F452722

General Info

Members Datasets Scaffolds Average Seq Length
483 225 966 248

Family's Representative Sequence

Representative Sequence 3300005355|Ga0070671_100260820|Ga0070671_1002608201
Length 291
Sequence VGASIAACTNPTCTRRDDRIDRSQPWSHCASGTRVAEPYNLGVHPRFFAPEAQATGELITLPEEEAEHLTRVLRLGAGAAVRVFNGSGDEFESVVEAAAKDGVRVRLGDAREPAPEPRLQVTLAQAVLKGDKMDDVVRDAVMIGATAIRPILTARTETTLAILEKGRRQERWERVAISSAKQCGRAIVPPILEPVTFDAFIAFLLAKWLAGPALMLVEPGATKAAVTFAELDVEPPKAATVLVGPEGGWTPEEIEAAEAACRRVTMGGRTLRADTMGLIAISAIYSRWREF

Samples

Sample ID Description Type Environment
1 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
60 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
61 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
96 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
143 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
147 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
148 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
149 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
150 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
151 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
152 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
153 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
154 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
155 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
156 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
157 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
158 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
159 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
160 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
161 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
162 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
163 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
164 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
165 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
166 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
167 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
168 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
169 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
170 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
171 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
172 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
173 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
174 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
175 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
176 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
177 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
178 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
179 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
180 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
181 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
182 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
183 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
184 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
194 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
195 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
196 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
197 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
198 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
199 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
200 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
201 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
202 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
203 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
204 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
205 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
206 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
207 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
208 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
209 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
210 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
211 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
212 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
213 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
214 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
215 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
216 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
217 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
218 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
219 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
220 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
221 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
222 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
223 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
224 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
225 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.21
Nodule 0
Rhizoplane 3.73
Rhizosphere 96.07
Stem 0
Stem Tuber 0
Unclassified 14.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070671_100260820 3300005355 Bacteria 1473
2 Ga0065712_10071536 3300005290 Bacteria 5204
3 Ga0065712_10085156 3300005290 Unclassified 2715
4 Ga0065715_10113826 3300005293 Unclassified 2474
5 Ga0065715_10121208 3300005293 Bacteria 2236
6 Ga0065715_10303956 3300005293 Unclassified 1028
7 Ga0065707_10238186 3300005295 Unclassified 1165
8 Ga0070676_10239905 3300005328 Bacteria 1205
9 Ga0070683_100004994 3300005329 Bacteria 11013
10 Ga0070683_100317242 3300005329 Bacteria 1483
11 Ga0070690_100001355 3300005330 Bacteria 12739
12 Ga0070690_100002063 3300005330 Bacteria 10731
13 Ga0070690_100101448 3300005330 Bacteria 1909
14 Ga0070677_10011494 3300005333 Bacteria 3055
15 Ga0070677_10024425 3300005333 Bacteria 2247
16 Ga0068869_100057616 3300005334 Bacteria 2837
17 Ga0068869_100363998 3300005334 Unclassified 1182
18 Ga0070666_10062063 3300005335 Unclassified 2531
19 Ga0070666_10123590 3300005335 Bacteria 1795
20 Ga0070680_100092147 3300005336 Bacteria 2509
21 Ga0068868_100006588 3300005338 Bacteria 8232
22 Ga0070660_100014270 3300005339 Bacteria 5720
23 Ga0070689_100045935 3300005340 Bacteria 3364
24 Ga0070689_100050447 3300005340 Bacteria 3215
25 Ga0070687_100030502 3300005343 Bacteria 2636
26 Ga0070661_100013806 3300005344 Bacteria 5676
27 Ga0070661_100137266 3300005344 Bacteria 1841
28 Ga0070669_100003674 3300005353 Bacteria 11067
29 Ga0070669_100009166 3300005353 Bacteria 7052
30 Ga0070669_100014686 3300005353 Bacteria 5574
31 Ga0070675_100068697 3300005354 Bacteria 2935
32 Ga0070675_100077413 3300005354 Bacteria 2768
33 Ga0070675_100105374 3300005354 Bacteria 2379
34 Ga0070671_100008260 3300005355 Bacteria 8333
35 Ga0070671_100117738 3300005355 Bacteria 2234
36 Ga0070674_100005252 3300005356 Bacteria 7457
37 Ga0070674_100027829 3300005356 Bacteria 3707
38 Ga0070673_100018351 3300005364 Bacteria 4994
39 Ga0070673_100218157 3300005364 Bacteria 1650
40 Ga0070688_100003612 3300005365 Bacteria 7984
41 Ga0070688_100110303 3300005365 Bacteria 1829
42 Ga0070688_100242574 3300005365 Bacteria 1280
43 Ga0070667_100058580 3300005367 Bacteria 3256
44 Ga0070667_100287865 3300005367 Bacteria 1477
45 Ga0070667_100567590 3300005367 Bacteria 1044
46 Ga0070713_100305475 3300005436 Bacteria 1466
47 Ga0070701_10010196 3300005438 Bacteria 4145
48 Ga0070701_10080945 3300005438 Unclassified 1758
49 Ga0070701_10294885 3300005438 Bacteria 995
50 Ga0070711_100117866 3300005439 Unclassified 1959
51 Ga0070705_100000132 3300005440 Bacteria 43669
52 Ga0070705_100057595 3300005440 Bacteria 2293
53 Ga0070700_100059572 3300005441 Bacteria 2404
54 Ga0070700_100106664 3300005441 Bacteria 1855
55 Ga0070700_100144707 3300005441 Unclassified 1619
56 Ga0070700_100401298 3300005441 Unclassified 1031
57 Ga0070694_100000521 3300005444 Bacteria 21231
58 Ga0070694_100012553 3300005444 Bacteria 5270
59 Ga0070694_100098945 3300005444 Bacteria 2060
60 Ga0070678_100106802 3300005456 Bacteria 2182
61 Ga0070678_100137969 3300005456 Bacteria 1947
62 Ga0070678_100427473 3300005456 Bacteria 1156
63 Ga0070678_100554174 3300005456 Bacteria 1021
64 Ga0070662_100578989 3300005457 Unclassified 943
65 Ga0070681_10004275 3300005458 Bacteria 13557
66 Ga0068867_100009997 3300005459 Bacteria 6687
67 Ga0068867_100073883 3300005459 Unclassified 2554
68 Ga0068867_100205466 3300005459 Bacteria 1579
69 Ga0070707_100176820 3300005468 Bacteria 2080
70 Ga0070707_100290794 3300005468 Bacteria 1588
71 Ga0070698_100002674 3300005471 Bacteria 19668
72 Ga0070698_100072641 3300005471 Bacteria 3448
73 Ga0070699_100002887 3300005518 Bacteria 15304
74 Ga0070699_100119671 3300005518 Bacteria 2315
75 Ga0070679_100071982 3300005530 Bacteria 3449
76 Ga0070679_100105929 3300005530 Bacteria 2798
77 Ga0070684_100415117 3300005535 Bacteria 1242
78 Ga0070697_100094544 3300005536 Bacteria 2477
79 Ga0070672_100040895 3300005543 Bacteria 3560
80 Ga0070672_100062585 3300005543 Unclassified 2937
81 Ga0070672_100431608 3300005543 Bacteria 1133
82 Ga0070672_100642752 3300005543 Bacteria 926
83 Ga0070686_100010973 3300005544 Bacteria 5129
84 Ga0070686_100016057 3300005544 Bacteria 4350
85 Ga0070686_100119544 3300005544 Unclassified 1807
86 Ga0070686_100409109 3300005544 Bacteria 1034
87 Ga0070695_100000378 3300005545 Bacteria 22911
88 Ga0070696_100000507 3300005546 Bacteria 24594
89 Ga0070696_100003050 3300005546 Bacteria 11126
90 Ga0070696_100013643 3300005546 Bacteria 5454
91 Ga0070696_100192477 3300005546 Bacteria 1518
92 Ga0070696_100367220 3300005546 Bacteria 1118
93 Ga0070665_100003650 3300005548 Bacteria 16301
94 Ga0070665_100963295 3300005548 Unclassified 866
95 Ga0070704_100000982 3300005549 Bacteria 14516
96 Ga0070704_100110571 3300005549 Bacteria 2090
97 Ga0070704_100162893 3300005549 Bacteria 1766
98 Ga0070704_100740011 3300005549 Unclassified 875
99 Ga0068855_100038431 3300005563 Bacteria 5687
100 Ga0070664_100004567 3300005564 Bacteria 11109
101 Ga0070664_100227079 3300005564 Unclassified 1672
102 Ga0068857_100016769 3300005577 Bacteria 6418
103 Ga0068854_100028242 3300005578 Bacteria 3875
104 Ga0070702_100021393 3300005615 Bacteria 3403
105 Ga0068859_100054136 3300005617 Bacteria 4035
106 Ga0068859_100819574 3300005617 Bacteria 1018
107 Ga0068864_100062404 3300005618 Bacteria 3229
108 Ga0068864_100068591 3300005618 Bacteria 3081
109 Ga0068864_100159286 3300005618 Bacteria 2051
110 Ga0068864_100694285 3300005618 Bacteria 994
111 Ga0068866_10107603 3300005718 Unclassified 1550
112 Ga0068866_10110129 3300005718 Bacteria 1535
113 Ga0068861_100041765 3300005719 Bacteria 3435
114 Ga0068861_100116277 3300005719 Bacteria 2150
115 Ga0068861_100197927 3300005719 Bacteria 1685
116 Ga0068861_100502857 3300005719 Bacteria 1096
117 Ga0068870_10028201 3300005840 Bacteria 2817
118 Ga0068870_10287620 3300005840 Bacteria 1033
119 Ga0068863_100399526 3300005841 Bacteria 1344
120 Ga0068858_100020500 3300005842 Bacteria 6179
121 Ga0068858_100027744 3300005842 Bacteria 5261
122 Ga0068858_100032833 3300005842 Bacteria 4820
123 Ga0068858_100426830 3300005842 Bacteria 1275
124 Ga0068860_100020099 3300005843 Bacteria 6469
125 Ga0068860_100070984 3300005843 Bacteria 3311
126 Ga0068860_100222496 3300005843 Bacteria 1833
127 Ga0068860_100321760 3300005843 Archaea 1518
128 Ga0068862_100113399 3300005844 Bacteria 2381
129 Ga0068862_100174123 3300005844 Bacteria 1928
130 Ga0068862_100581059 3300005844 Bacteria 1073
131 Ga0081540_1073452 3300005983 Bacteria 1571
132 Ga0081539_10017844 3300005985 Bacteria 4955
133 Ga0070715_10021594 3300006163 Unclassified 2498
134 Ga0097621_100010501 3300006237 Bacteria 6780
135 Ga0097621_100070269 3300006237 Bacteria 2891
136 Ga0097621_100377822 3300006237 Unclassified 1265
137 Ga0068871_100001590 3300006358 Bacteria 15262
138 Ga0068871_100197605 3300006358 Bacteria 1735
139 Ga0075428_100005260 3300006844 Bacteria 14391
140 Ga0075428_100038407 3300006844 Bacteria 5268
141 Ga0075428_100143242 3300006844 Bacteria 2598
142 Ga0075428_100327733 3300006844 Bacteria 1645
143 Ga0075428_100342376 3300006844 Bacteria 1605
144 Ga0075428_100679011 3300006844 Bacteria 1098
145 Ga0075430_100002579 3300006846 Bacteria 15113
146 Ga0075430_100003365 3300006846 Bacteria 13389
147 Ga0075430_100020957 3300006846 Bacteria 5557
148 Ga0075430_100048427 3300006846 Unclassified 3589
149 Ga0075431_100000804 3300006847 Bacteria 27410
150 Ga0075431_100155109 3300006847 Unclassified 2356
151 Ga0075431_100320906 3300006847 Bacteria 1562
152 Ga0075431_100960574 3300006847 Unclassified 822
153 Ga0075433_10021491 3300006852 Bacteria 5412
154 Ga0075433_10072426 3300006852 Bacteria 3030
155 Ga0075434_100019510 3300006871 Bacteria 6563
156 Ga0075434_100030113 3300006871 Bacteria 5343
157 Ga0075434_100031114 3300006871 Bacteria 5260
158 Ga0075434_100050438 3300006871 Bacteria 4134
159 Ga0075434_100137117 3300006871 Bacteria 2466
160 Ga0075434_100181400 3300006871 Bacteria 2125
161 Ga0075429_100019522 3300006880 Bacteria 5873
162 Ga0075429_100171002 3300006880 Bacteria 1903
163 Ga0075429_100217400 3300006880 Unclassified 1674
164 Ga0075429_100628696 3300006880 Bacteria 940
165 Ga0068865_100026540 3300006881 Bacteria 3820
166 Ga0068865_100077607 3300006881 Bacteria 2374
167 Ga0068865_100382459 3300006881 Bacteria 1148
168 Ga0068865_100557887 3300006881 Bacteria 963
169 Ga0075436_100007354 3300006914 Bacteria 7527
170 Ga0075436_100165218 3300006914 Bacteria 1561
171 Ga0075436_100295541 3300006914 Bacteria 1160
172 Ga0075436_100318687 3300006914 Unclassified 1117
173 Ga0097620_100054134 3300006931 Bacteria 4035
174 Ga0097620_100819598 3300006931 Bacteria 1018
175 Ga0075435_100002722 3300007076 Bacteria 11799
176 Ga0075435_100006104 3300007076 Bacteria 8492
177 Ga0075435_100008856 3300007076 Bacteria 7249
178 Ga0075435_100023697 3300007076 Bacteria 4751
179 Ga0075435_100030615 3300007076 Bacteria 4233
180 Ga0075435_100037853 3300007076 Bacteria 3844
181 Ga0075435_100236498 3300007076 Bacteria 1553
182 Ga0105240_10097218 3300009093 Bacteria 3588
183 Ga0105240_10212421 3300009093 Bacteria 2260
184 Ga0111539_10003167 3300009094 Bacteria 21770
185 Ga0111539_10004803 3300009094 Bacteria 17626
186 Ga0111539_10009144 3300009094 Bacteria 12531
187 Ga0111539_10115674 3300009094 Bacteria 3145
188 Ga0111539_10122710 3300009094 Bacteria 3045
189 Ga0111539_10268135 3300009094 Bacteria 1988
190 Ga0111539_10710503 3300009094 Unclassified 1170
191 Ga0111539_10967308 3300009094 Bacteria 990
192 Ga0105245_10005017 3300009098 Bacteria 11637
193 Ga0105247_10142200 3300009101 Bacteria 1573
194 Ga0114129_10010695 3300009147 Bacteria 13087
195 Ga0114129_10019760 3300009147 Bacteria 9588
196 Ga0114129_10053853 3300009147 Bacteria 5643
197 Ga0114129_10063812 3300009147 Bacteria 5141
198 Ga0114129_10087449 3300009147 Bacteria 4321
199 Ga0114129_10164074 3300009147 Bacteria 3033
200 Ga0114129_10280612 3300009147 Bacteria 2226
201 Ga0105243_10017815 3300009148 Bacteria 5374
202 Ga0105243_10025238 3300009148 Bacteria 4539
203 Ga0105243_10204508 3300009148 Bacteria 1734
204 Ga0105242_10003163 3300009176 Bacteria 12859
205 Ga0105242_10114776 3300009176 Bacteria 2302
206 Ga0105242_10262997 3300009176 Unclassified 1559
207 Ga0105242_10280250 3300009176 Bacteria 1514
208 Ga0105242_10364627 3300009176 Bacteria 1338
209 Ga0105248_10020513 3300009177 Bacteria 7323
210 Ga0105248_10090633 3300009177 Bacteria 3443
211 Ga0105248_10217139 3300009177 Bacteria 2154
212 Ga0105248_11125971 3300009177 Bacteria 887
213 Ga0105238_10413505 3300009551 Bacteria 1343
214 Ga0105249_10013098 3300009553 Bacteria 7320
215 Ga0105249_10046032 3300009553 Bacteria 3970
216 Ga0105249_10069785 3300009553 Bacteria 3243
217 Ga0105249_10494752 3300009553 Unclassified 1267
218 Ga0105249_11060614 3300009553 Bacteria 880
219 Ga0105246_10542946 3300011119 Unclassified 995
220 Ga0157371_10430247 3300013102 Unclassified 968
221 Ga0157374_10004332 3300013296 Bacteria 11941
222 Ga0157374_10126449 3300013296 Bacteria 2471
223 Ga0157374_10433593 3300013296 Bacteria 1314
224 Ga0157378_10314244 3300013297 Bacteria 1520
225 Ga0163162_10415280 3300013306 Bacteria 1478
226 Ga0163162_11030093 3300013306 Bacteria 931
227 Ga0163162_11152517 3300013306 Unclassified 879
228 Ga0157375_10028898 3300013308 Bacteria 5205
229 Ga0157375_10099762 3300013308 Bacteria 2983
230 Ga0157375_11036868 3300013308 Unclassified 958
231 Ga0163163_10009842 3300014325 Bacteria 8567
232 Ga0163163_10071213 3300014325 Bacteria 3464
233 Ga0157380_10002213 3300014326 Bacteria 13085
234 Ga0157380_10013664 3300014326 Bacteria 5928
235 Ga0157380_10031761 3300014326 Bacteria 4056
236 Ga0157380_10203455 3300014326 Bacteria 1758
237 Ga0157380_10215504 3300014326 Bacteria 1714
238 Ga0157380_10879171 3300014326 Bacteria 920
239 Ga0157377_10012509 3300014745 Bacteria 4270
240 Ga0157379_10022061 3300014968 Bacteria 5642
241 Ga0157376_10075739 3300014969 Bacteria 2872
242 Ga0157376_10082004 3300014969 Bacteria 2770
243 Ga0157376_10633555 3300014969 Unclassified 1068
244 Ga0163161_10037212 3300017792 Bacteria 3488
245 Ga0163161_10341672 3300017792 Unclassified 1188
246 Ga0207682_10003257 3300025893 Bacteria 7103
247 Ga0207682_10005272 3300025893 Bacteria 5285
248 Ga0207642_10192991 3300025899 Bacteria 1119
249 Ga0207642_10199497 3300025899 Bacteria 1104
250 Ga0207688_10000499 3300025901 Bacteria 18848
251 Ga0207688_10075246 3300025901 Bacteria 1921
252 Ga0207680_10035874 3300025903 Bacteria 2852
253 Ga0207680_10146227 3300025903 Bacteria 1571
254 Ga0207680_10367594 3300025903 Bacteria 1012
255 Ga0207685_10054878 3300025905 Unclassified 1553
256 Ga0207643_10003447 3300025908 Bacteria 8505
257 Ga0207643_10010261 3300025908 Bacteria 5041
258 Ga0207643_10405289 3300025908 Unclassified 863
259 Ga0207705_10126694 3300025909 Bacteria 1898
260 Ga0207684_10147260 3300025910 Bacteria 2025
261 Ga0207695_10135134 3300025913 Bacteria 2420
262 Ga0207663_10087522 3300025916 Unclassified 2057
263 Ga0207660_10073240 3300025917 Bacteria 2497
264 Ga0207657_10118420 3300025919 Bacteria 2180
265 Ga0207652_10422926 3300025921 Bacteria 1201
266 Ga0207646_10239327 3300025922 Bacteria 1640
267 Ga0207681_10064933 3300025923 Unclassified 2522
268 Ga0207681_10074403 3300025923 Bacteria 2379
269 Ga0207681_10297461 3300025923 Bacteria 1276
270 Ga0207650_10002354 3300025925 Bacteria 13134
271 Ga0207659_10073572 3300025926 Bacteria 2502
272 Ga0207659_10143384 3300025926 Bacteria 1857
273 Ga0207659_10173126 3300025926 Bacteria 1704
274 Ga0207659_10352668 3300025926 Unclassified 1221
275 Ga0207687_10004936 3300025927 Bacteria 8854
276 Ga0207687_10056391 3300025927 Bacteria 2756
277 Ga0207700_10429025 3300025928 Bacteria 1162
278 Ga0207706_10005650 3300025933 Bacteria 11654
279 Ga0207706_10240126 3300025933 Bacteria 1584
280 Ga0207706_10534049 3300025933 Unclassified 1011
281 Ga0207706_10562687 3300025933 Unclassified 981
282 Ga0207706_10753924 3300025933 Bacteria 829
283 Ga0207686_10078911 3300025934 Bacteria 2142
284 Ga0207686_10539690 3300025934 Bacteria 910
285 Ga0207686_10641683 3300025934 Bacteria 839
286 Ga0207709_10015793 3300025935 Bacteria 4191
287 Ga0207709_10181705 3300025935 Bacteria 1486
288 Ga0207670_10043467 3300025936 Bacteria 2967
289 Ga0207669_10017650 3300025937 Bacteria 3667
290 Ga0207669_10177010 3300025937 Unclassified 1525
291 Ga0207669_10593816 3300025937 Bacteria 899
292 Ga0207704_10021501 3300025938 Bacteria 3438
293 Ga0207704_10096988 3300025938 Bacteria 1954
294 Ga0207704_10126142 3300025938 Unclassified 1763
295 Ga0207704_10478407 3300025938 Bacteria 999
296 Ga0207691_10026222 3300025940 Bacteria 5469
297 Ga0207691_10040464 3300025940 Bacteria 4305
298 Ga0207691_10257751 3300025940 Bacteria 1504
299 Ga0207691_10260945 3300025940 Bacteria 1494
300 Ga0207711_10138819 3300025941 Bacteria 2185
301 Ga0207689_10001511 3300025942 Bacteria 22145
302 Ga0207689_10040816 3300025942 Bacteria 3839
303 Ga0207689_10044587 3300025942 Bacteria 3667
304 Ga0207689_10339616 3300025942 Unclassified 1247
305 Ga0207661_10312529 3300025944 Bacteria 1411
306 Ga0207679_10049168 3300025945 Bacteria 3075
307 Ga0207679_10056730 3300025945 Bacteria 2893
308 Ga0207679_10063353 3300025945 Bacteria 2759
309 Ga0207679_10121786 3300025945 Bacteria 2078
310 Ga0207667_10452589 3300025949 Bacteria 1304
311 Ga0207651_10040618 3300025960 Bacteria 3080
312 Ga0207651_10047049 3300025960 Bacteria 2906
313 Ga0207651_10090822 3300025960 Bacteria 2234
314 Ga0207651_10129141 3300025960 Bacteria 1931
315 Ga0207651_10167500 3300025960 Bacteria 1729
316 Ga0207668_10165339 3300025972 Bacteria 1729
317 Ga0207658_10221177 3300025986 Bacteria 1593
318 Ga0207658_10236865 3300025986 Unclassified 1544
319 Ga0207677_10709393 3300026023 Bacteria 893
320 Ga0207703_10458598 3300026035 Bacteria 1192
321 Ga0207708_10219448 3300026075 Bacteria 1523
322 Ga0207702_10492905 3300026078 Bacteria 1194
323 Ga0207641_10019016 3300026088 Bacteria 5635
324 Ga0207641_10156381 3300026088 Bacteria 2069
325 Ga0207641_10419709 3300026088 Bacteria 1288
326 Ga0207648_10031065 3300026089 Bacteria 4724
327 Ga0207648_10502477 3300026089 Unclassified 1109
328 Ga0207648_10534614 3300026089 Bacteria 1075
329 Ga0207676_10018398 3300026095 Bacteria 5078
330 Ga0207676_10220707 3300026095 Unclassified 1688
331 Ga0207674_10023935 3300026116 Bacteria 6532
332 Ga0207675_100065200 3300026118 Bacteria 3404
333 Ga0207675_100263121 3300026118 Bacteria 1672
334 Ga0207675_100472642 3300026118 Unclassified 1245
335 Ga0207675_100595433 3300026118 Unclassified 1108
336 Ga0207675_100596464 3300026118 Bacteria 1107
337 Ga0207683_10012107 3300026121 Bacteria 7362
338 Ga0207683_10053652 3300026121 Bacteria 3535
339 Ga0207683_10100099 3300026121 Bacteria 2587
340 Ga0207683_10105102 3300026121 Bacteria 2524
341 Ga0207683_10269805 3300026121 Unclassified 1554
342 Ga0209966_1028959 3300027695 Bacteria 1114
343 Ga0209998_10023882 3300027717 Bacteria 1324
344 Ga0207428_10000236 3300027907 Bacteria 75764
345 Ga0207428_10008126 3300027907 Bacteria 9506
346 Ga0207428_10024438 3300027907 Bacteria 5073
347 Ga0207428_10052959 3300027907 Bacteria 3238
348 Ga0268266_10009263 3300028379 Bacteria 8684
349 Ga0268266_10370671 3300028379 Bacteria 1348
350 Ga0268265_10120992 3300028380 Bacteria 2156
351 Ga0268265_10134435 3300028380 Bacteria 2061
352 Ga0268264_10292242 3300028381 Archaea 1531
353 Ga0268264_10558012 3300028381 Unclassified 1124
354 Ga0268264_10595726 3300028381 Bacteria 1089
355 Ga0268264_10852991 3300028381 Bacteria 912
356 Ga0265332_10042569 3300031238 Bacteria 1963
357 Ga0307405_10049508 3300031731 Bacteria 2597
358 Ga0307413_10079004 3300031824 Bacteria 2101
359 Ga0307413_10349702 3300031824 Unclassified 1140
360 Ga0307413_10409180 3300031824 Unclassified 1065
361 Ga0307410_10134007 3300031852 Bacteria 1823
362 Ga0307406_10033799 3300031901 Bacteria 3132
363 Ga0307407_10047603 3300031903 Bacteria 2435
364 Ga0307407_10085183 3300031903 Bacteria 1922
365 Ga0307407_10259573 3300031903 Bacteria 1194
366 Ga0307412_10009489 3300031911 Bacteria 5586
367 Ga0307412_10423645 3300031911 Bacteria 1089
368 Ga0307409_100001170 3300031995 Bacteria 12527
369 Ga0307416_100222535 3300032002 Unclassified 1811
370 Ga0307416_100289344 3300032002 Unclassified 1621
371 Ga0307416_100560134 3300032002 Bacteria 1217
372 Ga0307414_10043542 3300032004 Unclassified 3059
373 Ga0307415_100185476 3300032126 Bacteria 1636
374 Ga0307415_100230933 3300032126 Bacteria 1490
375 Ga0373940_0031001 3300035088 Bacteria 1425
376 Ga0373949_0014514 3300035090 Bacteria 1755
377 Ga0373932_0008111 3300035112 Bacteria 2507
378 Ga0373933_0097171 3300035724 Bacteria 1824
379 Ga0373937_0835424 3300036401 Bacteria 869
380 Ga0439435_0000396 3300042436 Bacteria 6763
381 Ga0451576_0034311 3300045051 Bacteria 5390
382 Ga0451576_0067876 3300045051 Unclassified 3711
383 Ga0451576_0088070 3300045051 Bacteria 3229
384 Ga0466967_1034609 3300045976 Bacteria 818
385 Ga0495628_0115883 3300046516 Unclassified 2058
386 Ga0495643_0036414 3300046522 Bacteria 2703
387 Ga0495643_0206491 3300046522 Bacteria 940
388 Ga0495669_0088553 3300046684 Bacteria 1427
389 Ga0495670_0059967 3300046691 Bacteria 1911
390 Ga0495604_0092181 3300047317 Bacteria 2245
391 Ga0495636_0012489 3300047318 Bacteria 3363
392 Ga0496100_0039022 3300048903 Bacteria 3013
393 Ga0496101_0001325 3300048904 Bacteria 14825
394 Ga0496104_0031440 3300048907 Bacteria 4937
395 Ga0496104_0081082 3300048907 Bacteria 3094
396 Ga0496105_0264186 3300048908 Bacteria 1391
397 Ga0496106_0232545 3300048909 Bacteria 1472
398 Ga0496107_0142593 3300048910 Bacteria 1771
399 Ga0496107_0386290 3300048910 Unclassified 1041
400 Ga0496108_0567766 3300048911 Bacteria 989
401 Ga0496110_0191198 3300048913 Unclassified 1859
402 Ga0496111_0289542 3300048914 Bacteria 1215
403 Ga0496112_0033055 3300048915 Bacteria 5024
404 Ga0496112_0170064 3300048915 Bacteria 2144
405 Ga0496112_0779704 3300048915 Bacteria 881
406 Ga0496113_0130884 3300048916 Unclassified 1969
407 Ga0496114_0007918 3300048917 Bacteria 8409
408 Ga0496114_0166660 3300048917 Bacteria 1918
409 Ga0496115_0138765 3300048918 Bacteria 2005
410 Ga0501032_0223290 3300049569 Bacteria 1226
411 Ga0501033_0035273 3300049570 Unclassified 3751
412 Ga0501036_0019182 3300049572 Bacteria 5738
413 Ga0501036_0360384 3300049572 Bacteria 1214
414 Ga0501038_0335797 3300049574 Bacteria 1179
415 Ga0501040_0002616 3300049576 Bacteria 11600
416 Ga0501041_0002998 3300049577 Bacteria 9680
417 Ga0501042_0000533 3300049578 Bacteria 19905
418 Ga0501043_0032412 3300049579 Unclassified 4109
419 Ga0501046_0002001 3300049580 Bacteria 19343
420 Ga0501067_0274396 3300049583 Bacteria 939
421 Ga0501068_0158494 3300049584 Bacteria 1426
422 Ga0501071_0167117 3300049587 Bacteria 1646
423 Ga0501072_0010961 3300049588 Bacteria 6913
424 Ga0501074_0041942 3300049590 Unclassified 3312
425 Ga0501075_0000977 3300049591 Bacteria 18200
426 Ga0501076_0022177 3300049592 Bacteria 4879
427 Ga0501077_0415315 3300049593 Bacteria 861
428 Ga0501079_0002101 3300049741 Bacteria 14303
429 Ga0501079_0626936 3300049741 Bacteria 846
430 Ga0501080_0241198 3300049742 Bacteria 1650
431 Ga0501081_0000743 3300049743 Bacteria 19045
432 Ga0501081_0325412 3300049743 Bacteria 1130
433 Ga0501083_0112047 3300049744 Unclassified 1793
434 Ga0501045_0111699 3300049824 Bacteria 2026
435 nmdc:mga0k408_106479_c1 3300050493 Bacteria 1656
436 nmdc:mga05p37_154738_c2 3300050507 Bacteria 1157
437 nmdc:mga05p37_190544_c1 3300050507 Bacteria 2490
438 nmdc:mga05p37_302208_c1 3300050507 Unclassified 1901
439 nmdc:mga05p37_3094_c1 3300050507 Bacteria 19331
440 nmdc:mga05p37_3651_c1 3300050507 Bacteria 17997
441 nmdc:mga09592_101778_c1 3300050508 Bacteria 2461
442 nmdc:mga09592_348412_c1 3300050508 Bacteria 1282
443 nmdc:mga09592_52929_c1 3300050508 Bacteria 3426
444 nmdc:mga09592_6451_c1 3300050508 Bacteria 9556
445 nmdc:mga09592_651885_c1 3300050508 Unclassified 899
446 nmdc:mga09592_818876_c1 3300050508 Bacteria 787
447 nmdc:mga0qj67_18411_c1 3300050509 Bacteria 5323
448 nmdc:mga0qj67_213093_c1 3300050509 Bacteria 1568
449 nmdc:mga0qj67_226371_c1 3300050509 Unclassified 1518
450 nmdc:mga0qj67_87068_c1 3300050509 Bacteria 2506
451 nmdc:mga06r32_197030_c1 3300050510 Bacteria 2002
452 nmdc:mga06r32_254543_c1 3300050510 Bacteria 1744
453 nmdc:mga06r32_70049_c1 3300050510 Bacteria 3391
454 nmdc:mga08y16_129081_c1 3300050511 Bacteria 2630
455 nmdc:mga08y16_1887_c1 3300050511 Bacteria 21334
456 nmdc:mga08y16_348244_c1 3300050511 Bacteria 1522
457 nmdc:mga08y16_9138_c1 3300050511 Bacteria 10404
458 nmdc:mga0n895_1051_c1 3300050512 Bacteria 20103
459 nmdc:mga0n895_14865_c1 3300050512 Bacteria 7085
460 nmdc:mga0n895_20551_c1 3300050512 Bacteria 6159
461 nmdc:mga0n895_252850_c1 3300050512 Bacteria 1788
462 nmdc:mga0n895_26913_c1 3300050512 Bacteria 5456
463 nmdc:mga0n895_43646_c1 3300050512 Bacteria 4370
464 nmdc:mga0rr50_137339_c1 3300050513 Bacteria 1964
465 nmdc:mga0rr50_213741_c1 3300050513 Unclassified 1590
466 nmdc:mga0rr50_43955_c1 3300050513 Bacteria 3273
467 nmdc:mga0rr50_5_c1 3300050513 Bacteria 327169
468 nmdc:mga08x19_406_c1 3300050514 Bacteria 30257
469 nmdc:mga0a205_10557_c1 3300050515 Bacteria 8485
470 nmdc:mga0a205_133108_c1 3300050515 Bacteria 2387
471 nmdc:mga0a205_186247_c1 3300050515 Bacteria 1969
472 nmdc:mga0a205_22043_c1 3300050515 Bacteria 6029
473 Ga0495612_0126369 3300053078 Bacteria 1103
474 Ga0495595_0044249 3300053084 Bacteria 2045
475 Ga0495619_0056563 3300053085 Unclassified 2601
476 Ga0495619_0371207 3300053085 Unclassified 989
477 Ga0501084_0001070 3300054114 Bacteria 21297
478 Ga0590071_000013 3300059421 Bacteria 45701
479 Ga0590074_000181 3300059423 Bacteria 7888
480 Ga0590075_000712 3300059424 Bacteria 8815
481 Ga0590077_000096 3300059426 Bacteria 22897
482 Ga0501082_0003081 3300060353 Bacteria 14544
483 Ga0530510_0023763 3300061734 Bacteria 4369
484 Ga0070671_100260820
485 Ga0065712_10071536
486 Ga0065712_10085156
487 Ga0065715_10113826
488 Ga0065715_10121208
489 Ga0065715_10303956
490 Ga0065707_10238186
491 Ga0070676_10239905
492 Ga0070683_100004994
493 Ga0070683_100317242
494 Ga0070690_100001355
495 Ga0070690_100002063
496 Ga0070690_100101448
497 Ga0070677_10011494
498 Ga0070677_10024425
499 Ga0068869_100057616
500 Ga0068869_100363998
501 Ga0070666_10062063
502 Ga0070666_10123590
503 Ga0070680_100092147
504 Ga0068868_100006588
505 Ga0070660_100014270
506 Ga0070689_100045935
507 Ga0070689_100050447
508 Ga0070687_100030502
509 Ga0070661_100013806
510 Ga0070661_100137266
511 Ga0070669_100003674
512 Ga0070669_100009166
513 Ga0070669_100014686
514 Ga0070675_100068697
515 Ga0070675_100077413
516 Ga0070675_100105374
517 Ga0070671_100008260
518 Ga0070671_100117738
519 Ga0070674_100005252
520 Ga0070674_100027829
521 Ga0070673_100018351
522 Ga0070673_100218157
523 Ga0070688_100003612
524 Ga0070688_100110303
525 Ga0070688_100242574
526 Ga0070667_100058580
527 Ga0070667_100287865
528 Ga0070667_100567590
529 Ga0070713_100305475
530 Ga0070701_10010196
531 Ga0070701_10080945
532 Ga0070701_10294885
533 Ga0070711_100117866
534 Ga0070705_100000132
535 Ga0070705_100057595
536 Ga0070700_100059572
537 Ga0070700_100106664
538 Ga0070700_100144707
539 Ga0070700_100401298
540 Ga0070694_100000521
541 Ga0070694_100012553
542 Ga0070694_100098945
543 Ga0070678_100106802
544 Ga0070678_100137969
545 Ga0070678_100427473
546 Ga0070678_100554174
547 Ga0070662_100578989
548 Ga0070681_10004275
549 Ga0068867_100009997
550 Ga0068867_100073883
551 Ga0068867_100205466
552 Ga0070707_100176820
553 Ga0070707_100290794
554 Ga0070698_100002674
555 Ga0070698_100072641
556 Ga0070699_100002887
557 Ga0070699_100119671
558 Ga0070679_100071982
559 Ga0070679_100105929
560 Ga0070684_100415117
561 Ga0070697_100094544
562 Ga0070672_100040895
563 Ga0070672_100062585
564 Ga0070672_100431608
565 Ga0070672_100642752
566 Ga0070686_100010973
567 Ga0070686_100016057
568 Ga0070686_100119544
569 Ga0070686_100409109
570 Ga0070695_100000378
571 Ga0070696_100000507
572 Ga0070696_100003050
573 Ga0070696_100013643
574 Ga0070696_100192477
575 Ga0070696_100367220
576 Ga0070665_100003650
577 Ga0070665_100963295
578 Ga0070704_100000982
579 Ga0070704_100110571
580 Ga0070704_100162893
581 Ga0070704_100740011
582 Ga0068855_100038431
583 Ga0070664_100004567
584 Ga0070664_100227079
585 Ga0068857_100016769
586 Ga0068854_100028242
587 Ga0070702_100021393
588 Ga0068859_100054136
589 Ga0068859_100819574
590 Ga0068864_100062404
591 Ga0068864_100068591
592 Ga0068864_100159286
593 Ga0068864_100694285
594 Ga0068866_10107603
595 Ga0068866_10110129
596 Ga0068861_100041765
597 Ga0068861_100116277
598 Ga0068861_100197927
599 Ga0068861_100502857
600 Ga0068870_10028201
601 Ga0068870_10287620
602 Ga0068863_100399526
603 Ga0068858_100020500
604 Ga0068858_100027744
605 Ga0068858_100032833
606 Ga0068858_100426830
607 Ga0068860_100020099
608 Ga0068860_100070984
609 Ga0068860_100222496
610 Ga0068860_100321760
611 Ga0068862_100113399
612 Ga0068862_100174123
613 Ga0068862_100581059
614 Ga0081540_1073452
615 Ga0081539_10017844
616 Ga0070715_10021594
617 Ga0097621_100010501
618 Ga0097621_100070269
619 Ga0097621_100377822
620 Ga0068871_100001590
621 Ga0068871_100197605
622 Ga0075428_100005260
623 Ga0075428_100038407
624 Ga0075428_100143242
625 Ga0075428_100327733
626 Ga0075428_100342376
627 Ga0075428_100679011
628 Ga0075430_100002579
629 Ga0075430_100003365
630 Ga0075430_100020957
631 Ga0075430_100048427
632 Ga0075431_100000804
633 Ga0075431_100155109
634 Ga0075431_100320906
635 Ga0075431_100960574
636 Ga0075433_10021491
637 Ga0075433_10072426
638 Ga0075434_100019510
639 Ga0075434_100030113
640 Ga0075434_100031114
641 Ga0075434_100050438
642 Ga0075434_100137117
643 Ga0075434_100181400
644 Ga0075429_100019522
645 Ga0075429_100171002
646 Ga0075429_100217400
647 Ga0075429_100628696
648 Ga0068865_100026540
649 Ga0068865_100077607
650 Ga0068865_100382459
651 Ga0068865_100557887
652 Ga0075436_100007354
653 Ga0075436_100165218
654 Ga0075436_100295541
655 Ga0075436_100318687
656 Ga0097620_100054134
657 Ga0097620_100819598
658 Ga0075435_100002722
659 Ga0075435_100006104
660 Ga0075435_100008856
661 Ga0075435_100023697
662 Ga0075435_100030615
663 Ga0075435_100037853
664 Ga0075435_100236498
665 Ga0105240_10097218
666 Ga0105240_10212421
667 Ga0111539_10003167
668 Ga0111539_10004803
669 Ga0111539_10009144
670 Ga0111539_10115674
671 Ga0111539_10122710
672 Ga0111539_10268135
673 Ga0111539_10710503
674 Ga0111539_10967308
675 Ga0105245_10005017
676 Ga0105247_10142200
677 Ga0114129_10010695
678 Ga0114129_10019760
679 Ga0114129_10053853
680 Ga0114129_10063812
681 Ga0114129_10087449
682 Ga0114129_10164074
683 Ga0114129_10280612
684 Ga0105243_10017815
685 Ga0105243_10025238
686 Ga0105243_10204508
687 Ga0105242_10003163
688 Ga0105242_10114776
689 Ga0105242_10262997
690 Ga0105242_10280250
691 Ga0105242_10364627
692 Ga0105248_10020513
693 Ga0105248_10090633
694 Ga0105248_10217139
695 Ga0105248_11125971
696 Ga0105238_10413505
697 Ga0105249_10013098
698 Ga0105249_10046032
699 Ga0105249_10069785
700 Ga0105249_10494752
701 Ga0105249_11060614
702 Ga0105246_10542946
703 Ga0157371_10430247
704 Ga0157374_10004332
705 Ga0157374_10126449
706 Ga0157374_10433593
707 Ga0157378_10314244
708 Ga0163162_10415280
709 Ga0163162_11030093
710 Ga0163162_11152517
711 Ga0157375_10028898
712 Ga0157375_10099762
713 Ga0157375_11036868
714 Ga0163163_10009842
715 Ga0163163_10071213
716 Ga0157380_10002213
717 Ga0157380_10013664
718 Ga0157380_10031761
719 Ga0157380_10203455
720 Ga0157380_10215504
721 Ga0157380_10879171
722 Ga0157377_10012509
723 Ga0157379_10022061
724 Ga0157376_10075739
725 Ga0157376_10082004
726 Ga0157376_10633555
727 Ga0163161_10037212
728 Ga0163161_10341672
729 Ga0207682_10003257
730 Ga0207682_10005272
731 Ga0207642_10192991
732 Ga0207642_10199497
733 Ga0207688_10000499
734 Ga0207688_10075246
735 Ga0207680_10035874
736 Ga0207680_10146227
737 Ga0207680_10367594
738 Ga0207685_10054878
739 Ga0207643_10003447
740 Ga0207643_10010261
741 Ga0207643_10405289
742 Ga0207705_10126694
743 Ga0207684_10147260
744 Ga0207695_10135134
745 Ga0207663_10087522
746 Ga0207660_10073240
747 Ga0207657_10118420
748 Ga0207652_10422926
749 Ga0207646_10239327
750 Ga0207681_10064933
751 Ga0207681_10074403
752 Ga0207681_10297461
753 Ga0207650_10002354
754 Ga0207659_10073572
755 Ga0207659_10143384
756 Ga0207659_10173126
757 Ga0207659_10352668
758 Ga0207687_10004936
759 Ga0207687_10056391
760 Ga0207700_10429025
761 Ga0207706_10005650
762 Ga0207706_10240126
763 Ga0207706_10534049
764 Ga0207706_10562687
765 Ga0207706_10753924
766 Ga0207686_10078911
767 Ga0207686_10539690
768 Ga0207686_10641683
769 Ga0207709_10015793
770 Ga0207709_10181705
771 Ga0207670_10043467
772 Ga0207669_10017650
773 Ga0207669_10177010
774 Ga0207669_10593816
775 Ga0207704_10021501
776 Ga0207704_10096988
777 Ga0207704_10126142
778 Ga0207704_10478407
779 Ga0207691_10026222
780 Ga0207691_10040464
781 Ga0207691_10257751
782 Ga0207691_10260945
783 Ga0207711_10138819
784 Ga0207689_10001511
785 Ga0207689_10040816
786 Ga0207689_10044587
787 Ga0207689_10339616
788 Ga0207661_10312529
789 Ga0207679_10049168
790 Ga0207679_10056730
791 Ga0207679_10063353
792 Ga0207679_10121786
793 Ga0207667_10452589
794 Ga0207651_10040618
795 Ga0207651_10047049
796 Ga0207651_10090822
797 Ga0207651_10129141
798 Ga0207651_10167500
799 Ga0207668_10165339
800 Ga0207658_10221177
801 Ga0207658_10236865
802 Ga0207677_10709393
803 Ga0207703_10458598
804 Ga0207708_10219448
805 Ga0207702_10492905
806 Ga0207641_10019016
807 Ga0207641_10156381
808 Ga0207641_10419709
809 Ga0207648_10031065
810 Ga0207648_10502477
811 Ga0207648_10534614
812 Ga0207676_10018398
813 Ga0207676_10220707
814 Ga0207674_10023935
815 Ga0207675_100065200
816 Ga0207675_100263121
817 Ga0207675_100472642
818 Ga0207675_100595433
819 Ga0207675_100596464
820 Ga0207683_10012107
821 Ga0207683_10053652
822 Ga0207683_10100099
823 Ga0207683_10105102
824 Ga0207683_10269805
825 Ga0209966_1028959
826 Ga0209998_10023882
827 Ga0207428_10000236
828 Ga0207428_10008126
829 Ga0207428_10024438
830 Ga0207428_10052959
831 Ga0268266_10009263
832 Ga0268266_10370671
833 Ga0268265_10120992
834 Ga0268265_10134435
835 Ga0268264_10292242
836 Ga0268264_10558012
837 Ga0268264_10595726
838 Ga0268264_10852991
839 Ga0265332_10042569
840 Ga0307405_10049508
841 Ga0307413_10079004
842 Ga0307413_10349702
843 Ga0307413_10409180
844 Ga0307410_10134007
845 Ga0307406_10033799
846 Ga0307407_10047603
847 Ga0307407_10085183
848 Ga0307407_10259573
849 Ga0307412_10009489
850 Ga0307412_10423645
851 Ga0307409_100001170
852 Ga0307416_100222535
853 Ga0307416_100289344
854 Ga0307416_100560134
855 Ga0307414_10043542
856 Ga0307415_100185476
857 Ga0307415_100230933
858 Ga0373940_0031001
859 Ga0373949_0014514
860 Ga0373932_0008111
861 Ga0373933_0097171
862 Ga0373937_0835424
863 Ga0439435_0000396
864 Ga0451576_0034311
865 Ga0451576_0067876
866 Ga0451576_0088070
867 Ga0466967_1034609
868 Ga0495628_0115883
869 Ga0495643_0036414
870 Ga0495643_0206491
871 Ga0495669_0088553
872 Ga0495670_0059967
873 Ga0495604_0092181
874 Ga0495636_0012489
875 Ga0496100_0039022
876 Ga0496101_0001325
877 Ga0496104_0031440
878 Ga0496104_0081082
879 Ga0496105_0264186
880 Ga0496106_0232545
881 Ga0496107_0142593
882 Ga0496107_0386290
883 Ga0496108_0567766
884 Ga0496110_0191198
885 Ga0496111_0289542
886 Ga0496112_0033055
887 Ga0496112_0170064
888 Ga0496112_0779704
889 Ga0496113_0130884
890 Ga0496114_0007918
891 Ga0496114_0166660
892 Ga0496115_0138765
893 Ga0501032_0223290
894 Ga0501033_0035273
895 Ga0501036_0019182
896 Ga0501036_0360384
897 Ga0501038_0335797
898 Ga0501040_0002616
899 Ga0501041_0002998
900 Ga0501042_0000533
901 Ga0501043_0032412
902 Ga0501046_0002001
903 Ga0501067_0274396
904 Ga0501068_0158494
905 Ga0501071_0167117
906 Ga0501072_0010961
907 Ga0501074_0041942
908 Ga0501075_0000977
909 Ga0501076_0022177
910 Ga0501077_0415315
911 Ga0501079_0002101
912 Ga0501079_0626936
913 Ga0501080_0241198
914 Ga0501081_0000743
915 Ga0501081_0325412
916 Ga0501083_0112047
917 Ga0501045_0111699
918 nmdc:mga0k408_106479_c1
919 nmdc:mga05p37_154738_c2
920 nmdc:mga05p37_190544_c1
921 nmdc:mga05p37_302208_c1
922 nmdc:mga05p37_3094_c1
923 nmdc:mga05p37_3651_c1
924 nmdc:mga09592_101778_c1
925 nmdc:mga09592_348412_c1
926 nmdc:mga09592_52929_c1
927 nmdc:mga09592_6451_c1
928 nmdc:mga09592_651885_c1
929 nmdc:mga09592_818876_c1
930 nmdc:mga0qj67_18411_c1
931 nmdc:mga0qj67_213093_c1
932 nmdc:mga0qj67_226371_c1
933 nmdc:mga0qj67_87068_c1
934 nmdc:mga06r32_197030_c1
935 nmdc:mga06r32_254543_c1
936 nmdc:mga06r32_70049_c1
937 nmdc:mga08y16_129081_c1
938 nmdc:mga08y16_1887_c1
939 nmdc:mga08y16_348244_c1
940 nmdc:mga08y16_9138_c1
941 nmdc:mga0n895_1051_c1
942 nmdc:mga0n895_14865_c1
943 nmdc:mga0n895_20551_c1
944 nmdc:mga0n895_252850_c1
945 nmdc:mga0n895_26913_c1
946 nmdc:mga0n895_43646_c1
947 nmdc:mga0rr50_137339_c1
948 nmdc:mga0rr50_213741_c1
949 nmdc:mga0rr50_43955_c1
950 nmdc:mga0rr50_5_c1
951 nmdc:mga08x19_406_c1
952 nmdc:mga0a205_10557_c1
953 nmdc:mga0a205_133108_c1
954 nmdc:mga0a205_186247_c1
955 nmdc:mga0a205_22043_c1
956 Ga0495612_0126369
957 Ga0495595_0044249
958 Ga0495619_0056563
959 Ga0495619_0371207
960 Ga0501084_0001070
961 Ga0590071_000013
962 Ga0590074_000181
963 Ga0590075_000712
964 Ga0590077_000096
965 Ga0501082_0003081
966 Ga0530510_0023763

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF20260

PUA_4

RNA methyltransferase PUA domain

61

108

0.96

PF04452

Methyltrans_RNA

RNA methyltransferase domain

115

285

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vhy-assembly3.cif.gz_B crystal structure of haemophilus influenzae protein hi0303, pfam duf558 0.9064 1 243
5o96-assembly4.cif.gz_G structure of the putative methyltransferase lpg2936 from legionella pneumophila in complex with the bound cofactor sam 0.9046 3 241
4e8b-assembly1.cif.gz_A crystal structure of 16s rrna methyltransferase rsme from e.coli 0.9028 1 243
1nxz-assembly1.cif.gz_B x-ray crystal structure of protein yggj_haein of haemophilus influenzae. northeast structural genomics consortium target ir73. 0.8997 1 243
1vhy-assembly3.cif.gz_A crystal structure of haemophilus influenzae protein hi0303, pfam duf558 0.8996 1 243
ID Description Score Start End Superfamily
af_Q54SC0_1_67_2.40.240.20 Mainly Beta;Beta Barrel;Ribosomal Protein L25; Chain P;Hypothetical PUA domain-like; domain 1 0.932 1 65 2.40.240.20
5o96E02 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9209 72 241 3.40.1280.10
5vm8B02 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9047 72 243 3.40.1280.10
1vhyA01 Mainly Beta;Beta Barrel;Ribosomal Protein L25; Chain P;Hypothetical PUA domain-like; domain 1 0.9007 1 69 2.40.240.20
2egwA02 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.8942 72 239 3.40.1280.10
ID Description Score Start End GO Terms
AF-A0A2V8A9D5-F1-model_v4 Ribosomal RNA small subunit methyltransferase E (EC 2.1.1.193) 0.9872 1 244 GO:0005737
GO:0070042
GO:0070475
AF-A0A3N5NJ30-F1-model_v4 Ribosomal RNA small subunit methyltransferase E (EC 2.1.1.193) 0.9726 1 243 GO:0005737
GO:0070042
GO:0070475
AF-A0A3N5NJ30-F1-model_v4 Ribosomal RNA small subunit methyltransferase E (EC 2.1.1.193) 0.957 1 243 GO:0005737
GO:0070042
GO:0070475
AF-A0A356IFR9-F1-model_v4 16S rRNA (uracil(1498)-N(3))-methyltransferase (EC 2.1.1.193) 0.9534 2 149 GO:0005737
GO:0070042
GO:0070475
AF-A0A379BXG2-F1-model_v4 Ribosomal RNA small subunit methyltransferase E (16S rRNA m3U1498 methyltransferase) 0.9522 2 68 GO:0006364
GO:0008168
GO:0032259

Map