F452715

General Info

Members Datasets Scaffolds Average Seq Length
483 238 966 121

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_100392491|Ga0070683_1003924913
Length 143
Sequence VCIPSASSNGCLRICTERPIAQMPRLIEQPTVIAAAGTKPKQIEEFAGRVNSGHAGVSVARMVSPEGWTEPGQRPEFEEITLVLRGVLRVEHERGAIDVRAGQAVVTHPGEWVRYSSPEPGGAEYVAVCTPAFTPQSVHRDAH

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
66 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
67 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
68 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
72 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
73 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
74 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
75 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
76 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
81 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
83 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
89 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
90 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
91 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
99 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
100 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
101 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
102 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
103 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
151 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
152 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
153 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
154 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
155 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
156 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
157 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
158 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
159 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
160 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
161 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
162 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
163 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
164 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
165 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
166 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
167 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
168 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
169 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
170 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
171 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
172 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
173 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
174 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
175 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
176 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
177 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
178 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
179 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
180 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
181 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
182 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
183 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
184 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
185 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
186 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
187 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
188 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
189 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
190 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
191 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
192 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
193 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
194 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
195 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
196 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
197 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
204 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
205 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
206 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
207 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
208 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
209 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
210 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
211 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
212 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
213 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
214 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
215 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
216 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
217 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
218 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
221 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
222 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
223 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
224 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
225 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
226 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
227 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
228 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
229 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
230 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
231 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
232 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
233 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
234 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
235 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
236 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
237 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
238 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.59
Metatranscriptomes 0.41
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.24
Nodule 0
Rhizoplane 2.69
Rhizosphere 95.45
Stem 0
Stem Tuber 0
Unclassified 21.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100392491 3300005329 Bacteria 1323
2 JGI24751J29686_10018764 3300002459 Bacteria 1431
3 JGI24751J29686_10019744 3300002459 Bacteria 1395
4 Ga0058860_11787562 3300004801 Bacteria 1021
5 Ga0065715_10188186 3300005293 Bacteria 1432
6 Ga0065715_10273525 3300005293 Bacteria 1104
7 Ga0065707_10020064 3300005295 Bacteria 1857
8 Ga0065707_10128792 3300005295 Bacteria 1959
9 Ga0065707_10212935 3300005295 Bacteria 1252
10 Ga0070658_10222632 3300005327 Bacteria 1596
11 Ga0070676_10027845 3300005328 Bacteria 3208
12 Ga0070676_10217577 3300005328 Bacteria 1260
13 Ga0070676_10349367 3300005328 Bacteria 1016
14 Ga0070676_10764978 3300005328 Bacteria 710
15 Ga0070683_100148375 3300005329 Unclassified 2223
16 Ga0070690_100079025 3300005330 Bacteria 2150
17 Ga0070690_101041524 3300005330 Unclassified 646
18 Ga0070670_100038556 3300005331 Bacteria 4109
19 Ga0070670_100047890 3300005331 Unclassified 3679
20 Ga0070670_100098583 3300005331 Unclassified 2515
21 Ga0070670_100605334 3300005331 Unclassified 981
22 Ga0070670_101042574 3300005331 Bacteria 745
23 Ga0070677_10071342 3300005333 Bacteria 1462
24 Ga0070677_10203908 3300005333 Bacteria 956
25 Ga0068869_100083161 3300005334 Bacteria 2394
26 Ga0068869_100169605 3300005334 Unclassified 1704
27 Ga0068869_101297294 3300005334 Unclassified 642
28 Ga0070666_10047474 3300005335 Bacteria 2883
29 Ga0070666_10827546 3300005335 Bacteria 683
30 Ga0068868_100636476 3300005338 Bacteria 948
31 Ga0070689_100060694 3300005340 Bacteria 2940
32 Ga0070689_101477798 3300005340 Unclassified 615
33 Ga0070691_10030735 3300005341 Bacteria 2516
34 Ga0070691_10561227 3300005341 Bacteria 668
35 Ga0070687_100267144 3300005343 Bacteria 1070
36 Ga0070687_100702757 3300005343 Bacteria 706
37 Ga0070687_100706432 3300005343 Unclassified 705
38 Ga0070661_100336402 3300005344 Unclassified 1182
39 Ga0070661_100945216 3300005344 Bacteria 713
40 Ga0070661_101395490 3300005344 Unclassified 589
41 Ga0070692_10647543 3300005345 Bacteria 705
42 Ga0070669_100086938 3300005353 Bacteria 2337
43 Ga0070669_100114054 3300005353 Unclassified 2054
44 Ga0070669_100120020 3300005353 Bacteria 2004
45 Ga0070669_100173245 3300005353 Bacteria 1684
46 Ga0070675_100007525 3300005354 Bacteria 8417
47 Ga0070675_100018693 3300005354 Bacteria 5517
48 Ga0070675_100070200 3300005354 Bacteria 2903
49 Ga0070675_100432054 3300005354 Bacteria 1179
50 Ga0070675_100876752 3300005354 Unclassified 822
51 Ga0070671_100004527 3300005355 Bacteria 11012
52 Ga0070671_100162322 3300005355 Bacteria 1889
53 Ga0070671_101306767 3300005355 Unclassified 640
54 Ga0070671_101360148 3300005355 Bacteria 627
55 Ga0070674_100019026 3300005356 Bacteria 4356
56 Ga0070674_100117565 3300005356 Bacteria 1963
57 Ga0070674_100174398 3300005356 Bacteria 1642
58 Ga0070673_100002223 3300005364 Bacteria 11734
59 Ga0070673_100198571 3300005364 Bacteria 1727
60 Ga0070673_100296722 3300005364 Bacteria 1422
61 Ga0070673_102405340 3300005364 Unclassified 501
62 Ga0070688_100098465 3300005365 Unclassified 1924
63 Ga0070688_100148205 3300005365 Bacteria 1601
64 Ga0070688_101025964 3300005365 Unclassified 656
65 Ga0070659_100193282 3300005366 Bacteria 1673
66 Ga0070659_100920368 3300005366 Bacteria 765
67 Ga0070667_100352988 3300005367 Bacteria 1332
68 Ga0070667_101034239 3300005367 Bacteria 767
69 Ga0070701_10010142 3300005438 Bacteria 4155
70 Ga0070705_100218330 3300005440 Unclassified 1319
71 Ga0070705_100976810 3300005440 Bacteria 686
72 Ga0070700_100899824 3300005441 Bacteria 721
73 Ga0070694_100022646 3300005444 Bacteria 4029
74 Ga0070708_100275723 3300005445 Bacteria 1582
75 Ga0070663_100284690 3300005455 Bacteria 1318
76 Ga0070678_100209629 3300005456 Bacteria 1614
77 Ga0070678_101598129 3300005456 Unclassified 612
78 Ga0070678_101924348 3300005456 Unclassified 559
79 Ga0070662_100078381 3300005457 Unclassified 2454
80 Ga0070662_100122430 3300005457 Bacteria 1995
81 Ga0070662_100162618 3300005457 Bacteria 1747
82 Ga0070662_100231801 3300005457 Bacteria 1477
83 Ga0068867_100016938 3300005459 Bacteria 5178
84 Ga0068867_100108935 3300005459 Unclassified 2125
85 Ga0068867_100111506 3300005459 Unclassified 2102
86 Ga0068867_101377693 3300005459 Bacteria 653
87 Ga0070685_10141052 3300005466 Unclassified 1517
88 Ga0070698_100029307 3300005471 Bacteria 5713
89 Ga0070698_100089361 3300005471 Unclassified 3064
90 Ga0070699_100262359 3300005518 Unclassified 1545
91 Ga0070699_100961629 3300005518 Bacteria 783
92 Ga0070684_100225830 3300005535 Bacteria 1709
93 Ga0070684_101079269 3300005535 Unclassified 754
94 Ga0070697_100054672 3300005536 Bacteria 3245
95 Ga0070697_101734256 3300005536 Bacteria 559
96 Ga0068853_100737745 3300005539 Unclassified 941
97 Ga0070672_100061871 3300005543 Bacteria 2952
98 Ga0070672_100234921 3300005543 Bacteria 1541
99 Ga0070672_100382024 3300005543 Bacteria 1205
100 Ga0070672_100991285 3300005543 Bacteria 744
101 Ga0070672_101354217 3300005543 Bacteria 636
102 Ga0070686_100135997 3300005544 Bacteria 1705
103 Ga0070686_101608589 3300005544 Bacteria 550
104 Ga0070695_100002932 3300005545 Bacteria 9935
105 Ga0070695_100030635 3300005545 Bacteria 3351
106 Ga0070696_100253081 3300005546 Bacteria 1333
107 Ga0070693_100006941 3300005547 Bacteria 5507
108 Ga0070665_100116215 3300005548 Unclassified 2678
109 Ga0070704_100008808 3300005549 Bacteria 6071
110 Ga0068855_100215470 3300005563 Bacteria 2155
111 Ga0070664_100004264 3300005564 Bacteria 11493
112 Ga0070664_100212556 3300005564 Bacteria 1729
113 Ga0070664_100363752 3300005564 Bacteria 1318
114 Ga0070664_100383085 3300005564 Bacteria 1284
115 Ga0070664_100880894 3300005564 Bacteria 839
116 Ga0068857_100852025 3300005577 Bacteria 872
117 Ga0068854_100266709 3300005578 Bacteria 1373
118 Ga0068856_100180662 3300005614 Bacteria 2123
119 Ga0070702_100077588 3300005615 Unclassified 1980
120 Ga0070702_100120634 3300005615 Bacteria 1641
121 Ga0068852_100150650 3300005616 Unclassified 2162
122 Ga0068852_101418141 3300005616 Bacteria 717
123 Ga0068859_100014847 3300005617 Bacteria 7821
124 Ga0068859_100395248 3300005617 Unclassified 1478
125 Ga0068859_101551299 3300005617 Unclassified 731
126 Ga0068859_101588704 3300005617 Bacteria 722
127 Ga0068864_100083235 3300005618 Bacteria 2809
128 Ga0068864_100101242 3300005618 Bacteria 2555
129 Ga0068861_100030492 3300005719 Bacteria 3953
130 Ga0068861_100306279 3300005719 Unclassified 1378
131 Ga0068851_10030473 3300005834 Bacteria 2675
132 Ga0068851_10113156 3300005834 Bacteria 1451
133 Ga0068870_10179149 3300005840 Bacteria 1271
134 Ga0068863_100567987 3300005841 Bacteria 1121
135 Ga0068863_100603737 3300005841 Unclassified 1086
136 Ga0068863_101195877 3300005841 Unclassified 766
137 Ga0068858_100098331 3300005842 Bacteria 2729
138 Ga0068860_100106809 3300005843 Bacteria 2674
139 Ga0068862_100038316 3300005844 Bacteria 4065
140 Ga0075364_10175079 3300006051 Bacteria 1451
141 Ga0075432_10289053 3300006058 Bacteria 677
142 Ga0070715_10151046 3300006163 Bacteria 1138
143 Ga0075369_10084233 3300006186 Bacteria 1413
144 Ga0097621_101200212 3300006237 Bacteria 714
145 Ga0097621_101404616 3300006237 Unclassified 661
146 Ga0068871_100346865 3300006358 Bacteria 1312
147 Ga0068871_101123899 3300006358 Bacteria 735
148 Ga0068871_101703913 3300006358 Bacteria 598
149 Ga0075428_100037919 3300006844 Bacteria 5304
150 Ga0075428_100099527 3300006844 Unclassified 3170
151 Ga0075428_100137407 3300006844 Bacteria 2657
152 Ga0075430_100111799 3300006846 Bacteria 2277
153 Ga0075431_100377090 3300006847 Bacteria 1423
154 Ga0075431_100532602 3300006847 Bacteria 1163
155 Ga0075431_100624699 3300006847 Bacteria 1059
156 Ga0075433_10057613 3300006852 Bacteria 3396
157 Ga0075434_100005942 3300006871 Bacteria 11171
158 Ga0075434_101493191 3300006871 Bacteria 685
159 Ga0075434_101575367 3300006871 Bacteria 666
160 Ga0075429_100004943 3300006880 Bacteria 11479
161 Ga0075429_100842076 3300006880 Unclassified 803
162 Ga0068865_100138615 3300006881 Bacteria 1831
163 Ga0068865_100566540 3300006881 Bacteria 956
164 Ga0068865_100704565 3300006881 Bacteria 863
165 Ga0068865_101818050 3300006881 Bacteria 551
166 Ga0075436_100012050 3300006914 Bacteria 5931
167 Ga0097620_100014847 3300006931 Bacteria 7821
168 Ga0097620_100395248 3300006931 Unclassified 1478
169 Ga0097620_101551593 3300006931 Unclassified 731
170 Ga0097620_101588339 3300006931 Bacteria 722
171 Ga0075435_100001880 3300007076 Bacteria 13659
172 Ga0075435_100010837 3300007076 Bacteria 6675
173 Ga0075435_101532008 3300007076 Bacteria 585
174 Ga0111539_10176937 3300009094 Bacteria 2492
175 Ga0111539_10474431 3300009094 Bacteria 1457
176 Ga0105245_10135773 3300009098 Unclassified 2312
177 Ga0105245_10258387 3300009098 Bacteria 1694
178 Ga0105245_10337855 3300009098 Unclassified 1488
179 Ga0114129_10012873 3300009147 Bacteria 11904
180 Ga0114129_10013841 3300009147 Bacteria 11493
181 Ga0114129_10050693 3300009147 Bacteria 5830
182 Ga0114129_10277172 3300009147 Bacteria 2241
183 Ga0114129_11958668 3300009147 Bacteria 709
184 Ga0105243_10485954 3300009148 Bacteria 1166
185 Ga0105243_10630997 3300009148 Bacteria 1036
186 Ga0105243_12134781 3300009148 Bacteria 596
187 Ga0105243_12378871 3300009148 Bacteria 568
188 Ga0105241_10338689 3300009174 Unclassified 1302
189 Ga0105241_10422341 3300009174 Bacteria 1174
190 Ga0105242_10078373 3300009176 Bacteria 2758
191 Ga0105242_11445759 3300009176 Bacteria 716
192 Ga0105248_10070767 3300009177 Bacteria 3917
193 Ga0105248_10084635 3300009177 Bacteria 3567
194 Ga0105248_10201410 3300009177 Bacteria 2243
195 Ga0105248_10278049 3300009177 Bacteria 1885
196 Ga0105248_10285030 3300009177 Bacteria 1860
197 Ga0105248_10509201 3300009177 Bacteria 1357
198 Ga0105248_10730333 3300009177 Bacteria 1117
199 Ga0105238_12656031 3300009551 Unclassified 537
200 Ga0105249_10000075 3300009553 Bacteria 145150
201 Ga0105249_10507012 3300009553 Bacteria 1252
202 Ga0105249_10543643 3300009553 Unclassified 1211
203 Ga0105239_10234772 3300010375 Bacteria 2058
204 Ga0157370_10498532 3300013104 Unclassified 1118
205 Ga0157370_11661096 3300013104 Bacteria 574
206 Ga0157374_11988208 3300013296 Unclassified 608
207 Ga0157378_10097388 3300013297 Bacteria 2681
208 Ga0163162_10007839 3300013306 Bacteria 10407
209 Ga0163162_12946884 3300013306 Bacteria 547
210 Ga0163162_13327564 3300013306 Unclassified 514
211 Ga0157372_12168848 3300013307 Bacteria 638
212 Ga0157375_10173478 3300013308 Bacteria 2305
213 Ga0157375_10185101 3300013308 Unclassified 2235
214 Ga0157375_10818333 3300013308 Unclassified 1079
215 Ga0157375_10926920 3300013308 Bacteria 1014
216 Ga0157375_11310267 3300013308 Bacteria 852
217 Ga0157375_12101596 3300013308 Unclassified 672
218 Ga0163163_11592900 3300014325 Bacteria 714
219 Ga0157380_10137707 3300014326 Bacteria 2092
220 Ga0157380_10194189 3300014326 Bacteria 1795
221 Ga0157380_10597603 3300014326 Bacteria 1091
222 Ga0157380_10619761 3300014326 Bacteria 1074
223 Ga0157380_11834466 3300014326 Bacteria 666
224 Ga0157380_11971124 3300014326 Bacteria 645
225 Ga0157377_10892946 3300014745 Bacteria 664
226 Ga0157376_10476068 3300014969 Bacteria 1223
227 Ga0157376_10939722 3300014969 Bacteria 885
228 Ga0182007_10025330 3300015262 Bacteria 2068
229 Ga0163161_11682043 3300017792 Unclassified 562
230 Ga0224712_10031801 3300022467 Bacteria 1918
231 Ga0207682_10055813 3300025893 Bacteria 1643
232 Ga0207682_10077758 3300025893 Bacteria 1416
233 Ga0207682_10380074 3300025893 Bacteria 667
234 Ga0207642_10402408 3300025899 Bacteria 819
235 Ga0207688_10014368 3300025901 Bacteria 4307
236 Ga0207688_10149190 3300025901 Unclassified 1380
237 Ga0207688_10976022 3300025901 Bacteria 536
238 Ga0207680_10471541 3300025903 Bacteria 892
239 Ga0207647_10030162 3300025904 Bacteria 3501
240 Ga0207685_10121523 3300025905 Bacteria 1147
241 Ga0207645_10016482 3300025907 Bacteria 4891
242 Ga0207645_10479091 3300025907 Unclassified 841
243 Ga0207645_10762587 3300025907 Bacteria 658
244 Ga0207643_10125980 3300025908 Bacteria 1521
245 Ga0207705_10310257 3300025909 Unclassified 1211
246 Ga0207662_10019865 3300025918 Bacteria 3828
247 Ga0207662_10328146 3300025918 Bacteria 1023
248 Ga0207657_10388358 3300025919 Bacteria 1098
249 Ga0207681_10071526 3300025923 Unclassified 2420
250 Ga0207681_10152989 3300025923 Bacteria 1731
251 Ga0207681_11301689 3300025923 Bacteria 610
252 Ga0207650_10006357 3300025925 Bacteria 8045
253 Ga0207650_10087160 3300025925 Bacteria 2378
254 Ga0207650_10168847 3300025925 Bacteria 1738
255 Ga0207650_10534532 3300025925 Unclassified 982
256 Ga0207650_10569555 3300025925 Bacteria 950
257 Ga0207650_10759961 3300025925 Bacteria 820
258 Ga0207659_10014984 3300025926 Bacteria 5013
259 Ga0207659_10398396 3300025926 Bacteria 1151
260 Ga0207659_10755267 3300025926 Bacteria 834
261 Ga0207659_11102107 3300025926 Bacteria 683
262 Ga0207687_10193923 3300025927 Unclassified 1583
263 Ga0207687_11486942 3300025927 Bacteria 582
264 Ga0207644_10129555 3300025931 Bacteria 1930
265 Ga0207644_10182733 3300025931 Bacteria 1644
266 Ga0207644_10306391 3300025931 Bacteria 1281
267 Ga0207690_10576069 3300025932 Bacteria 917
268 Ga0207706_10040249 3300025933 Unclassified 4142
269 Ga0207706_10200705 3300025933 Bacteria 1749
270 Ga0207686_11488872 3300025934 Bacteria 558
271 Ga0207709_10364044 3300025935 Bacteria 1095
272 Ga0207709_10394681 3300025935 Bacteria 1056
273 Ga0207670_10053890 3300025936 Bacteria 2711
274 Ga0207669_10029955 3300025937 Bacteria 3018
275 Ga0207669_10045003 3300025937 Bacteria 2598
276 Ga0207704_10175994 3300025938 Unclassified 1541
277 Ga0207704_10638032 3300025938 Bacteria 876
278 Ga0207665_10578782 3300025939 Bacteria 875
279 Ga0207691_10012039 3300025940 Bacteria 8297
280 Ga0207691_10086872 3300025940 Unclassified 2806
281 Ga0207691_10165172 3300025940 Bacteria 1940
282 Ga0207691_10262790 3300025940 Bacteria 1488
283 Ga0207691_10265365 3300025940 Bacteria 1479
284 Ga0207711_10512877 3300025941 Bacteria 1118
285 Ga0207711_10911204 3300025941 Bacteria 817
286 Ga0207689_10079332 3300025942 Bacteria 2698
287 Ga0207689_10385275 3300025942 Unclassified 1168
288 Ga0207689_11698756 3300025942 Bacteria 523
289 Ga0207661_10045429 3300025944 Bacteria 3477
290 Ga0207661_10329468 3300025944 Bacteria 1374
291 Ga0207679_10075279 3300025945 Bacteria 2561
292 Ga0207679_10233805 3300025945 Bacteria 1553
293 Ga0207679_10352058 3300025945 Bacteria 1284
294 Ga0207679_10415264 3300025945 Bacteria 1186
295 Ga0207679_11476205 3300025945 Bacteria 624
296 Ga0207651_10012246 3300025960 Bacteria 4844
297 Ga0207651_11992866 3300025960 Unclassified 522
298 Ga0207668_10538546 3300025972 Bacteria 1010
299 Ga0207640_10478772 3300025981 Bacteria 1032
300 Ga0207658_10180911 3300025986 Bacteria 1745
301 Ga0207658_10191465 3300025986 Bacteria 1700
302 Ga0207677_10420243 3300026023 Unclassified 1138
303 Ga0207677_10617500 3300026023 Bacteria 953
304 Ga0207677_11066374 3300026023 Unclassified 735
305 Ga0207639_11564105 3300026041 Unclassified 619
306 Ga0207708_10032972 3300026075 Bacteria 3933
307 Ga0207708_10416845 3300026075 Bacteria 1113
308 Ga0207641_10486448 3300026088 Bacteria 1197
309 Ga0207641_10857946 3300026088 Unclassified 900
310 Ga0207641_11744667 3300026088 Bacteria 624
311 Ga0207648_10011389 3300026089 Bacteria 8382
312 Ga0207648_10052131 3300026089 Unclassified 3577
313 Ga0207676_10062256 3300026095 Bacteria 2959
314 Ga0207676_10108268 3300026095 Unclassified 2320
315 Ga0207676_10297634 3300026095 Bacteria 1472
316 Ga0207676_10426149 3300026095 Bacteria 1245
317 Ga0207674_10786408 3300026116 Bacteria 918
318 Ga0207675_100013392 3300026118 Bacteria 7653
319 Ga0207675_100200802 3300026118 Bacteria 1915
320 Ga0207683_10015952 3300026121 Bacteria 6394
321 Ga0207683_10021203 3300026121 Bacteria 5560
322 Ga0207683_10555677 3300026121 Bacteria 1061
323 Ga0207683_11464648 3300026121 Bacteria 631
324 Ga0207698_11805409 3300026142 Bacteria 627
325 Ga0268266_10564350 3300028379 Bacteria 1091
326 Ga0268265_10025056 3300028380 Bacteria 4229
327 Ga0268265_10328922 3300028380 Bacteria 1387
328 Ga0268264_10431050 3300028381 Unclassified 1273
329 Ga0307408_100033148 3300031548 Bacteria 3606
330 Ga0307408_100348100 3300031548 Bacteria 1256
331 Ga0307408_100701403 3300031548 Bacteria 910
332 Ga0307408_100990652 3300031548 Unclassified 774
333 Ga0307405_10001642 3300031731 Bacteria 9526
334 Ga0307405_10002340 3300031731 Bacteria 8331
335 Ga0307405_10037100 3300031731 Bacteria 2927
336 Ga0307405_10106290 3300031731 Bacteria 1893
337 Ga0307405_10221708 3300031731 Bacteria 1388
338 Ga0307405_10373940 3300031731 Unclassified 1107
339 Ga0307413_10028991 3300031824 Bacteria 3090
340 Ga0307413_10032221 3300031824 Bacteria 2968
341 Ga0307413_10183082 3300031824 Bacteria 1496
342 Ga0307413_10988091 3300031824 Bacteria 721
343 Ga0307413_11153621 3300031824 Unclassified 672
344 Ga0307410_10006333 3300031852 Bacteria 6378
345 Ga0307410_10027216 3300031852 Bacteria 3612
346 Ga0307410_10138371 3300031852 Bacteria 1798
347 Ga0307410_11391170 3300031852 Bacteria 616
348 Ga0307406_10000796 3300031901 Bacteria 17670
349 Ga0307406_10033749 3300031901 Bacteria 3134
350 Ga0307406_10727857 3300031901 Unclassified 831
351 Ga0307407_10027458 3300031903 Bacteria 3029
352 Ga0307407_10342939 3300031903 Bacteria 1055
353 Ga0307412_10000710 3300031911 Bacteria 19206
354 Ga0307412_10010214 3300031911 Bacteria 5404
355 Ga0307412_10451962 3300031911 Bacteria 1059
356 Ga0307409_100008364 3300031995 Bacteria 6274
357 Ga0307409_100075217 3300031995 Bacteria 2703
358 Ga0307409_100529782 3300031995 Bacteria 1152
359 Ga0307416_100015228 3300032002 Bacteria 5303
360 Ga0307416_100171092 3300032002 Bacteria 2022
361 Ga0307416_100306472 3300032002 Bacteria 1582
362 Ga0307416_100341963 3300032002 Unclassified 1509
363 Ga0307416_101458868 3300032002 Bacteria 790
364 Ga0307416_101870641 3300032002 Unclassified 704
365 Ga0307416_102124075 3300032002 Bacteria 663
366 Ga0307416_102578819 3300032002 Unclassified 606
367 Ga0307414_10004433 3300032004 Bacteria 7622
368 Ga0307414_10035728 3300032004 Unclassified 3310
369 Ga0307414_10365336 3300032004 Bacteria 1243
370 Ga0307414_11556375 3300032004 Bacteria 616
371 Ga0307414_11815761 3300032004 Unclassified 569
372 Ga0307411_10048832 3300032005 Bacteria 2745
373 Ga0307411_10185418 3300032005 Bacteria 1583
374 Ga0307411_10347930 3300032005 Unclassified 1207
375 Ga0307411_12091222 3300032005 Bacteria 530
376 Ga0307415_100002414 3300032126 Bacteria 9314
377 Ga0307415_100003576 3300032126 Bacteria 7936
378 Ga0307415_101159387 3300032126 Bacteria 726
379 Ga0373948_0022067 3300034817 Unclassified 1225
380 Ga0373941_0114977 3300035115 Unclassified 953
381 Ga0373960_0265675 3300035121 Unclassified 628
382 Ga0373942_0023698 3300035207 Bacteria 1569
383 Ga0373961_0108651 3300035241 Unclassified 906
384 Ga0373931_0483089 3300035691 Unclassified 797
385 Ga0373935_0006639 3300035692 Bacteria 6914
386 Ga0373937_1141107 3300036401 Unclassified 728
387 Ga0451787_830135 3300041441 Unclassified 540
388 Ga0451789_0547690 3300041443 Bacteria 522
389 Ga0451804_0472498 3300041463 Bacteria 582
390 Ga0451853_0747820 3300041512 Unclassified 608
391 Ga0451853_1654907 3300041512 Bacteria 785
392 Ga0439455_0034060 3300042012 Bacteria 1280
393 Ga0450916_009894 3300042530 Bacteria 1184
394 Ga0466964_0866972 3300044706 Bacteria 514
395 Ga0466958_0386308 3300045836 Bacteria 903
396 Ga0466967_2568268 3300045976 Bacteria 504
397 Ga0495638_0011997 3300046460 Bacteria 5954
398 Ga0495664_0656412 3300046477 Unclassified 621
399 Ga0495594_0018991 3300046499 Bacteria 3649
400 Ga0495628_0331424 3300046516 Bacteria 1122
401 Ga0495643_0003693 3300046522 Bacteria 11092
402 Ga0495621_0173012 3300046539 Unclassified 859
403 Ga0495645_0124442 3300046543 Bacteria 1813
404 Ga0495588_0272829 3300046674 Bacteria 891
405 Ga0495684_0282543 3300047471 Bacteria 1197
406 Ga0496101_0431381 3300048904 Bacteria 1039
407 Ga0496103_0383787 3300048906 Unclassified 903
408 Ga0496105_0558686 3300048908 Bacteria 892
409 Ga0496106_0282839 3300048909 Bacteria 1329
410 Ga0496107_0298555 3300048910 Bacteria 1199
411 Ga0496108_0210005 3300048911 Bacteria 1690
412 Ga0496108_0414177 3300048911 Unclassified 1177
413 Ga0496111_0360677 3300048914 Bacteria 1076
414 Ga0496113_0575922 3300048916 Unclassified 902
415 Ga0496114_0000048 3300048917 Bacteria 113554
416 Ga0501032_1037507 3300049569 Unclassified 515
417 Ga0501034_0005275 3300049571 Bacteria 14174
418 Ga0501034_0037037 3300049571 Bacteria 4940
419 Ga0501034_0561280 3300049571 Bacteria 1050
420 Ga0501041_0088911 3300049577 Bacteria 1907
421 Ga0501043_0133038 3300049579 Bacteria 1949
422 Ga0501043_0502234 3300049579 Bacteria 906
423 Ga0501046_0690110 3300049580 Bacteria 720
424 Ga0501047_0021135 3300049581 Bacteria 6250
425 Ga0501047_0336845 3300049581 Bacteria 1347
426 Ga0501070_0402267 3300049586 Unclassified 1107
427 Ga0501070_0640935 3300049586 Bacteria 844
428 Ga0501072_0111286 3300049588 Bacteria 2180
429 Ga0501073_0134769 3300049589 Bacteria 1712
430 Ga0501073_0482717 3300049589 Bacteria 857
431 Ga0501074_0768937 3300049590 Unclassified 679
432 Ga0501074_0812894 3300049590 Bacteria 658
433 Ga0501074_0996923 3300049590 Bacteria 589
434 Ga0501209_269978 3300049656 Bacteria 533
435 Ga0501216_060090 3300049660 Bacteria 765
436 Ga0501230_139540 3300049667 Bacteria 546
437 Ga0501235_028364 3300049669 Bacteria 1258
438 Ga0501239_033284 3300049672 Bacteria 685
439 Ga0501256_012873 3300049685 Bacteria 819
440 Ga0501259_170071 3300049688 Bacteria 548
441 Ga0501221_248354 3300049704 Bacteria 510
442 Ga0501079_0240321 3300049741 Bacteria 1415
443 Ga0501079_0642550 3300049741 Unclassified 835
444 Ga0501079_0713593 3300049741 Bacteria 789
445 Ga0501080_0882420 3300049742 Unclassified 780
446 Ga0501081_0243058 3300049743 Bacteria 1313
447 Ga0501081_0767131 3300049743 Bacteria 725
448 Ga0501044_0008028 3300049823 Bacteria 11597
449 Ga0501045_0268484 3300049824 Unclassified 1270
450 Ga0501212_054743 3300049851 Bacteria 681
451 nmdc:mga00v17_109054_c1 3300050491 Bacteria 1755
452 nmdc:mga00v17_79066_c1 3300050491 Bacteria 2050
453 nmdc:mga06z11_307796_c1 3300050494 Bacteria 943
454 nmdc:mga05p37_25091_c1 3300050507 Bacteria 7248
455 nmdc:mga05p37_37788_c1 3300050507 Bacteria 5922
456 nmdc:mga05p37_45330_c1 3300050507 Bacteria 5409
457 nmdc:mga09592_26456_c1 3300050508 Bacteria 4807
458 nmdc:mga0qj67_22111_c1 3300050509 Bacteria 4882
459 nmdc:mga06r32_1164016_c1 3300050510 Unclassified 718
460 nmdc:mga06r32_198617_c1 3300050510 Bacteria 1993
461 nmdc:mga06r32_375671_c1 3300050510 Bacteria 1404
462 nmdc:mga06r32_38885_c1 3300050510 Bacteria 4510
463 nmdc:mga06r32_493916_c1 3300050510 Bacteria 1201
464 nmdc:mga08y16_1617779_c1 3300050511 Bacteria 605
465 nmdc:mga08y16_388888_c1 3300050511 Bacteria 1429
466 nmdc:mga0n895_17276_c1 3300050512 Bacteria 6647
467 nmdc:mga0n895_719892_c1 3300050512 Bacteria 993
468 nmdc:mga0n895_771697_c1 3300050512 Bacteria 953
469 nmdc:mga0rr50_118262_c1 3300050513 Bacteria 2106
470 nmdc:mga0rr50_1471077_c1 3300050513 Bacteria 576
471 nmdc:mga08x19_270038_c1 3300050514 Bacteria 1177
472 nmdc:mga0a205_243782_c1 3300050515 Bacteria 1678
473 nmdc:mga0a205_312944_c1 3300050515 Bacteria 1442
474 nmdc:mga0sz30_231629_c1 3300050516 Bacteria 822
475 Ga0495601_0404524 3300053077 Bacteria 885
476 Ga0501084_0237700 3300054114 Bacteria 1538
477 Ga0501084_0578253 3300054114 Bacteria 949
478 Ga0501084_0802588 3300054114 Bacteria 793
479 Ga0501084_1024941 3300054114 Unclassified 693
480 Ga0590071_000246 3300059421 Bacteria 15808
481 Ga0590074_016217 3300059423 Unclassified 1268
482 Ga0590075_000041 3300059424 Bacteria 33435
483 Ga0590077_001465 3300059426 Bacteria 5516
484 Ga0070683_100392491
485 JGI24751J29686_10018764
486 JGI24751J29686_10019744
487 Ga0058860_11787562
488 Ga0065715_10188186
489 Ga0065715_10273525
490 Ga0065707_10020064
491 Ga0065707_10128792
492 Ga0065707_10212935
493 Ga0070658_10222632
494 Ga0070676_10027845
495 Ga0070676_10217577
496 Ga0070676_10349367
497 Ga0070676_10764978
498 Ga0070683_100148375
499 Ga0070690_100079025
500 Ga0070690_101041524
501 Ga0070670_100038556
502 Ga0070670_100047890
503 Ga0070670_100098583
504 Ga0070670_100605334
505 Ga0070670_101042574
506 Ga0070677_10071342
507 Ga0070677_10203908
508 Ga0068869_100083161
509 Ga0068869_100169605
510 Ga0068869_101297294
511 Ga0070666_10047474
512 Ga0070666_10827546
513 Ga0068868_100636476
514 Ga0070689_100060694
515 Ga0070689_101477798
516 Ga0070691_10030735
517 Ga0070691_10561227
518 Ga0070687_100267144
519 Ga0070687_100702757
520 Ga0070687_100706432
521 Ga0070661_100336402
522 Ga0070661_100945216
523 Ga0070661_101395490
524 Ga0070692_10647543
525 Ga0070669_100086938
526 Ga0070669_100114054
527 Ga0070669_100120020
528 Ga0070669_100173245
529 Ga0070675_100007525
530 Ga0070675_100018693
531 Ga0070675_100070200
532 Ga0070675_100432054
533 Ga0070675_100876752
534 Ga0070671_100004527
535 Ga0070671_100162322
536 Ga0070671_101306767
537 Ga0070671_101360148
538 Ga0070674_100019026
539 Ga0070674_100117565
540 Ga0070674_100174398
541 Ga0070673_100002223
542 Ga0070673_100198571
543 Ga0070673_100296722
544 Ga0070673_102405340
545 Ga0070688_100098465
546 Ga0070688_100148205
547 Ga0070688_101025964
548 Ga0070659_100193282
549 Ga0070659_100920368
550 Ga0070667_100352988
551 Ga0070667_101034239
552 Ga0070701_10010142
553 Ga0070705_100218330
554 Ga0070705_100976810
555 Ga0070700_100899824
556 Ga0070694_100022646
557 Ga0070708_100275723
558 Ga0070663_100284690
559 Ga0070678_100209629
560 Ga0070678_101598129
561 Ga0070678_101924348
562 Ga0070662_100078381
563 Ga0070662_100122430
564 Ga0070662_100162618
565 Ga0070662_100231801
566 Ga0068867_100016938
567 Ga0068867_100108935
568 Ga0068867_100111506
569 Ga0068867_101377693
570 Ga0070685_10141052
571 Ga0070698_100029307
572 Ga0070698_100089361
573 Ga0070699_100262359
574 Ga0070699_100961629
575 Ga0070684_100225830
576 Ga0070684_101079269
577 Ga0070697_100054672
578 Ga0070697_101734256
579 Ga0068853_100737745
580 Ga0070672_100061871
581 Ga0070672_100234921
582 Ga0070672_100382024
583 Ga0070672_100991285
584 Ga0070672_101354217
585 Ga0070686_100135997
586 Ga0070686_101608589
587 Ga0070695_100002932
588 Ga0070695_100030635
589 Ga0070696_100253081
590 Ga0070693_100006941
591 Ga0070665_100116215
592 Ga0070704_100008808
593 Ga0068855_100215470
594 Ga0070664_100004264
595 Ga0070664_100212556
596 Ga0070664_100363752
597 Ga0070664_100383085
598 Ga0070664_100880894
599 Ga0068857_100852025
600 Ga0068854_100266709
601 Ga0068856_100180662
602 Ga0070702_100077588
603 Ga0070702_100120634
604 Ga0068852_100150650
605 Ga0068852_101418141
606 Ga0068859_100014847
607 Ga0068859_100395248
608 Ga0068859_101551299
609 Ga0068859_101588704
610 Ga0068864_100083235
611 Ga0068864_100101242
612 Ga0068861_100030492
613 Ga0068861_100306279
614 Ga0068851_10030473
615 Ga0068851_10113156
616 Ga0068870_10179149
617 Ga0068863_100567987
618 Ga0068863_100603737
619 Ga0068863_101195877
620 Ga0068858_100098331
621 Ga0068860_100106809
622 Ga0068862_100038316
623 Ga0075364_10175079
624 Ga0075432_10289053
625 Ga0070715_10151046
626 Ga0075369_10084233
627 Ga0097621_101200212
628 Ga0097621_101404616
629 Ga0068871_100346865
630 Ga0068871_101123899
631 Ga0068871_101703913
632 Ga0075428_100037919
633 Ga0075428_100099527
634 Ga0075428_100137407
635 Ga0075430_100111799
636 Ga0075431_100377090
637 Ga0075431_100532602
638 Ga0075431_100624699
639 Ga0075433_10057613
640 Ga0075434_100005942
641 Ga0075434_101493191
642 Ga0075434_101575367
643 Ga0075429_100004943
644 Ga0075429_100842076
645 Ga0068865_100138615
646 Ga0068865_100566540
647 Ga0068865_100704565
648 Ga0068865_101818050
649 Ga0075436_100012050
650 Ga0097620_100014847
651 Ga0097620_100395248
652 Ga0097620_101551593
653 Ga0097620_101588339
654 Ga0075435_100001880
655 Ga0075435_100010837
656 Ga0075435_101532008
657 Ga0111539_10176937
658 Ga0111539_10474431
659 Ga0105245_10135773
660 Ga0105245_10258387
661 Ga0105245_10337855
662 Ga0114129_10012873
663 Ga0114129_10013841
664 Ga0114129_10050693
665 Ga0114129_10277172
666 Ga0114129_11958668
667 Ga0105243_10485954
668 Ga0105243_10630997
669 Ga0105243_12134781
670 Ga0105243_12378871
671 Ga0105241_10338689
672 Ga0105241_10422341
673 Ga0105242_10078373
674 Ga0105242_11445759
675 Ga0105248_10070767
676 Ga0105248_10084635
677 Ga0105248_10201410
678 Ga0105248_10278049
679 Ga0105248_10285030
680 Ga0105248_10509201
681 Ga0105248_10730333
682 Ga0105238_12656031
683 Ga0105249_10000075
684 Ga0105249_10507012
685 Ga0105249_10543643
686 Ga0105239_10234772
687 Ga0157370_10498532
688 Ga0157370_11661096
689 Ga0157374_11988208
690 Ga0157378_10097388
691 Ga0163162_10007839
692 Ga0163162_12946884
693 Ga0163162_13327564
694 Ga0157372_12168848
695 Ga0157375_10173478
696 Ga0157375_10185101
697 Ga0157375_10818333
698 Ga0157375_10926920
699 Ga0157375_11310267
700 Ga0157375_12101596
701 Ga0163163_11592900
702 Ga0157380_10137707
703 Ga0157380_10194189
704 Ga0157380_10597603
705 Ga0157380_10619761
706 Ga0157380_11834466
707 Ga0157380_11971124
708 Ga0157377_10892946
709 Ga0157376_10476068
710 Ga0157376_10939722
711 Ga0182007_10025330
712 Ga0163161_11682043
713 Ga0224712_10031801
714 Ga0207682_10055813
715 Ga0207682_10077758
716 Ga0207682_10380074
717 Ga0207642_10402408
718 Ga0207688_10014368
719 Ga0207688_10149190
720 Ga0207688_10976022
721 Ga0207680_10471541
722 Ga0207647_10030162
723 Ga0207685_10121523
724 Ga0207645_10016482
725 Ga0207645_10479091
726 Ga0207645_10762587
727 Ga0207643_10125980
728 Ga0207705_10310257
729 Ga0207662_10019865
730 Ga0207662_10328146
731 Ga0207657_10388358
732 Ga0207681_10071526
733 Ga0207681_10152989
734 Ga0207681_11301689
735 Ga0207650_10006357
736 Ga0207650_10087160
737 Ga0207650_10168847
738 Ga0207650_10534532
739 Ga0207650_10569555
740 Ga0207650_10759961
741 Ga0207659_10014984
742 Ga0207659_10398396
743 Ga0207659_10755267
744 Ga0207659_11102107
745 Ga0207687_10193923
746 Ga0207687_11486942
747 Ga0207644_10129555
748 Ga0207644_10182733
749 Ga0207644_10306391
750 Ga0207690_10576069
751 Ga0207706_10040249
752 Ga0207706_10200705
753 Ga0207686_11488872
754 Ga0207709_10364044
755 Ga0207709_10394681
756 Ga0207670_10053890
757 Ga0207669_10029955
758 Ga0207669_10045003
759 Ga0207704_10175994
760 Ga0207704_10638032
761 Ga0207665_10578782
762 Ga0207691_10012039
763 Ga0207691_10086872
764 Ga0207691_10165172
765 Ga0207691_10262790
766 Ga0207691_10265365
767 Ga0207711_10512877
768 Ga0207711_10911204
769 Ga0207689_10079332
770 Ga0207689_10385275
771 Ga0207689_11698756
772 Ga0207661_10045429
773 Ga0207661_10329468
774 Ga0207679_10075279
775 Ga0207679_10233805
776 Ga0207679_10352058
777 Ga0207679_10415264
778 Ga0207679_11476205
779 Ga0207651_10012246
780 Ga0207651_11992866
781 Ga0207668_10538546
782 Ga0207640_10478772
783 Ga0207658_10180911
784 Ga0207658_10191465
785 Ga0207677_10420243
786 Ga0207677_10617500
787 Ga0207677_11066374
788 Ga0207639_11564105
789 Ga0207708_10032972
790 Ga0207708_10416845
791 Ga0207641_10486448
792 Ga0207641_10857946
793 Ga0207641_11744667
794 Ga0207648_10011389
795 Ga0207648_10052131
796 Ga0207676_10062256
797 Ga0207676_10108268
798 Ga0207676_10297634
799 Ga0207676_10426149
800 Ga0207674_10786408
801 Ga0207675_100013392
802 Ga0207675_100200802
803 Ga0207683_10015952
804 Ga0207683_10021203
805 Ga0207683_10555677
806 Ga0207683_11464648
807 Ga0207698_11805409
808 Ga0268266_10564350
809 Ga0268265_10025056
810 Ga0268265_10328922
811 Ga0268264_10431050
812 Ga0307408_100033148
813 Ga0307408_100348100
814 Ga0307408_100701403
815 Ga0307408_100990652
816 Ga0307405_10001642
817 Ga0307405_10002340
818 Ga0307405_10037100
819 Ga0307405_10106290
820 Ga0307405_10221708
821 Ga0307405_10373940
822 Ga0307413_10028991
823 Ga0307413_10032221
824 Ga0307413_10183082
825 Ga0307413_10988091
826 Ga0307413_11153621
827 Ga0307410_10006333
828 Ga0307410_10027216
829 Ga0307410_10138371
830 Ga0307410_11391170
831 Ga0307406_10000796
832 Ga0307406_10033749
833 Ga0307406_10727857
834 Ga0307407_10027458
835 Ga0307407_10342939
836 Ga0307412_10000710
837 Ga0307412_10010214
838 Ga0307412_10451962
839 Ga0307409_100008364
840 Ga0307409_100075217
841 Ga0307409_100529782
842 Ga0307416_100015228
843 Ga0307416_100171092
844 Ga0307416_100306472
845 Ga0307416_100341963
846 Ga0307416_101458868
847 Ga0307416_101870641
848 Ga0307416_102124075
849 Ga0307416_102578819
850 Ga0307414_10004433
851 Ga0307414_10035728
852 Ga0307414_10365336
853 Ga0307414_11556375
854 Ga0307414_11815761
855 Ga0307411_10048832
856 Ga0307411_10185418
857 Ga0307411_10347930
858 Ga0307411_12091222
859 Ga0307415_100002414
860 Ga0307415_100003576
861 Ga0307415_101159387
862 Ga0373948_0022067
863 Ga0373941_0114977
864 Ga0373960_0265675
865 Ga0373942_0023698
866 Ga0373961_0108651
867 Ga0373931_0483089
868 Ga0373935_0006639
869 Ga0373937_1141107
870 Ga0451787_830135
871 Ga0451789_0547690
872 Ga0451804_0472498
873 Ga0451853_0747820
874 Ga0451853_1654907
875 Ga0439455_0034060
876 Ga0450916_009894
877 Ga0466964_0866972
878 Ga0466958_0386308
879 Ga0466967_2568268
880 Ga0495638_0011997
881 Ga0495664_0656412
882 Ga0495594_0018991
883 Ga0495628_0331424
884 Ga0495643_0003693
885 Ga0495621_0173012
886 Ga0495645_0124442
887 Ga0495588_0272829
888 Ga0495684_0282543
889 Ga0496101_0431381
890 Ga0496103_0383787
891 Ga0496105_0558686
892 Ga0496106_0282839
893 Ga0496107_0298555
894 Ga0496108_0210005
895 Ga0496108_0414177
896 Ga0496111_0360677
897 Ga0496113_0575922
898 Ga0496114_0000048
899 Ga0501032_1037507
900 Ga0501034_0005275
901 Ga0501034_0037037
902 Ga0501034_0561280
903 Ga0501041_0088911
904 Ga0501043_0133038
905 Ga0501043_0502234
906 Ga0501046_0690110
907 Ga0501047_0021135
908 Ga0501047_0336845
909 Ga0501070_0402267
910 Ga0501070_0640935
911 Ga0501072_0111286
912 Ga0501073_0134769
913 Ga0501073_0482717
914 Ga0501074_0768937
915 Ga0501074_0812894
916 Ga0501074_0996923
917 Ga0501209_269978
918 Ga0501216_060090
919 Ga0501230_139540
920 Ga0501235_028364
921 Ga0501239_033284
922 Ga0501256_012873
923 Ga0501259_170071
924 Ga0501221_248354
925 Ga0501079_0240321
926 Ga0501079_0642550
927 Ga0501079_0713593
928 Ga0501080_0882420
929 Ga0501081_0243058
930 Ga0501081_0767131
931 Ga0501044_0008028
932 Ga0501045_0268484
933 Ga0501212_054743
934 nmdc:mga00v17_109054_c1
935 nmdc:mga00v17_79066_c1
936 nmdc:mga06z11_307796_c1
937 nmdc:mga05p37_25091_c1
938 nmdc:mga05p37_37788_c1
939 nmdc:mga05p37_45330_c1
940 nmdc:mga09592_26456_c1
941 nmdc:mga0qj67_22111_c1
942 nmdc:mga06r32_1164016_c1
943 nmdc:mga06r32_198617_c1
944 nmdc:mga06r32_375671_c1
945 nmdc:mga06r32_38885_c1
946 nmdc:mga06r32_493916_c1
947 nmdc:mga08y16_1617779_c1
948 nmdc:mga08y16_388888_c1
949 nmdc:mga0n895_17276_c1
950 nmdc:mga0n895_719892_c1
951 nmdc:mga0n895_771697_c1
952 nmdc:mga0rr50_118262_c1
953 nmdc:mga0rr50_1471077_c1
954 nmdc:mga08x19_270038_c1
955 nmdc:mga0a205_243782_c1
956 nmdc:mga0a205_312944_c1
957 nmdc:mga0sz30_231629_c1
958 Ga0495601_0404524
959 Ga0501084_0237700
960 Ga0501084_0578253
961 Ga0501084_0802588
962 Ga0501084_1024941
963 Ga0590071_000246
964 Ga0590074_016217
965 Ga0590075_000041
966 Ga0590077_001465

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02311

AraC_binding

AraC-like ligand binding domain

64

142

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
3rns-assembly1.cif.gz_A cupin 2 conserved barrel domain protein from leptotrichia buccalis 0.9476 18 108
2dct-assembly1.cif.gz_A crystal structure of the tt1209 from thermus thermophilus hb8 0.92 33 111
3fjs-assembly2.cif.gz_D crystal structure of a putative biosynthetic protein with rmlc-like cupin fold (reut_b4087) from ralstonia eutropha jmp134 at 1.90 a resolution 0.9183 32 108
4ubg-assembly1.cif.gz_A resting state of rat cysteine dioxygenase c93g variant 0.9158 33 111
5uqp-assembly1.cif.gz_B the crystal structure of cupin protein from rhodococcus jostii rha1 0.9141 35 108
ID Description Score Start End Superfamily
af_P24174_373_472_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.936 33 120 2.60.120.10
3fjsA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9328 34 108 2.60.120.10
af_P91416_1_157_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9245 50 106 2.60.120.10
2dctB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.923 33 111 2.60.120.10
af_Q5RHD1_1_363_2.60.120.650 Mainly Beta;Sandwich;Jelly Rolls;Cupin 0.923 35 108 2.60.120.650
ID Description Score Start End GO Terms
AF-Q2IDL1-F1-model_v4 Cupin domain protein 1.001 1 120
AF-A0A6P0P3D4-F1-model_v4 Cupin domain-containing protein 1.001 1 121
AF-A0A3B8YZF2-F1-model_v4 Cupin 0.9999 1 119
AF-A0A812XGP2-F1-model_v4 deleted 0.9998 1 118
AF-A0A2U3L9B5-F1-model_v4 Cupin 2, conserved barrel domain protein 0.998 1 120

Map