F452689

General Info

Members Datasets Scaffolds Average Seq Length
482 231 964 156

Family's Representative Sequence

Representative Sequence 3300059647|Ga0587079_080222|Ga0587079_080222_175_720
Length 181
Sequence MVGPRVTPKFRPAGGVRHPCCSMEDMVMDRFDFSPLFRSTIGFDRLARLVDSATRVDSTALSYPPYNIEKTGEDSYRLTMAVAGFAQDELDVTVHENTLVVTGKAQKDDENGRYLHRGIARRAFERRFSLADHLKVTGASMDNGLLHVDLVREVPEEAKPKQIKIGNGEPQRPQVIEQKAA

Samples

Sample ID Description Type Environment
1 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
2 3300003305 Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
4 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
25 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
31 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
32 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
33 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
34 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
35 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
36 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
37 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
38 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
39 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
40 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
45 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
46 3300013045 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
47 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
48 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
49 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
50 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
51 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
52 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
53 3300019161 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA2 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
54 3300019162 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
55 3300019166 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
56 3300019176 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
57 3300019177 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZI1 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
58 3300019182 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE1 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
59 3300019183 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA1 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
60 3300019188 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE2 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
61 3300019190 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE3 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
62 3300019192 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA3 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
63 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
67 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
72 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
73 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
74 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
75 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
76 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300023536 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
78 3300023539 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
79 3300023547 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
80 3300023552 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
81 3300023660 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
82 3300023672 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
83 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
84 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
109 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
110 3300030762 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
111 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
112 3300030863 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
113 3300030877 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
114 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
115 3300030880 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
116 3300030882 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
117 3300030886 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
118 3300030888 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
119 3300030889 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
120 3300030963 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
121 3300031011 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
122 3300031043 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
123 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
124 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
125 3300031592 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA4 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
126 3300031614 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI4 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
127 3300031664 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
128 3300031686 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA6 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
129 3300031814 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
130 3300031828 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Unclassified
131 3300032120 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
132 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
133 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
134 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
135 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
136 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
137 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
138 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
139 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
140 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
141 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
142 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
143 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
144 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
145 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
146 3300036242 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
147 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
148 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
149 3300036458 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
150 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
151 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
152 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
153 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
154 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
155 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
156 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
157 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
158 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
159 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
160 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
161 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
162 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
163 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
164 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
165 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
166 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
167 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
168 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
169 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
170 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
171 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
172 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
173 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
174 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
175 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
176 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
177 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
178 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
179 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
180 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
181 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
182 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
183 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
184 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
185 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
186 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
187 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
188 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
189 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
190 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
191 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
192 3300049549 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
193 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
194 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
195 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
196 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
197 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
198 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
199 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
200 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
201 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
202 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
203 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
204 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
205 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
206 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
207 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
208 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
209 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
210 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
211 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
212 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
213 3300059514 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 106R_AW_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
214 3300059609 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 227R_SD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
215 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
216 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
217 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
218 3300059628 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
219 3300059631 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 168R_SD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
220 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
221 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
222 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
223 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
224 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
225 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
226 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
227 3300059654 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
228 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
229 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
230 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
231 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 58.51
Metatranscriptomes 41.49
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.41
Rhizosphere 91.29
Stem 0
Stem Tuber 0
Unclassified 9.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0587079_080222 3300059647 Bacteria 745
2 Ga0006770J48903_1009927 3300003305 Bacteria 604
3 Ga0006777J48905_1034004 3300003308 Bacteria 595
4 Ga0007417J51691_1016415 3300003544 Bacteria 603
5 Ga0058861_11854301 3300004800 Bacteria 604
6 Ga0058862_11975756 3300004803 Unclassified 589
7 Ga0070690_101450873 3300005330 Bacteria 553
8 Ga0070666_10984664 3300005335 Bacteria 625
9 Ga0070675_101105417 3300005354 Bacteria 729
10 Ga0070671_100129175 3300005355 Bacteria 2128
11 Ga0070671_100519906 3300005355 Bacteria 1025
12 Ga0070671_100827905 3300005355 Bacteria 807
13 Ga0070667_101686107 3300005367 Bacteria 596
14 Ga0070709_10040355 3300005434 Bacteria 2869
15 Ga0070709_10463613 3300005434 Unclassified 956
16 Ga0070714_100117869 3300005435 Bacteria 2358
17 Ga0070714_100203873 3300005435 Bacteria 1810
18 Ga0070714_100267851 3300005435 Bacteria 1583
19 Ga0070714_100874398 3300005435 Bacteria 872
20 Ga0070714_100988827 3300005435 Bacteria 818
21 Ga0070713_100055186 3300005436 Bacteria 3300
22 Ga0070713_100131049 3300005436 Bacteria 2211
23 Ga0070713_100154533 3300005436 Bacteria 2044
24 Ga0070713_100257593 3300005436 Bacteria 1593
25 Ga0070713_100420699 3300005436 Bacteria 1251
26 Ga0070713_100433894 3300005436 Bacteria 1231
27 Ga0070713_100543284 3300005436 Bacteria 1100
28 Ga0070713_100805594 3300005436 Bacteria 901
29 Ga0070710_10003584 3300005437 Bacteria 7361
30 Ga0070710_10457160 3300005437 Bacteria 866
31 Ga0070710_10594336 3300005437 Bacteria 769
32 Ga0070710_10631626 3300005437 Bacteria 749
33 Ga0070710_10673197 3300005437 Bacteria 727
34 Ga0070711_100111557 3300005439 Bacteria 2008
35 Ga0070711_101062171 3300005439 Bacteria 697
36 Ga0070711_101853350 3300005439 Bacteria 530
37 Ga0070708_100132139 3300005445 Bacteria 2311
38 Ga0070708_100420383 3300005445 Bacteria 1261
39 Ga0070681_10136250 3300005458 Bacteria 2386
40 Ga0070681_10502923 3300005458 Bacteria 1125
41 Ga0070681_10800261 3300005458 Bacteria 860
42 Ga0070706_100018301 3300005467 Bacteria 6465
43 Ga0070706_100136798 3300005467 Bacteria 2287
44 Ga0070706_100155815 3300005467 Bacteria 2132
45 Ga0070706_100221905 3300005467 Bacteria 1764
46 Ga0070706_100331725 3300005467 Bacteria 1418
47 Ga0070706_100350594 3300005467 Bacteria 1376
48 Ga0070706_100594189 3300005467 Bacteria 1029
49 Ga0070706_101168307 3300005467 Bacteria 708
50 Ga0070707_100006146 3300005468 Bacteria 11191
51 Ga0070698_100002879 3300005471 Bacteria 18935
52 Ga0070698_100022207 3300005471 Bacteria 6643
53 Ga0070698_100031058 3300005471 Bacteria 5539
54 Ga0070698_100045471 3300005471 Bacteria 4493
55 Ga0070698_100045574 3300005471 Bacteria 4488
56 Ga0070698_100095433 3300005471 Bacteria 2951
57 Ga0070698_101838575 3300005471 Bacteria 558
58 Ga0070699_100022426 3300005518 Bacteria 5440
59 Ga0070699_100058057 3300005518 Bacteria 3352
60 Ga0070699_100136893 3300005518 Bacteria 2161
61 Ga0070699_100204732 3300005518 Bacteria 1755
62 Ga0070699_102066132 3300005518 Bacteria 521
63 Ga0070679_100221882 3300005530 Bacteria 1851
64 Ga0070697_100118352 3300005536 Bacteria 2213
65 Ga0070697_100274872 3300005536 Bacteria 1444
66 Ga0070697_101616655 3300005536 Bacteria 579
67 Ga0070696_101276504 3300005546 Unclassified 623
68 Ga0070665_100695475 3300005548 Unclassified 1030
69 Ga0070704_101806603 3300005549 Bacteria 566
70 Ga0068856_100159164 3300005614 Bacteria 2268
71 Ga0068864_101266543 3300005618 Bacteria 737
72 Ga0081540_1020086 3300005983 Bacteria 4031
73 Ga0070717_10000696 3300006028 Bacteria 21691
74 Ga0070717_10005332 3300006028 Bacteria 9373
75 Ga0070717_10130192 3300006028 Bacteria 2163
76 Ga0070717_10168890 3300006028 Bacteria 1901
77 Ga0070717_10201044 3300006028 Bacteria 1745
78 Ga0070717_10215223 3300006028 Bacteria 1687
79 Ga0070717_11175946 3300006028 Unclassified 698
80 Ga0075432_10251030 3300006058 Bacteria 718
81 Ga0075432_10559076 3300006058 Unclassified 518
82 Ga0070715_10122907 3300006163 Bacteria 1240
83 Ga0070715_10579332 3300006163 Bacteria 655
84 Ga0070716_100090053 3300006173 Bacteria 1855
85 Ga0070716_100117887 3300006173 Bacteria 1656
86 Ga0070712_100096805 3300006175 Bacteria 2173
87 Ga0070712_100240460 3300006175 Bacteria 1442
88 Ga0070712_100404973 3300006175 Unclassified 1128
89 Ga0070712_100584918 3300006175 Unclassified 943
90 Ga0075433_11183822 3300006852 Bacteria 664
91 Ga0075434_100429839 3300006871 Unclassified 1342
92 Ga0075434_100441311 3300006871 Bacteria 1323
93 Ga0075434_101515186 3300006871 Bacteria 680
94 Ga0075436_100076118 3300006914 Bacteria 2324
95 Ga0075435_100071610 3300007076 Bacteria 2830
96 Ga0075435_101920838 3300007076 Bacteria 520
97 Ga0099795_10004776 3300007788 Bacteria 3532
98 Ga0105240_10153993 3300009093 Bacteria 2736
99 Ga0111539_11320323 3300009094 Bacteria 837
100 Ga0105245_11371269 3300009098 Unclassified 757
101 Ga0105243_10740631 3300009148 Bacteria 962
102 Ga0099796_10004450 3300010159 Bacteria 3390
103 Ga0099796_10167206 3300010159 Bacteria 875
104 Ga0154016_102500 3300013045 Bacteria 665
105 Ga0163162_10204536 3300013306 Bacteria 2103
106 Ga0157375_12828633 3300013308 Unclassified 580
107 Ga0163163_10448419 3300014325 Bacteria 1350
108 Ga0182008_10281716 3300014497 Bacteria 865
109 Ga0182007_10063121 3300015262 Bacteria 1214
110 Ga0182005_1105753 3300015265 Bacteria 792
111 Ga0184602_118868 3300019161 Bacteria 623
112 Ga0184602_122446 3300019161 Bacteria 547
113 Ga0184602_129311 3300019161 Bacteria 542
114 Ga0184597_103083 3300019162 Bacteria 582
115 Ga0184597_107388 3300019162 Bacteria 573
116 Ga0184597_109249 3300019162 Bacteria 549
117 Ga0184595_103857 3300019166 Bacteria 591
118 Ga0184596_103159 3300019176 Bacteria 609
119 Ga0184592_126466 3300019177 Bacteria 591
120 Ga0184598_103017 3300019182 Bacteria 572
121 Ga0184598_138103 3300019182 Unclassified 807
122 Ga0184598_142306 3300019182 Bacteria 585
123 Ga0184601_108599 3300019183 Bacteria 601
124 Ga0184601_112974 3300019183 Unclassified 576
125 Ga0184601_127431 3300019183 Bacteria 590
126 Ga0184601_136579 3300019183 Bacteria 560
127 Ga0184599_124199 3300019188 Bacteria 560
128 Ga0184599_131283 3300019188 Bacteria 561
129 Ga0184599_153516 3300019188 Bacteria 589
130 Ga0184600_101535 3300019190 Unclassified 680
131 Ga0184600_103883 3300019190 Bacteria 676
132 Ga0184600_121047 3300019190 Bacteria 839
133 Ga0184600_140066 3300019190 Bacteria 588
134 Ga0184603_103103 3300019192 Unclassified 581
135 Ga0184603_110364 3300019192 Bacteria 540
136 Ga0184603_115830 3300019192 Bacteria 755
137 Ga0184603_122954 3300019192 Bacteria 592
138 Ga0184603_137982 3300019192 Bacteria 924
139 Ga0197907_10095408 3300020069 Bacteria 580
140 Ga0197907_10293587 3300020069 Bacteria 618
141 Ga0197907_11127809 3300020069 Bacteria 570
142 Ga0206356_10496703 3300020070 Bacteria 803
143 Ga0206356_11676838 3300020070 Bacteria 581
144 Ga0206349_1120964 3300020075 Bacteria 582
145 Ga0206349_1481239 3300020075 Bacteria 601
146 Ga0206349_1696522 3300020075 Bacteria 586
147 Ga0206349_1907275 3300020075 Bacteria 531
148 Ga0206355_1299727 3300020076 Bacteria 572
149 Ga0206355_1536004 3300020076 Bacteria 586
150 Ga0206355_1673115 3300020076 Bacteria 955
151 Ga0206351_10242082 3300020077 Bacteria 646
152 Ga0206351_10365526 3300020077 Bacteria 535
153 Ga0206351_10455253 3300020077 Bacteria 539
154 Ga0206351_10462059 3300020077 Bacteria 641
155 Ga0206351_10510870 3300020077 Bacteria 575
156 Ga0206351_10832892 3300020077 Bacteria 654
157 Ga0206352_10624036 3300020078 Bacteria 577
158 Ga0206350_10018279 3300020080 Bacteria 627
159 Ga0206350_10178792 3300020080 Bacteria 582
160 Ga0206350_10647940 3300020080 Bacteria 543
161 Ga0206350_10661902 3300020080 Bacteria 641
162 Ga0206350_10753285 3300020080 Bacteria 577
163 Ga0206350_10927683 3300020080 Bacteria 548
164 Ga0206350_11203237 3300020080 Bacteria 675
165 Ga0206354_10405456 3300020081 Bacteria 575
166 Ga0206354_10489295 3300020081 Bacteria 552
167 Ga0206354_11032657 3300020081 Bacteria 608
168 Ga0154015_1023667 3300020610 Bacteria 559
169 Ga0154015_1156009 3300020610 Bacteria 578
170 Ga0154015_1259239 3300020610 Bacteria 758
171 Ga0154015_1462271 3300020610 Bacteria 575
172 Ga0154015_1682937 3300020610 Bacteria 685
173 Ga0213873_10019237 3300021358 Bacteria 1582
174 Ga0213874_10100926 3300021377 Unclassified 959
175 Ga0213874_10191208 3300021377 Bacteria 732
176 Ga0213876_10013691 3300021384 Bacteria 4301
177 Ga0213876_10170506 3300021384 Bacteria 1158
178 Ga0213876_10322604 3300021384 Bacteria 821
179 Ga0213875_10000412 3300021388 Bacteria 37606
180 Ga0213875_10005724 3300021388 Bacteria 6621
181 Ga0213875_10373970 3300021388 Bacteria 678
182 Ga0224712_10089517 3300022467 Bacteria 1287
183 Ga0224712_10145938 3300022467 Bacteria 1045
184 Ga0224712_10187903 3300022467 Bacteria 934
185 Ga0224712_10198661 3300022467 Bacteria 911
186 Ga0224712_10205463 3300022467 Bacteria 896
187 Ga0224712_10214941 3300022467 Bacteria 878
188 Ga0224712_10233395 3300022467 Bacteria 845
189 Ga0224712_10270693 3300022467 Bacteria 788
190 Ga0224712_10432841 3300022467 Bacteria 630
191 Ga0224712_10484840 3300022467 Bacteria 596
192 Ga0224712_10488349 3300022467 Bacteria 594
193 Ga0224712_10492580 3300022467 Bacteria 592
194 Ga0224712_10496740 3300022467 Bacteria 589
195 Ga0224712_10539452 3300022467 Bacteria 566
196 Ga0224712_10551668 3300022467 Bacteria 560
197 Ga0224712_10568156 3300022467 Bacteria 552
198 Ga0247552_101920 3300023536 Bacteria 645
199 Ga0247552_102474 3300023536 Unclassified 597
200 Ga0247552_102955 3300023536 Bacteria 572
201 Ga0247555_102775 3300023539 Bacteria 592
202 Ga0247555_103115 3300023539 Bacteria 576
203 Ga0247555_104374 3300023539 Bacteria 515
204 Ga0247554_101565 3300023547 Unclassified 802
205 Ga0247554_103977 3300023547 Bacteria 591
206 Ga0247554_104353 3300023547 Bacteria 578
207 Ga0247551_104236 3300023552 Unclassified 570
208 Ga0247550_100649 3300023660 Bacteria 951
209 Ga0247550_103443 3300023660 Bacteria 576
210 Ga0247550_104137 3300023660 Bacteria 545
211 Ga0247550_104174 3300023660 Bacteria 544
212 Ga0247550_104192 3300023660 Bacteria 543
213 Ga0247553_103242 3300023672 Bacteria 788
214 Ga0247553_104241 3300023672 Bacteria 721
215 Ga0247553_106068 3300023672 Bacteria 638
216 Ga0247553_108013 3300023672 Unclassified 582
217 Ga0247553_109121 3300023672 Bacteria 559
218 Ga0228598_1096006 3300024227 Bacteria 598
219 Ga0207692_10084188 3300025898 Bacteria 1708
220 Ga0207692_10170958 3300025898 Unclassified 1259
221 Ga0207692_10483588 3300025898 Bacteria 783
222 Ga0207692_10713910 3300025898 Bacteria 651
223 Ga0207680_10052982 3300025903 Bacteria 2434
224 Ga0207685_10064340 3300025905 Bacteria 1464
225 Ga0207685_10431954 3300025905 Bacteria 681
226 Ga0207685_10522859 3300025905 Bacteria 627
227 Ga0207699_10308733 3300025906 Bacteria 1106
228 Ga0207684_10031769 3300025910 Bacteria 4491
229 Ga0207684_10185286 3300025910 Bacteria 1795
230 Ga0207684_10533837 3300025910 Archaea 1004
231 Ga0207684_10626685 3300025910 Unclassified 917
232 Ga0207684_10897413 3300025910 Bacteria 745
233 Ga0207707_10246611 3300025912 Bacteria 1552
234 Ga0207707_10288243 3300025912 Bacteria 1421
235 Ga0207707_10676964 3300025912 Bacteria 868
236 Ga0207695_10815779 3300025913 Bacteria 813
237 Ga0207693_10039298 3300025915 Bacteria 3726
238 Ga0207693_10099331 3300025915 Bacteria 2282
239 Ga0207693_10199236 3300025915 Unclassified 1575
240 Ga0207693_10200275 3300025915 Bacteria 1570
241 Ga0207693_10865176 3300025915 Bacteria 695
242 Ga0207663_10127981 3300025916 Bacteria 1750
243 Ga0207663_10134053 3300025916 Bacteria 1716
244 Ga0207663_10138092 3300025916 Bacteria 1694
245 Ga0207663_10504796 3300025916 Unclassified 940
246 Ga0207663_10519076 3300025916 Bacteria 927
247 Ga0207649_11625883 3300025920 Bacteria 511
248 Ga0207652_10084536 3300025921 Bacteria 2780
249 Ga0207646_10007709 3300025922 Bacteria 10895
250 Ga0207646_10071167 3300025922 Bacteria 3106
251 Ga0207646_10114066 3300025922 Bacteria 2426
252 Ga0207681_10595826 3300025923 Unclassified 913
253 Ga0207700_10045252 3300025928 Bacteria 3246
254 Ga0207700_10225183 3300025928 Bacteria 1592
255 Ga0207700_10302749 3300025928 Bacteria 1381
256 Ga0207700_10375455 3300025928 Bacteria 1242
257 Ga0207700_10421822 3300025928 Bacteria 1172
258 Ga0207700_10532356 3300025928 Bacteria 1042
259 Ga0207700_10656553 3300025928 Bacteria 935
260 Ga0207664_10086254 3300025929 Bacteria 2564
261 Ga0207664_10110421 3300025929 Bacteria 2286
262 Ga0207664_10914022 3300025929 Bacteria 788
263 Ga0207664_11575659 3300025929 Bacteria 579
264 Ga0207644_10862481 3300025931 Unclassified 758
265 Ga0207670_10835104 3300025936 Bacteria 769
266 Ga0207665_10036574 3300025939 Bacteria 3266
267 Ga0207679_10252948 3300025945 Bacteria 1499
268 Ga0207640_10942488 3300025981 Unclassified 756
269 Ga0207677_10830291 3300026023 Bacteria 829
270 Ga0207703_10176164 3300026035 Bacteria 1884
271 Ga0207702_10014179 3300026078 Bacteria 6621
272 Ga0207702_10407762 3300026078 Bacteria 1312
273 Ga0207676_10549549 3300026095 Bacteria 1103
274 Ga0207428_11052542 3300027907 Bacteria 570
275 Ga0265762_1090290 3300030760 Bacteria 667
276 Ga0265762_1118331 3300030760 Bacteria 603
277 Ga0265775_111593 3300030762 Bacteria 565
278 Ga0265763_1019076 3300030763 Bacteria 708
279 Ga0265766_1016469 3300030863 Bacteria 579
280 Ga0265777_108324 3300030877 Bacteria 735
281 Ga0265777_115112 3300030877 Bacteria 600
282 Ga0265777_116934 3300030877 Bacteria 579
283 Ga0265777_121968 3300030877 Unclassified 532
284 Ga0265765_1019340 3300030879 Bacteria 814
285 Ga0265776_106411 3300030880 Bacteria 636
286 Ga0265776_108697 3300030880 Bacteria 581
287 Ga0265776_108849 3300030880 Bacteria 579
288 Ga0265776_109091 3300030880 Bacteria 574
289 Ga0265776_111566 3300030880 Bacteria 533
290 Ga0265776_112116 3300030880 Bacteria 525
291 Ga0265764_108295 3300030882 Bacteria 627
292 Ga0265764_109521 3300030882 Bacteria 600
293 Ga0265764_110409 3300030882 Bacteria 586
294 Ga0265764_111514 3300030882 Unclassified 572
295 Ga0265772_104760 3300030886 Bacteria 592
296 Ga0265772_106554 3300030886 Viruses 537
297 Ga0265769_111710 3300030888 Bacteria 613
298 Ga0265761_105674 3300030889 Bacteria 656
299 Ga0265761_108392 3300030889 Bacteria 579
300 Ga0265768_109767 3300030963 Bacteria 610
301 Ga0265774_104683 3300031011 Unclassified 580
302 Ga0265779_105051 3300031043 Bacteria 717
303 Ga0265779_109899 3300031043 Bacteria 578
304 Ga0265779_112261 3300031043 Bacteria 542
305 Ga0265760_10113856 3300031090 Bacteria 863
306 Ga0265760_10171507 3300031090 Bacteria 721
307 Ga0265760_10290353 3300031090 Bacteria 577
308 Ga0265325_10151169 3300031241 Unclassified 1098
309 Ga0310117_128278 3300031592 Unclassified 546
310 Ga0310117_128660 3300031592 Bacteria 542
311 Ga0310103_136127 3300031614 Bacteria 579
312 Ga0310118_117952 3300031664 Bacteria 579
313 Ga0310119_128533 3300031686 Bacteria 581
314 Ga0247548_108682 3300031814 Bacteria 517
315 Ga0316043_128366 3300031828 Bacteria 569
316 Ga0316053_107738 3300032120 Bacteria 717
317 Ga0316053_113478 3300032120 Bacteria 593
318 Ga0316053_115858 3300032120 Bacteria 563
319 Ga0316053_118873 3300032120 Bacteria 531
320 Ga0373959_0191064 3300034820 Bacteria 537
321 Ga0373926_0163342 3300035083 Bacteria 851
322 Ga0373926_0199987 3300035083 Bacteria 769
323 Ga0373934_0434877 3300035086 Bacteria 549
324 Ga0373944_0115623 3300035089 Bacteria 920
325 Ga0373951_0081728 3300035091 Bacteria 837
326 Ga0373923_0099775 3300035111 Unclassified 1279
327 Ga0373932_0016559 3300035112 Bacteria 1883
328 Ga0373953_0003310 3300035117 Bacteria 5001
329 Ga0373953_0007041 3300035117 Bacteria 3744
330 Ga0373953_0088319 3300035117 Bacteria 1295
331 Ga0373953_0254646 3300035117 Bacteria 763
332 Ga0373953_0267356 3300035117 Bacteria 744
333 Ga0373956_0072725 3300035119 Bacteria 1570
334 Ga0373956_0118896 3300035119 Bacteria 1233
335 Ga0373957_0003396 3300035120 Bacteria 4702
336 Ga0373957_0133150 3300035120 Bacteria 1013
337 Ga0373955_0100172 3300035172 Bacteria 1662
338 Ga0373955_0215559 3300035172 Bacteria 1145
339 Ga0373931_0046009 3300035691 Bacteria 2306
340 Ga0373931_0113381 3300035691 Bacteria 1541
341 Ga0373935_1121485 3300035692 Bacteria 586
342 Ga0373933_0010667 3300035724 Bacteria 5038
343 Ga0310104_12056 3300036242 Bacteria 689
344 Ga0310104_16017 3300036242 Bacteria 580
345 Ga0310104_16286 3300036242 Unclassified 574
346 Ga0373937_0003696 3300036401 Bacteria 12921
347 Ga0373937_0023547 3300036401 Bacteria 5545
348 Ga0373937_0025135 3300036401 Bacteria 5377
349 Ga0373937_0033180 3300036401 Bacteria 4687
350 Ga0373937_0349528 3300036401 Bacteria 1400
351 Ga0373937_1474085 3300036401 Bacteria 628
352 Ga0265778_027743 3300036457 Bacteria 723
353 Ga0265778_045390 3300036457 Bacteria 593
354 Ga0265778_046119 3300036457 Bacteria 589
355 Ga0265778_047828 3300036457 Bacteria 581
356 Ga0265778_050041 3300036457 Bacteria 570
357 Ga0265778_057453 3300036457 Bacteria 540
358 Ga0310112_046651 3300036458 Bacteria 587
359 Ga0373925_0096228 3300037068 Bacteria 2269
360 Ga0373925_0557554 3300037068 Bacteria 942
361 Ga0395900_1154498 3300037418 Bacteria 691
362 Ga0436364_0010736 3300037853 Bacteria 24036
363 Ga0436364_0066886 3300037853 Bacteria 936
364 Ga0436364_0525537 3300037853 Bacteria 2065
365 Ga0436364_0536950 3300037853 Bacteria 1237
366 Ga0436364_1048958 3300037853 Bacteria 780
367 Ga0436364_1266540 3300037853 Bacteria 46477
368 Ga0436364_1360422 3300037853 Bacteria 15324
369 Ga0436364_1371474 3300037853 Bacteria 700
370 Ga0436364_1390939 3300037853 Bacteria 1778
371 Ga0436364_1495326 3300037853 Bacteria 757
372 Ga0436365_0170453 3300039437 Bacteria 2050
373 Ga0436365_0173805 3300039437 Bacteria 1069
374 Ga0436365_0284017 3300039437 Bacteria 3824
375 Ga0436365_0548789 3300039437 Bacteria 1244
376 Ga0436365_0689990 3300039437 Bacteria 1675
377 Ga0436365_0763987 3300039437 Bacteria 1922
378 Ga0436365_0869707 3300039437 Bacteria 1140
379 Ga0436365_1087876 3300039437 Bacteria 1118
380 Ga0436365_1710668 3300039437 Bacteria 1994
381 Ga0436360_0093777 3300039438 Bacteria 7387
382 Ga0436360_0254657 3300039438 Bacteria 584
383 Ga0436360_0377102 3300039438 Bacteria 1042
384 Ga0436360_0817203 3300039438 Bacteria 1029
385 Ga0436360_1321651 3300039438 Bacteria 1265
386 Ga0436361_1037309 3300039447 Unclassified 871
387 Ga0436363_0783918 3300039450 Bacteria 552
388 Ga0436363_0824345 3300039450 Bacteria 1398
389 Ga0436363_0832611 3300039450 Bacteria 1297
390 Ga0436362_0638410 3300039453 Bacteria 907
391 Ga0436362_0756207 3300039453 Bacteria 828
392 Ga0466963_0091540 3300044694 Bacteria 2072
393 Ga0466957_0557599 3300044842 Bacteria 799
394 Ga0495592_0016968 3300046454 Bacteria 5528
395 Ga0495592_0332867 3300046454 Bacteria 978
396 Ga0495651_0800053 3300046462 Bacteria 582
397 Ga0495653_0256684 3300046463 Bacteria 1158
398 Ga0495580_0030065 3300046472 Bacteria 3936
399 Ga0495639_0410921 3300046475 Bacteria 684
400 Ga0495662_0017062 3300046476 Bacteria 3514
401 Ga0495664_0473924 3300046477 Bacteria 749
402 Ga0495628_0267033 3300046516 Bacteria 1274
403 Ga0495630_0722463 3300046517 Bacteria 762
404 Ga0495652_0367650 3300046529 Bacteria 1026
405 Ga0495586_0402928 3300046535 Bacteria 787
406 Ga0495587_0193299 3300046536 Bacteria 1152
407 Ga0495667_0178314 3300046559 Bacteria 1364
408 Ga0495635_0339112 3300046663 Bacteria 1004
409 Ga0495657_0263381 3300046675 Bacteria 1035
410 Ga0495657_0375723 3300046675 Bacteria 839
411 Ga0495599_0506109 3300046678 Bacteria 710
412 Ga0495623_0263305 3300046679 Bacteria 965
413 Ga0495658_0354546 3300046683 Bacteria 933
414 Ga0495600_0078424 3300046809 Bacteria 2157
415 Ga0495600_0491396 3300046809 Unclassified 755
416 Ga0495680_0291477 3300047322 Bacteria 1148
417 Ga0495680_0333461 3300047322 Bacteria 1059
418 Ga0495675_0253600 3300047444 Bacteria 1056
419 Ga0495684_0250671 3300047471 Bacteria 1288
420 Ga0496109_0391488 3300048912 Bacteria 1313
421 Ga0496113_0181823 3300048916 Bacteria 1667
422 Ga0501306_074419 3300049127 Bacteria 577
423 Ga0501307_061291 3300049162 Bacteria 584
424 Ga0501311_069439 3300049527 Bacteria 582
425 Ga0501311_072378 3300049527 Bacteria 574
426 Ga0501315_046651 3300049531 Bacteria 670
427 Ga0501316_038106 3300049532 Bacteria 663
428 Ga0501318_062440 3300049534 Bacteria 574
429 Ga0501320_045842 3300049536 Bacteria 584
430 Ga0501323_061829 3300049539 Bacteria 586
431 Ga0501333_012275 3300049549 Bacteria 625
432 Ga0501067_0374698 3300049583 Bacteria 794
433 Ga0501083_0029230 3300049744 Bacteria 3793
434 nmdc:mga05p37_1850619_c1 3300050507 Bacteria 579
435 nmdc:mga08y16_238634_c1 3300050511 Bacteria 1879
436 nmdc:mga0n895_467469_c1 3300050512 Bacteria 1272
437 nmdc:mga0n895_761292_c1 3300050512 Unclassified 961
438 nmdc:mga0rr50_100378_c1 3300050513 Bacteria 2273
439 nmdc:mga08x19_504707_c1 3300050514 Bacteria 854
440 Ga0495601_0002038 3300053077 Bacteria 11335
441 Ga0495601_0121848 3300053077 Bacteria 1694
442 Ga0495601_0173979 3300053077 Unclassified 1407
443 Ga0495612_0089560 3300053078 Bacteria 1301
444 Ga0495595_0010215 3300053084 Bacteria 3898
445 Ga0495595_0105564 3300053084 Unclassified 1362
446 Ga0495595_0253424 3300053084 Bacteria 881
447 Ga0495595_0344821 3300053084 Bacteria 751
448 Ga0495619_0019515 3300053085 Bacteria 4311
449 Ga0495619_0073103 3300053085 Bacteria 2297
450 Ga0495619_0104153 3300053085 Bacteria 1933
451 Ga0587084_100864 3300059477 Unclassified 585
452 Ga0587084_118967 3300059477 Bacteria 554
453 Ga0587093_077496 3300059478 Bacteria 568
454 Ga0587070_110616 3300059491 Bacteria 644
455 Ga0587070_149167 3300059491 Bacteria 585
456 Ga0587073_0043490 3300059492 Bacteria 990
457 Ga0587077_184954 3300059493 Bacteria 567
458 Ga0587082_114481 3300059504 Bacteria 603
459 Ga0587083_0167765 3300059505 Bacteria 605
460 Ga0587086_079863 3300059507 Bacteria 575
461 Ga0587090_066574 3300059510 Unclassified 695
462 Ga0587095_031876 3300059514 Bacteria 548
463 Ga0587131_011017 3300059609 Bacteria 650
464 Ga0587101_060787 3300059623 Bacteria 674
465 Ga0587109_063617 3300059624 Bacteria 783
466 Ga0587117_088848 3300059627 Bacteria 574
467 Ga0587122_022286 3300059628 Unclassified 697
468 Ga0587130_036545 3300059631 Bacteria 582
469 Ga0587062_080204 3300059639 Bacteria 605
470 Ga0587068_112842 3300059641 Bacteria 582
471 Ga0587075_068391 3300059644 Unclassified 655
472 Ga0587076_137024 3300059645 Unclassified 582
473 Ga0587078_062498 3300059646 Bacteria 567
474 Ga0587102_049808 3300059649 Bacteria 562
475 Ga0587107_058612 3300059652 Bacteria 673
476 Ga0587110_045246 3300059654 Bacteria 576
477 Ga0587114_053618 3300059655 Unclassified 690
478 Ga0587114_080501 3300059655 Bacteria 605
479 Ga0587071_140735 3300060344 Unclassified 592
480 Ga0587071_149285 3300060344 Bacteria 580
481 Ga0587111_0196932 3300060346 Bacteria 569
482 Ga0501082_0068076 3300060353 Bacteria 3066
483 Ga0587079_080222
484 Ga0006770J48903_1009927
485 Ga0006777J48905_1034004
486 Ga0007417J51691_1016415
487 Ga0058861_11854301
488 Ga0058862_11975756
489 Ga0070690_101450873
490 Ga0070666_10984664
491 Ga0070675_101105417
492 Ga0070671_100129175
493 Ga0070671_100519906
494 Ga0070671_100827905
495 Ga0070667_101686107
496 Ga0070709_10040355
497 Ga0070709_10463613
498 Ga0070714_100117869
499 Ga0070714_100203873
500 Ga0070714_100267851
501 Ga0070714_100874398
502 Ga0070714_100988827
503 Ga0070713_100055186
504 Ga0070713_100131049
505 Ga0070713_100154533
506 Ga0070713_100257593
507 Ga0070713_100420699
508 Ga0070713_100433894
509 Ga0070713_100543284
510 Ga0070713_100805594
511 Ga0070710_10003584
512 Ga0070710_10457160
513 Ga0070710_10594336
514 Ga0070710_10631626
515 Ga0070710_10673197
516 Ga0070711_100111557
517 Ga0070711_101062171
518 Ga0070711_101853350
519 Ga0070708_100132139
520 Ga0070708_100420383
521 Ga0070681_10136250
522 Ga0070681_10502923
523 Ga0070681_10800261
524 Ga0070706_100018301
525 Ga0070706_100136798
526 Ga0070706_100155815
527 Ga0070706_100221905
528 Ga0070706_100331725
529 Ga0070706_100350594
530 Ga0070706_100594189
531 Ga0070706_101168307
532 Ga0070707_100006146
533 Ga0070698_100002879
534 Ga0070698_100022207
535 Ga0070698_100031058
536 Ga0070698_100045471
537 Ga0070698_100045574
538 Ga0070698_100095433
539 Ga0070698_101838575
540 Ga0070699_100022426
541 Ga0070699_100058057
542 Ga0070699_100136893
543 Ga0070699_100204732
544 Ga0070699_102066132
545 Ga0070679_100221882
546 Ga0070697_100118352
547 Ga0070697_100274872
548 Ga0070697_101616655
549 Ga0070696_101276504
550 Ga0070665_100695475
551 Ga0070704_101806603
552 Ga0068856_100159164
553 Ga0068864_101266543
554 Ga0081540_1020086
555 Ga0070717_10000696
556 Ga0070717_10005332
557 Ga0070717_10130192
558 Ga0070717_10168890
559 Ga0070717_10201044
560 Ga0070717_10215223
561 Ga0070717_11175946
562 Ga0075432_10251030
563 Ga0075432_10559076
564 Ga0070715_10122907
565 Ga0070715_10579332
566 Ga0070716_100090053
567 Ga0070716_100117887
568 Ga0070712_100096805
569 Ga0070712_100240460
570 Ga0070712_100404973
571 Ga0070712_100584918
572 Ga0075433_11183822
573 Ga0075434_100429839
574 Ga0075434_100441311
575 Ga0075434_101515186
576 Ga0075436_100076118
577 Ga0075435_100071610
578 Ga0075435_101920838
579 Ga0099795_10004776
580 Ga0105240_10153993
581 Ga0111539_11320323
582 Ga0105245_11371269
583 Ga0105243_10740631
584 Ga0099796_10004450
585 Ga0099796_10167206
586 Ga0154016_102500
587 Ga0163162_10204536
588 Ga0157375_12828633
589 Ga0163163_10448419
590 Ga0182008_10281716
591 Ga0182007_10063121
592 Ga0182005_1105753
593 Ga0184602_118868
594 Ga0184602_122446
595 Ga0184602_129311
596 Ga0184597_103083
597 Ga0184597_107388
598 Ga0184597_109249
599 Ga0184595_103857
600 Ga0184596_103159
601 Ga0184592_126466
602 Ga0184598_103017
603 Ga0184598_138103
604 Ga0184598_142306
605 Ga0184601_108599
606 Ga0184601_112974
607 Ga0184601_127431
608 Ga0184601_136579
609 Ga0184599_124199
610 Ga0184599_131283
611 Ga0184599_153516
612 Ga0184600_101535
613 Ga0184600_103883
614 Ga0184600_121047
615 Ga0184600_140066
616 Ga0184603_103103
617 Ga0184603_110364
618 Ga0184603_115830
619 Ga0184603_122954
620 Ga0184603_137982
621 Ga0197907_10095408
622 Ga0197907_10293587
623 Ga0197907_11127809
624 Ga0206356_10496703
625 Ga0206356_11676838
626 Ga0206349_1120964
627 Ga0206349_1481239
628 Ga0206349_1696522
629 Ga0206349_1907275
630 Ga0206355_1299727
631 Ga0206355_1536004
632 Ga0206355_1673115
633 Ga0206351_10242082
634 Ga0206351_10365526
635 Ga0206351_10455253
636 Ga0206351_10462059
637 Ga0206351_10510870
638 Ga0206351_10832892
639 Ga0206352_10624036
640 Ga0206350_10018279
641 Ga0206350_10178792
642 Ga0206350_10647940
643 Ga0206350_10661902
644 Ga0206350_10753285
645 Ga0206350_10927683
646 Ga0206350_11203237
647 Ga0206354_10405456
648 Ga0206354_10489295
649 Ga0206354_11032657
650 Ga0154015_1023667
651 Ga0154015_1156009
652 Ga0154015_1259239
653 Ga0154015_1462271
654 Ga0154015_1682937
655 Ga0213873_10019237
656 Ga0213874_10100926
657 Ga0213874_10191208
658 Ga0213876_10013691
659 Ga0213876_10170506
660 Ga0213876_10322604
661 Ga0213875_10000412
662 Ga0213875_10005724
663 Ga0213875_10373970
664 Ga0224712_10089517
665 Ga0224712_10145938
666 Ga0224712_10187903
667 Ga0224712_10198661
668 Ga0224712_10205463
669 Ga0224712_10214941
670 Ga0224712_10233395
671 Ga0224712_10270693
672 Ga0224712_10432841
673 Ga0224712_10484840
674 Ga0224712_10488349
675 Ga0224712_10492580
676 Ga0224712_10496740
677 Ga0224712_10539452
678 Ga0224712_10551668
679 Ga0224712_10568156
680 Ga0247552_101920
681 Ga0247552_102474
682 Ga0247552_102955
683 Ga0247555_102775
684 Ga0247555_103115
685 Ga0247555_104374
686 Ga0247554_101565
687 Ga0247554_103977
688 Ga0247554_104353
689 Ga0247551_104236
690 Ga0247550_100649
691 Ga0247550_103443
692 Ga0247550_104137
693 Ga0247550_104174
694 Ga0247550_104192
695 Ga0247553_103242
696 Ga0247553_104241
697 Ga0247553_106068
698 Ga0247553_108013
699 Ga0247553_109121
700 Ga0228598_1096006
701 Ga0207692_10084188
702 Ga0207692_10170958
703 Ga0207692_10483588
704 Ga0207692_10713910
705 Ga0207680_10052982
706 Ga0207685_10064340
707 Ga0207685_10431954
708 Ga0207685_10522859
709 Ga0207699_10308733
710 Ga0207684_10031769
711 Ga0207684_10185286
712 Ga0207684_10533837
713 Ga0207684_10626685
714 Ga0207684_10897413
715 Ga0207707_10246611
716 Ga0207707_10288243
717 Ga0207707_10676964
718 Ga0207695_10815779
719 Ga0207693_10039298
720 Ga0207693_10099331
721 Ga0207693_10199236
722 Ga0207693_10200275
723 Ga0207693_10865176
724 Ga0207663_10127981
725 Ga0207663_10134053
726 Ga0207663_10138092
727 Ga0207663_10504796
728 Ga0207663_10519076
729 Ga0207649_11625883
730 Ga0207652_10084536
731 Ga0207646_10007709
732 Ga0207646_10071167
733 Ga0207646_10114066
734 Ga0207681_10595826
735 Ga0207700_10045252
736 Ga0207700_10225183
737 Ga0207700_10302749
738 Ga0207700_10375455
739 Ga0207700_10421822
740 Ga0207700_10532356
741 Ga0207700_10656553
742 Ga0207664_10086254
743 Ga0207664_10110421
744 Ga0207664_10914022
745 Ga0207664_11575659
746 Ga0207644_10862481
747 Ga0207670_10835104
748 Ga0207665_10036574
749 Ga0207679_10252948
750 Ga0207640_10942488
751 Ga0207677_10830291
752 Ga0207703_10176164
753 Ga0207702_10014179
754 Ga0207702_10407762
755 Ga0207676_10549549
756 Ga0207428_11052542
757 Ga0265762_1090290
758 Ga0265762_1118331
759 Ga0265775_111593
760 Ga0265763_1019076
761 Ga0265766_1016469
762 Ga0265777_108324
763 Ga0265777_115112
764 Ga0265777_116934
765 Ga0265777_121968
766 Ga0265765_1019340
767 Ga0265776_106411
768 Ga0265776_108697
769 Ga0265776_108849
770 Ga0265776_109091
771 Ga0265776_111566
772 Ga0265776_112116
773 Ga0265764_108295
774 Ga0265764_109521
775 Ga0265764_110409
776 Ga0265764_111514
777 Ga0265772_104760
778 Ga0265772_106554
779 Ga0265769_111710
780 Ga0265761_105674
781 Ga0265761_108392
782 Ga0265768_109767
783 Ga0265774_104683
784 Ga0265779_105051
785 Ga0265779_109899
786 Ga0265779_112261
787 Ga0265760_10113856
788 Ga0265760_10171507
789 Ga0265760_10290353
790 Ga0265325_10151169
791 Ga0310117_128278
792 Ga0310117_128660
793 Ga0310103_136127
794 Ga0310118_117952
795 Ga0310119_128533
796 Ga0247548_108682
797 Ga0316043_128366
798 Ga0316053_107738
799 Ga0316053_113478
800 Ga0316053_115858
801 Ga0316053_118873
802 Ga0373959_0191064
803 Ga0373926_0163342
804 Ga0373926_0199987
805 Ga0373934_0434877
806 Ga0373944_0115623
807 Ga0373951_0081728
808 Ga0373923_0099775
809 Ga0373932_0016559
810 Ga0373953_0003310
811 Ga0373953_0007041
812 Ga0373953_0088319
813 Ga0373953_0254646
814 Ga0373953_0267356
815 Ga0373956_0072725
816 Ga0373956_0118896
817 Ga0373957_0003396
818 Ga0373957_0133150
819 Ga0373955_0100172
820 Ga0373955_0215559
821 Ga0373931_0046009
822 Ga0373931_0113381
823 Ga0373935_1121485
824 Ga0373933_0010667
825 Ga0310104_12056
826 Ga0310104_16017
827 Ga0310104_16286
828 Ga0373937_0003696
829 Ga0373937_0023547
830 Ga0373937_0025135
831 Ga0373937_0033180
832 Ga0373937_0349528
833 Ga0373937_1474085
834 Ga0265778_027743
835 Ga0265778_045390
836 Ga0265778_046119
837 Ga0265778_047828
838 Ga0265778_050041
839 Ga0265778_057453
840 Ga0310112_046651
841 Ga0373925_0096228
842 Ga0373925_0557554
843 Ga0395900_1154498
844 Ga0436364_0010736
845 Ga0436364_0066886
846 Ga0436364_0525537
847 Ga0436364_0536950
848 Ga0436364_1048958
849 Ga0436364_1266540
850 Ga0436364_1360422
851 Ga0436364_1371474
852 Ga0436364_1390939
853 Ga0436364_1495326
854 Ga0436365_0170453
855 Ga0436365_0173805
856 Ga0436365_0284017
857 Ga0436365_0548789
858 Ga0436365_0689990
859 Ga0436365_0763987
860 Ga0436365_0869707
861 Ga0436365_1087876
862 Ga0436365_1710668
863 Ga0436360_0093777
864 Ga0436360_0254657
865 Ga0436360_0377102
866 Ga0436360_0817203
867 Ga0436360_1321651
868 Ga0436361_1037309
869 Ga0436363_0783918
870 Ga0436363_0824345
871 Ga0436363_0832611
872 Ga0436362_0638410
873 Ga0436362_0756207
874 Ga0466963_0091540
875 Ga0466957_0557599
876 Ga0495592_0016968
877 Ga0495592_0332867
878 Ga0495651_0800053
879 Ga0495653_0256684
880 Ga0495580_0030065
881 Ga0495639_0410921
882 Ga0495662_0017062
883 Ga0495664_0473924
884 Ga0495628_0267033
885 Ga0495630_0722463
886 Ga0495652_0367650
887 Ga0495586_0402928
888 Ga0495587_0193299
889 Ga0495667_0178314
890 Ga0495635_0339112
891 Ga0495657_0263381
892 Ga0495657_0375723
893 Ga0495599_0506109
894 Ga0495623_0263305
895 Ga0495658_0354546
896 Ga0495600_0078424
897 Ga0495600_0491396
898 Ga0495680_0291477
899 Ga0495680_0333461
900 Ga0495675_0253600
901 Ga0495684_0250671
902 Ga0496109_0391488
903 Ga0496113_0181823
904 Ga0501306_074419
905 Ga0501307_061291
906 Ga0501311_069439
907 Ga0501311_072378
908 Ga0501315_046651
909 Ga0501316_038106
910 Ga0501318_062440
911 Ga0501320_045842
912 Ga0501323_061829
913 Ga0501333_012275
914 Ga0501067_0374698
915 Ga0501083_0029230
916 nmdc:mga05p37_1850619_c1
917 nmdc:mga08y16_238634_c1
918 nmdc:mga0n895_467469_c1
919 nmdc:mga0n895_761292_c1
920 nmdc:mga0rr50_100378_c1
921 nmdc:mga08x19_504707_c1
922 Ga0495601_0002038
923 Ga0495601_0121848
924 Ga0495601_0173979
925 Ga0495612_0089560
926 Ga0495595_0010215
927 Ga0495595_0105564
928 Ga0495595_0253424
929 Ga0495595_0344821
930 Ga0495619_0019515
931 Ga0495619_0073103
932 Ga0495619_0104153
933 Ga0587084_100864
934 Ga0587084_118967
935 Ga0587093_077496
936 Ga0587070_110616
937 Ga0587070_149167
938 Ga0587073_0043490
939 Ga0587077_184954
940 Ga0587082_114481
941 Ga0587083_0167765
942 Ga0587086_079863
943 Ga0587090_066574
944 Ga0587095_031876
945 Ga0587131_011017
946 Ga0587101_060787
947 Ga0587109_063617
948 Ga0587117_088848
949 Ga0587122_022286
950 Ga0587130_036545
951 Ga0587062_080204
952 Ga0587068_112842
953 Ga0587075_068391
954 Ga0587076_137024
955 Ga0587078_062498
956 Ga0587102_049808
957 Ga0587107_058612
958 Ga0587110_045246
959 Ga0587114_053618
960 Ga0587114_080501
961 Ga0587071_140735
962 Ga0587071_149285
963 Ga0587111_0196932
964 Ga0501082_0068076

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00011

HSP20

Hsp20/alpha crystallin family

68

166

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
4zjd-assembly1.cif.gz_A small heat shock protein agsa from salmonella typhimurium: truncations at n- and c- termini 0.8261 37 124
6l6m-assembly1.cif.gz_A hsp18.5 from e. histolytica 0.8041 36 125
5ds1-assembly2.cif.gz_C core domain of the class ii small heat-shock protein hsp 17.7 from pisum sativum 0.8034 37 124
5zul-assembly1.cif.gz_C-2 small heat shock protein from mycobacterium marinum m : form-3 0.7907 36 126
7ck4-assembly1.cif.gz_F structural and functional analysis of small heat shock protein from synechococcus phage s-shm2 0.7844 37 129
ID Description Score Start End Superfamily
af_A0A0R0G7T5_78_196_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8522 106 126 3.40.50.150
af_Q8S1F2_1_96_2.60.40.790 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8501 37 125 2.60.40.790
af_P0C054_33_137_2.60.40.790 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8275 36 138 2.60.40.790
4zj9A00 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8219 36 124 2.60.40.790
af_P0C054_33_137_2.60.40.790 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8058 36 138 2.60.40.790
ID Description Score Start End GO Terms
AF-A0A7C6BC02-F1-model_v4 Hsp20 family protein 0.8543 29 128
AF-A0A485CTK9-F1-model_v4 16 kDa heat shock protein A 0.8472 37 138
AF-A0A4S0IBR2-F1-model_v4 deleted 0.8457 29 123
AF-A0A6A3AU61-F1-model_v4 Small heat shock protein 0.8439 38 125 GO:0005524
GO:0005634
GO:0006355
GO:0009408
GO:0099402
AF-A0A381ZKC1-F1-model_v4 SHSP domain-containing protein 0.8422 31 138

Map