ga0105238_10019836
602 Ga0105238_10045667
603 Ga0105238_10353756
604 Ga0105238_10388929
605 Ga0105249_10040073
606 Ga0105249_10103630
607 Ga0105249_10149842
608 Ga0105239_10000737
609 Ga0105239_10002973
610 Ga0105239_10005827
611 Ga0105239_10049556
612 Ga0105239_10121130
613 Ga0105239_10173336
614 Ga0105246_10001302
615 Ga0105246_10065551
616 Ga0157370_10000016
617 Ga0157370_10021162
618 Ga0157370_10097563
619 Ga0157369_10000010
620 Ga0157369_10000182
621 Ga0157369_10000527
622 Ga0157369_10001496
623 Ga0157369_10023922
624 Ga0157369_10044419
625 Ga0157369_10048208
626 Ga0157369_10063224
627 Ga0157369_10198324
628 Ga0157369_10263534
629 Ga0157374_10001075
630 Ga0157374_10001087
631 Ga0157374_10008655
632 Ga0157374_10014112
633 Ga0157374_10032178
634 Ga0157378_10002149
635 Ga0157378_10010457
636 Ga0157378_10075019
637 Ga0163162_10015785
638 Ga0163162_10223792
639 Ga0157372_10000036
640 Ga0157372_10002675
641 Ga0157372_10003462
642 Ga0157372_10008962
643 Ga0157372_10011652
644 Ga0157372_10011710
645 Ga0157372_10017603
646 Ga0157372_10018756
647 Ga0157372_10022991
648 Ga0157372_10036493
649 Ga0157372_10058206
650 Ga0157375_10002123
651 Ga0157375_10003549
652 Ga0163163_10000015
653 Ga0163163_10001254
654 Ga0163163_10008106
655 Ga0163163_10035785
656 Ga0157379_10000549
657 Ga0157379_10001160
658 Ga0157376_10001719
659 Ga0157376_10004668
660 Ga0157376_10007102
661 Ga0157376_10114903
662 Ga0209437_103677
663 Ga0209233_1000732
664 Ga0209233_1021748
665 Ga0209455_1010389
666 Ga0209758_1000085
667 Ga0207710_10000259
668 Ga0207647_10016065
669 Ga0207645_10039428
670 Ga0207643_10036230
671 Ga0207705_10038868
672 Ga0207654_10000101
673 Ga0207654_10003407
674 Ga0207654_10020381
675 Ga0207654_10101922
676 Ga0207707_10053107
677 Ga0207707_10092803
678 Ga0207695_10000001
679 Ga0207695_10000050
680 Ga0207695_10000188
681 Ga0207695_10000332
682 Ga0207695_10010236
683 Ga0207695_10033897
684 Ga0207695_10151598
685 Ga0207695_10252118
686 Ga0207671_10001384
687 Ga0207671_10002433
688 Ga0207657_10013177
689 Ga0207657_10016772
690 Ga0207657_10023308
691 Ga0207649_10032653
692 Ga0207652_10004634
693 Ga0207652_10139401
694 Ga0207694_10000102
695 Ga0207694_10000965
696 Ga0207694_10022718
697 Ga0207694_10087635
698 Ga0207694_10112720
699 Ga0207650_10001984
700 Ga0207687_10002774
701 Ga0207687_10011090
702 Ga0207700_10007431
703 Ga0207644_10008502
704 Ga0207644_10013983
705 Ga0207690_10056226
706 Ga0207686_10016762
707 Ga0207709_10163296
708 Ga0207711_10000028
709 Ga0207711_10016525
710 Ga0207689_10001335
711 Ga0207661_10002706
712 Ga0207661_10023196
713 Ga0207661_10054648
714 Ga0207661_10112721
715 Ga0207667_10002277
716 Ga0207667_10004635
717 Ga0207667_10006935
718 Ga0207667_10012231
719 Ga0207667_10136268
720 Ga0207712_10114157
721 Ga0207640_10039373
722 Ga0207658_10002487
723 Ga0207677_10000798
724 Ga0207639_10000027
725 Ga0207678_10006398
726 Ga0207702_10001474
727 Ga0207702_10005113
728 Ga0207702_10054972
729 Ga0207641_10001119
730 Ga0207648_10025822
731 Ga0207676_10003661
732 Ga0207674_10000385
733 Ga0207674_10001812
734 Ga0207674_10163903
735 Ga0207674_10293908
736 Ga0207683_10117023
737 Ga0207698_10000008
738 Ga0207698_10000123
739 Ga0268266_10002268
740 Ga0268266_10002554
741 Ga0268266_10011330
742 Ga0268266_10023899
743 Ga0268266_10089544
744 Ga0268266_10369779
745 Ga0268265_10006954
746 Ga0268265_10079288
747 Ga0268264_10005386
748 Ga0265336_10029438
749 Ga0307515_10001513
750 Ga0265338_10001393
751 Ga0265338_10002775
752 Ga0265338_10023830
753 Ga0265338_10081542
754 Ga0265330_10000109
755 Ga0265330_10001640
756 Ga0265330_10022469
757 Ga0265332_10014119
758 Ga0265328_10030242
759 Ga0265325_10000806
760 Ga0265325_10002733
761 Ga0265340_10012894
762 Ga0265339_10004529
763 Ga0265339_10010966
764 Ga0265339_10044116
765 Ga0265339_10065264
766 Ga0265331_10027043
767 Ga0265316_10002545
768 Ga0265316_10006060
769 Ga0265316_10007944
770 Ga0265316_10032393
771 Ga0265316_10257274
772 Ga0265313_10005161
773 Ga0265313_10008547
774 Ga0265313_10012472
775 Ga0265313_10042005
776 Ga0265314_10000027
777 Ga0265314_10021521
778 Ga0265314_10055480
779 Ga0265314_10094101
780 Ga0265342_10000396
781 Ga0265342_10004149
782 Ga0265342_10004961
783 Ga0265342_10007783
784 Ga0265342_10014396
785 Ga0265342_10014521
786 Ga0307510_10045241
787 Ga0373953_0058268
788 Ga0373933_0061836
789 Ga0373937_0081799
790 Ga0395900_0223657
791 Ga0395898_0076139
792 Ga0395898_0139499
793 Ga0395901_0194532
794 Ga0395901_0388091
795 Ga0436365_0725595
796 Ga0466963_0003167
797 Ga0466967_0003740
798 Ga0495592_0053535
799 Ga0495629_0011149
800 Ga0495629_0090048
801 Ga0495651_0026802
802 Ga0495651_0033258
803 Ga0495650_0000009
804 Ga0495650_0006524
805 Ga0495580_0068042
806 Ga0495580_0139126
807 Ga0495582_0044600
808 Ga0495582_0060566
809 Ga0495662_0004056
810 Ga0495664_0013919
811 Ga0495585_0035865
812 Ga0495594_0000906
813 Ga0495594_0003677
814 Ga0495594_0076904
815 Ga0495583_0007938
816 Ga0495606_0055054
817 Ga0495628_0058968
818 Ga0495644_0000109
819 Ga0495642_0011153
820 Ga0495652_0005468
821 Ga0495652_0061767
822 Ga0495665_0024710
823 Ga0495640_0023530
824 Ga0495586_0011292
825 Ga0495645_0004760
826 Ga0495645_0063718
827 Ga0495667_0009997
828 Ga0495634_0014718
829 Ga0495611_0009927
830 Ga0495625_0002756
831 Ga0495625_0030194
832 Ga0495625_0062302
833 Ga0495635_0020001
834 Ga0495599_0025196
835 Ga0495623_0078577
836 Ga0495646_0013306
837 Ga0495669_0017285
838 Ga0495613_0005174
839 Ga0495613_0007647
840 Ga0495624_0009608
841 Ga0495649_0045719
842 Ga0495600_0031922
843 Ga0495581_0006539
844 Ga0495604_0008730
845 Ga0495604_0010493
846 Ga0495604_0024215
847 Ga0495674_0054578
848 Ga0495676_0061874
849 Ga0495686_0000009
850 Ga0495686_0001610
851 Ga0495686_0004813
852 Ga0495686_0009368
853 Ga0495686_0149451
854 Ga0495614_0015251
855 Ga0496104_0000072
856 Ga0496104_0009733
857 Ga0496105_0026383
858 Ga0496105_0104158
859 Ga0496114_0039435
860 Ga0496115_0176131
861 Ga0496116_0032665
862 Ga0496116_0090378
863 Ga0496120_0114583
864 Ga0496122_0007373
865 Ga0496122_0079934
866 Ga0496123_0016745
867 Ga0496124_0028270
868 Ga0496125_0001581
869 Ga0496126_0000074
870 Ga0496126_0003786
871 Ga0496126_0009009
872 Ga0501031_0001488
873 Ga0501031_0014948
874 Ga0501031_0040280
875 Ga0501032_0006524
876 Ga0501033_0004614
877 Ga0501033_0063902
878 Ga0501034_0034661
879 Ga0501034_0056091
880 Ga0501034_0121285
881 Ga0501034_0123842
882 Ga0501036_0000552
883 Ga0501036_0001290
884 Ga0501036_0134889
885 Ga0501037_0001039
886 Ga0501037_0002761
887 Ga0501037_0005671
888 Ga0501037_0111332
889 Ga0501037_0246327
890 Ga0501038_0004260
891 Ga0501038_0021715
892 Ga0501039_0005559
893 Ga0501039_0043411
894 Ga0501039_0181263
895 Ga0501042_0060857
896 Ga0501043_0004290
897 Ga0501043_0010185
898 Ga0501043_0079049
899 Ga0501043_0163674
900 Ga0501046_0000217
901 Ga0501046_0001415
902 Ga0501046_0021253
903 Ga0501046_0022500
904 Ga0501046_0030422
905 Ga0501047_0000630
906 Ga0501047_0001996
907 Ga0501047_0002481
908 Ga0501047_0017729
909 Ga0501048_0034627
910 Ga0501067_0005240
911 Ga0501068_0005578
912 Ga0501068_0083822
913 Ga0501069_0001899
914 Ga0501070_0006508
915 Ga0501070_0093794
916 Ga0501071_0056772
917 Ga0501073_0001319
918 Ga0501073_0008434
919 Ga0501073_0042213
920 Ga0501074_0004442
921 Ga0501079_0006166
922 Ga0501080_0034322
923 Ga0501080_0038570
924 Ga0501080_0082073
925 Ga0501083_0007616
926 Ga0501083_0010560
927 Ga0501083_0102809
928 Ga0501035_0002865
929 Ga0501035_0020899
930 Ga0501035_0047822
931 Ga0501035_0151782
932 Ga0501035_0153748
933 Ga0501044_0000753
934 Ga0501044_0016290
935 Ga0501044_0095600
936 Ga0501045_0039255
937 Ga0501045_0046847
938 Ga0500643_000003
939 Ga0500651_0000010
940 Ga0500595_000071
941 Ga0500595_004739
942 Ga0500568_0027666
943 Ga0500573_0000054
944 Ga0500622_0039378
945 Ga0501084_0006993
946 Ga0501084_0014055
947 Ga0501084_0197680
948 Ga0500661_005305
949 Ga0501082_0000640
950 Ga0501082_0176013
951 2524189940
952 2587742116
953 2595316262
954 2757572239
955 2787509594
956 2793183556
957 2821113440
958 2857459908
959 2884217502
960 2888583930
961 2889053625
962 2956899286
963 2971412704
964 3001269735
965 3006990794
966 8056538681

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22725

GFO_IDH_MocA_C3

GFO/IDH/MocA C-terminal domain

206

343

0.86

PF02894

GFO_IDH_MocA_C

Oxidoreductase family, C-terminal alpha/beta domain

210

400

0.72

Structural Annotation

Top 5 Hits

ID Description Score Start End
3u3x-assembly3.cif.gz_M crystal structure of a putative oxidoreductase from sinorhizobium meliloti 1021 0.9674 41 377
3u3x-assembly3.cif.gz_M crystal structure of a putative oxidoreductase from sinorhizobium meliloti 1021 0.9645 41 377
2p2s-assembly1.cif.gz_B crystal structure of putative oxidoreductase (yp_050235.1) from erwinia carotovora atroseptica scri1043 at 1.25 a resolution 0.9595 42 380
2p2s-assembly1.cif.gz_B crystal structure of putative oxidoreductase (yp_050235.1) from erwinia carotovora atroseptica scri1043 at 1.25 a resolution 0.9539 42 380
3ip3-assembly4.cif.gz_G structure of putative oxidoreductase (tm_0425) from thermotoga maritima 0.8856 43 376
ID Description Score Start End Superfamily
3u3xA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9507 41 161 3.40.50.720
3u3xG02 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.9507 160 377 3.30.360.10
3u3xG02 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.9458 160 377 3.30.360.10
2p2sB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9334 40 161 3.40.50.720
2p2sB02 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.9135 161 380 3.30.360.10
ID Description Score Start End GO Terms
AF-A0A7C5QIQ7-F1-model_v4 Gfo/Idh/MocA family oxidoreductase 0.9744 127 379
AF-A0A7C5QIQ7-F1-model_v4 Gfo/Idh/MocA family oxidoreductase 0.9552 127 379
AF-A0A847WEA4-F1-model_v4 Gfo/Idh/MocA family oxidoreductase 0.8929 43 382 GO:0000166
GO:0016491
AF-A0A847WEA4-F1-model_v4 Gfo/Idh/MocA family oxidoreductase 0.8878 43 382 GO:0000166
GO:0016491
AF-A0A4Q3G9I4-F1-model_v4 Gfo/Idh/MocA family oxidoreductase 0.8848 41 156 GO:0000166

Map