F452635

General Info

Members Datasets Scaffolds Average Seq Length
482 263 964 129

Family's Representative Sequence

Representative Sequence 3300028794|Ga0307515_10030191|Ga0307515_100301919
Length 154
Sequence VLLLRGAGTDERNADAGQALGSGCMVHVLSSRVLLRPLDPERSRVFYGERLGLAVHREFGTGPERGTVYFLGGGFLELSGRAEEPPSPSVRLWLQVADVTAAHDELVSRGVEIVRPPVKEPWGLVEMWIADPDGTRIVLVEVPADHPLRYRPGI

Samples

Sample ID Description Type Environment
1 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
13 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
14 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
15 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
16 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
17 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
18 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
19 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
20 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
21 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
22 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
23 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
24 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
25 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
26 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
27 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
28 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
29 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
30 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
31 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
42 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
43 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
44 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
45 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
46 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
47 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
48 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
49 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
50 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
51 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
52 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
53 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
54 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
55 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
56 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
57 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
58 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
59 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
60 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
61 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
62 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
63 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
64 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
65 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
66 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
67 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
68 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
69 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
70 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
71 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
72 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
73 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
74 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
75 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
76 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
77 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
78 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
79 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
80 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
81 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
82 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
83 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
84 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
85 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
86 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
87 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
88 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
89 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
90 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
91 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
92 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
93 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
94 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
95 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
96 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
97 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
98 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
99 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
100 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
101 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
102 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
103 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
104 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
105 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
106 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
107 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
108 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
109 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
110 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
111 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
112 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
113 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
114 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
115 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
116 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
117 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
118 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
119 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
120 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
121 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
122 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
123 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
124 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
125 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
126 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
127 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
128 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
129 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
130 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
131 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
132 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
133 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
134 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
135 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
136 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
137 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
138 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
139 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
140 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
141 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
142 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
143 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
144 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
145 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
146 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
147 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
148 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
149 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
150 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
151 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
152 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
153 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
154 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
155 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
156 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
157 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
158 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
159 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
160 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
161 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
162 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
163 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
164 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
165 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
166 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
167 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
168 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
169 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
170 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
171 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
172 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
173 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
174 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
175 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
176 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
189 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
190 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
191 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
192 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
193 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
194 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
197 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
198 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
199 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
200 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
201 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
202 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
203 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
204 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
205 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
206 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
207 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
208 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
209 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
210 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
211 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
212 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
213 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
214 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
215 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
216 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
217 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
218 2643221647 Streptomyces sp. Root369 Isolate Unclassified
219 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
220 2643221714 Streptomyces sp. Root264 Isolate Unclassified
221 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
222 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
223 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
224 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
225 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
226 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
227 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
228 2808606448 Streptomyces sp. 193411 Isolate Unclassified
229 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
230 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
231 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
232 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
233 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
234 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
235 2867369537 Streptomyces sp. Z26 Isolate Unclassified
236 2867428634 Streptomyces sp. RP5T Isolate Unclassified
237 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
238 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
239 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
240 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
241 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
242 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
243 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
244 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
245 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
246 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
247 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
248 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
249 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
250 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
251 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
252 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
253 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
254 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
255 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
256 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
257 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
258 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
259 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
260 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
261 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
262 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
263 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.38
Metatranscriptomes 0.83
Isolates 10.79

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.53
Nodule 0
Rhizoplane 1.45
Rhizosphere 78.84
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307515_10030191 3300028794 Bacteria 9118
2 JGI25153J46596_10094615 3300003215 Bacteria 714
3 rootH1_10074698 3300003316 Bacteria 8431
4 rootH1_10092425 3300003316 Bacteria 2973
5 rootL2_10003342 3300003322 Bacteria 2791
6 rootL2_10026053 3300003322 Bacteria 1455
7 rootL2_10026640 3300003322 Bacteria 2988
8 rootL2_10236764 3300003322 Bacteria 1238
9 rootH1_10032465 3300003323 Bacteria 2209
10 rootH1_10043571 3300003323 Bacteria 2652
11 rootH1_10046623 3300003323 Bacteria 9586
12 Ga0006562J51391_1038768 3300003578 Bacteria 2811
13 Ga0006562J51391_1038769 3300003578 Bacteria 2320
14 Ga0006562J51391_1179300 3300003578 Bacteria 1328
15 Ga0006562J51391_1179301 3300003578 Bacteria 1110
16 Ga0070668_100015798 3300005347 Bacteria 5648
17 Ga0070668_101985522 3300005347 Bacteria 536
18 Ga0070675_100639140 3300005354 Bacteria 967
19 Ga0070714_100018530 3300005435 Bacteria 5657
20 Ga0070714_100367269 3300005435 Bacteria 1354
21 Ga0070713_100009785 3300005436 Bacteria 6890
22 Ga0070708_101275872 3300005445 Bacteria 686
23 Ga0070663_100000197 3300005455 Bacteria 30053
24 Ga0070693_101498285 3300005547 Bacteria 527
25 Ga0068855_100363192 3300005563 Bacteria 1593
26 Ga0081455_10406792 3300005937 Bacteria 943
27 Ga0075363_100002708 3300006048 Bacteria 7331
28 Ga0075363_100088089 3300006048 Bacteria 1706
29 Ga0075370_10013186 3300006353 Bacteria 4387
30 Ga0075370_10140685 3300006353 Bacteria 1411
31 Ga0075429_100326839 3300006880 Bacteria 1342
32 Ga0105251_10087491 3300009011 Bacteria 1434
33 Ga0105250_10109888 3300009092 Bacteria 1129
34 Ga0105245_11051601 3300009098 Bacteria 859
35 Ga0105238_12912057 3300009551 Bacteria 515
36 Ga0105032_101302 3300009979 Bacteria 2300
37 Ga0105028_115896 3300009993 Bacteria 803
38 Ga0105246_11048653 3300011119 Bacteria 741
39 Ga0157369_10041246 3300013105 Bacteria 5039
40 Ga0182008_10001610 3300014497 Bacteria 14983
41 Ga0182007_10005470 3300015262 Bacteria 5576
42 Ga0183367_1003 3300015688 Bacteria 814276
43 Ga0209758_1003249 3300025297 Bacteria 15073
44 Ga0207713_1114164 3300025735 Bacteria 914
45 Ga0207647_10023187 3300025904 Bacteria 4109
46 Ga0207681_11137770 3300025923 Bacteria 656
47 Ga0207700_10083612 3300025928 Bacteria 2499
48 Ga0207664_10019453 3300025929 Bacteria 5019
49 Ga0207639_10119761 3300026041 Bacteria 2161
50 Ga0207702_10419673 3300026078 Bacteria 1294
51 Ga0207641_12161185 3300026088 Bacteria 557
52 Ga0207683_10273465 3300026121 Bacteria 1543
53 Ga0268264_10239865 3300028381 Bacteria 1679
54 Ga0307517_10014742 3300028786 Bacteria 10464
55 Ga0307515_10000633 3300028794 Bacteria 81559
56 Ga0307515_10054676 3300028794 Bacteria 5854
57 Ga0307515_10400154 3300028794 Bacteria 999
58 Ga0268256_1017132 3300030500 Bacteria 2051
59 Ga0307511_10112546 3300030521 Bacteria 1724
60 Ga0307511_10153330 3300030521 Bacteria 1315
61 Ga0307511_10156377 3300030521 Bacteria 1293
62 Ga0307512_10001476 3300030522 Bacteria 33144
63 Ga0307512_10031121 3300030522 Bacteria 4628
64 Ga0307512_10110383 3300030522 Bacteria 1816
65 Ga0307513_10006146 3300031456 Bacteria 15755
66 Ga0307513_10029503 3300031456 Bacteria 6253
67 Ga0307513_10080545 3300031456 Bacteria 3358
68 Ga0307513_10218749 3300031456 Bacteria 1728
69 Ga0307513_10388761 3300031456 Bacteria 1132
70 Ga0307509_10006938 3300031507 Bacteria 15022
71 Ga0307509_10014318 3300031507 Bacteria 9331
72 Ga0307509_10052935 3300031507 Bacteria 4332
73 Ga0307508_10004538 3300031616 Bacteria 13530
74 Ga0307508_10101300 3300031616 Bacteria 2476
75 Ga0307508_10122725 3300031616 Bacteria 2200
76 Ga0307514_10005798 3300031649 Bacteria 10911
77 Ga0307514_10054699 3300031649 Bacteria 3072
78 Ga0307514_10082203 3300031649 Bacteria 2377
79 Ga0307514_10105812 3300031649 Bacteria 2009
80 Ga0307516_10031212 3300031730 Bacteria 5371
81 Ga0307516_10087445 3300031730 Bacteria 2951
82 Ga0307518_10058191 3300031838 Bacteria 2807
83 Ga0307518_10082185 3300031838 Bacteria 2325
84 Ga0307518_10108491 3300031838 Bacteria 1980
85 Ga0307518_10194442 3300031838 Bacteria 1355
86 Ga0307411_10378377 3300032005 Bacteria 1164
87 Ga0307507_10009406 3300033179 Bacteria 13043
88 Ga0307507_10034033 3300033179 Bacteria 5275
89 Ga0307510_10032704 3300033180 Bacteria 5856
90 Ga0307510_10075312 3300033180 Bacteria 3328
91 Ga0307510_10137432 3300033180 Bacteria 2097
92 Ga0395900_0153468 3300037418 Bacteria 2353
93 Ga0395898_0025678 3300037466 Bacteria 5934
94 Ga0395898_0027824 3300037466 Bacteria 5669
95 Ga0395898_0032530 3300037466 Bacteria 5206
96 Ga0395905_0071895 3300037471 Bacteria 3243
97 Ga0395901_1032563 3300038443 Bacteria 796
98 Ga0439436_0008303 3300041404 Bacteria 3191
99 Ga0439439_0011179 3300041406 Bacteria 2157
100 Ga0451800_1658700 3300041459 Bacteria 1580
101 Ga0451802_1954197 3300041460 Bacteria 867
102 Ga0451833_1284733 3300041491 Bacteria 519
103 Ga0451835_0312314 3300041492 Bacteria 586
104 Ga0451845_0072849 3300041501 Bacteria 716
105 Ga0451849_1537953 3300041505 Bacteria 1479
106 Ga0451843_0057485 3300041509 Bacteria 652
107 Ga0451853_0014593 3300041512 Bacteria 992
108 Ga0451853_0773861 3300041512 Bacteria 3378
109 Ga0451853_1597964 3300041512 Bacteria 681
110 Ga0451853_2952698 3300041512 Bacteria 900
111 Ga0439433_0002950 3300041999 Bacteria 3643
112 Ga0439448_0120104 3300042005 Bacteria 902
113 Ga0439449_0004122 3300042007 Bacteria 5626
114 Ga0439449_0006819 3300042007 Bacteria 4355
115 Ga0439455_0001299 3300042012 Bacteria 4106
116 Ga0439457_000910 3300042014 Bacteria 8913
117 Ga0439457_003001 3300042014 Bacteria 4690
118 Ga0439457_046550 3300042014 Bacteria 971
119 Ga0450894_000110 3300042131 Bacteria 13800
120 Ga0450895_006794 3300042132 Bacteria 941
121 Ga0450896_001338 3300042133 Bacteria 2996
122 Ga0450898_134231 3300042134 Bacteria 534
123 Ga0450899_004876 3300042135 Bacteria 1437
124 Ga0450906_001115 3300042145 Bacteria 5954
125 Ga0439458_0025991 3300042157 Bacteria 1375
126 Ga0450908_016107 3300042184 Bacteria 1335
127 Ga0466969_0016940 3300044656 Bacteria 3809
128 Ga0466969_0025577 3300044656 Bacteria 3033
129 Ga0466972_0004939 3300044658 Bacteria 6694
130 Ga0466972_0008654 3300044658 Bacteria 5105
131 Ga0466972_0187529 3300044658 Bacteria 969
132 Ga0466965_0001600 3300044683 Bacteria 9243
133 Ga0466965_0010760 3300044683 Bacteria 4279
134 Ga0466965_0086610 3300044683 Bacteria 1589
135 Ga0466965_0236266 3300044683 Bacteria 977
136 Ga0466966_0001512 3300044684 Bacteria 14923
137 Ga0466966_0006779 3300044684 Bacteria 7583
138 Ga0466966_0208133 3300044684 Bacteria 1182
139 Ga0466966_0526587 3300044684 Bacteria 711
140 Ga0466961_0002718 3300044693 Bacteria 10997
141 Ga0466961_0014648 3300044693 Bacteria 5037
142 Ga0466961_0086471 3300044693 Bacteria 1981
143 Ga0466961_0096637 3300044693 Bacteria 1863
144 Ga0466961_0414181 3300044693 Bacteria 817
145 Ga0466963_0000266 3300044694 Bacteria 23069
146 Ga0466963_0000924 3300044694 Bacteria 14981
147 Ga0466963_0047275 3300044694 Bacteria 2840
148 Ga0466963_1116818 3300044694 Bacteria 554
149 Ga0466964_0094036 3300044706 Bacteria 1310
150 Ga0466971_0001812 3300044719 Bacteria 9071
151 Ga0466971_0003467 3300044719 Bacteria 6736
152 Ga0466971_0032283 3300044719 Bacteria 2346
153 Ga0466971_0049938 3300044719 Bacteria 1882
154 Ga0466971_0264082 3300044719 Bacteria 822
155 Ga0466971_0629109 3300044719 Bacteria 536
156 Ga0466968_0010862 3300044735 Bacteria 3538
157 Ga0466968_0485052 3300044735 Bacteria 614
158 Ga0466970_0000459 3300044765 Bacteria 20111
159 Ga0466970_0004210 3300044765 Bacteria 7082
160 Ga0466970_0106148 3300044765 Bacteria 1532
161 Ga0466970_0157033 3300044765 Bacteria 1257
162 Ga0466970_0308990 3300044765 Bacteria 893
163 Ga0466957_0002411 3300044842 Bacteria 10037
164 Ga0466960_0001440 3300044901 Bacteria 8678
165 Ga0466960_0121383 3300044901 Bacteria 1369
166 Ga0466960_0284026 3300044901 Bacteria 928
167 Ga0466960_0294141 3300044901 Bacteria 913
168 Ga0466959_0000407 3300045049 Bacteria 25154
169 Ga0466959_0168840 3300045049 Bacteria 1535
170 Ga0466959_0221878 3300045049 Bacteria 1310
171 Ga0466959_0261962 3300045049 Bacteria 1190
172 Ga0466958_0000629 3300045836 Bacteria 15130
173 Ga0466958_0151540 3300045836 Bacteria 1463
174 Ga0466967_0002626 3300045976 Bacteria 11315
175 Ga0466967_0162320 3300045976 Bacteria 2098
176 Ga0466967_0289756 3300045976 Bacteria 1573
177 Ga0466967_0452098 3300045976 Bacteria 1255
178 Ga0495617_051838 3300046452 Bacteria 1363
179 Ga0495592_0006017 3300046454 Bacteria 9021
180 Ga0495592_0011001 3300046454 Bacteria 6828
181 Ga0495603_0001079 3300046455 Bacteria 15810
182 Ga0495603_0020211 3300046455 Bacteria 4036
183 Ga0495603_0029676 3300046455 Bacteria 3296
184 Ga0495603_0129860 3300046455 Bacteria 1467
185 Ga0495629_0002834 3300046459 Bacteria 13255
186 Ga0495629_0003083 3300046459 Bacteria 12647
187 Ga0495629_0044938 3300046459 Bacteria 3099
188 Ga0495629_0055064 3300046459 Bacteria 2781
189 Ga0495629_0060685 3300046459 Bacteria 2642
190 Ga0495629_0095335 3300046459 Bacteria 2076
191 Ga0495638_0382055 3300046460 Bacteria 735
192 Ga0495651_0027093 3300046462 Bacteria 4463
193 Ga0495651_0313927 3300046462 Bacteria 1047
194 Ga0495580_0103276 3300046472 Bacteria 1981
195 Ga0495582_0078997 3300046473 Bacteria 1826
196 Ga0495582_0102490 3300046473 Bacteria 1603
197 Ga0495582_0355897 3300046473 Bacteria 843
198 Ga0495605_0003375 3300046474 Bacteria 9534
199 Ga0495605_0089420 3300046474 Bacteria 1429
200 Ga0495662_0005584 3300046476 Bacteria 6292
201 Ga0495662_0025506 3300046476 Bacteria 2854
202 Ga0495662_0100161 3300046476 Bacteria 1417
203 Ga0495662_0101953 3300046476 Bacteria 1404
204 Ga0495664_0003688 3300046477 Bacteria 8349
205 Ga0495664_0246482 3300046477 Bacteria 1080
206 Ga0495664_0477334 3300046477 Bacteria 745
207 Ga0495585_0124282 3300046492 Bacteria 1363
208 Ga0495585_0143420 3300046492 Bacteria 1249
209 Ga0495594_0000572 3300046499 Bacteria 18918
210 Ga0495594_0015561 3300046499 Bacteria 3998
211 Ga0495594_0138150 3300046499 Bacteria 1381
212 Ga0495607_0046210 3300046501 Bacteria 2558
213 Ga0495583_0013025 3300046506 Bacteria 4667
214 Ga0495583_0060312 3300046506 Bacteria 1696
215 Ga0495606_0019391 3300046507 Bacteria 5062
216 Ga0495608_0150877 3300046511 Bacteria 1481
217 Ga0495610_0026077 3300046512 Bacteria 3125
218 Ga0495610_0233051 3300046512 Bacteria 738
219 Ga0495616_0012684 3300046513 Bacteria 4773
220 Ga0495618_0058320 3300046514 Bacteria 2445
221 Ga0495618_0191805 3300046514 Bacteria 1295
222 Ga0495620_0027084 3300046515 Bacteria 2687
223 Ga0495620_0043412 3300046515 Bacteria 1958
224 Ga0495620_0306967 3300046515 Bacteria 603
225 Ga0495628_0092128 3300046516 Bacteria 2345
226 Ga0495628_0126639 3300046516 Bacteria 1956
227 Ga0495630_0016486 3300046517 Bacteria 5401
228 Ga0495631_0002194 3300046518 Bacteria 11237
229 Ga0495631_0099779 3300046518 Bacteria 1250
230 Ga0495637_0046971 3300046520 Bacteria 1825
231 Ga0495643_0026535 3300046522 Bacteria 3268
232 Ga0495643_0114781 3300046522 Bacteria 1366
233 Ga0495648_0267659 3300046524 Bacteria 816
234 Ga0495666_0045637 3300046526 Bacteria 2113
235 Ga0495666_0047541 3300046526 Bacteria 2066
236 Ga0495652_0013340 3300046529 Bacteria 7395
237 Ga0495652_0109449 3300046529 Bacteria 2224
238 Ga0495654_0204955 3300046530 Bacteria 842
239 Ga0495665_0070518 3300046531 Bacteria 1842
240 Ga0495640_0009664 3300046533 Bacteria 7498
241 Ga0495640_0517309 3300046533 Bacteria 725
242 Ga0495586_0089261 3300046535 Bacteria 1701
243 Ga0495587_0010659 3300046536 Bacteria 5838
244 Ga0495587_0393824 3300046536 Bacteria 770
245 Ga0495609_0015882 3300046538 Bacteria 3516
246 Ga0495597_0043702 3300046542 Bacteria 1994
247 Ga0495597_0067606 3300046542 Bacteria 1545
248 Ga0495645_0014168 3300046543 Bacteria 5652
249 Ga0495645_0015907 3300046543 Bacteria 5360
250 Ga0495622_0007236 3300046557 Bacteria 5152
251 Ga0495633_0009958 3300046558 Bacteria 5218
252 Ga0495667_0067801 3300046559 Bacteria 2331
253 Ga0495667_0147347 3300046559 Bacteria 1516
254 Ga0495668_0035092 3300046616 Bacteria 2810
255 Ga0495634_0034526 3300046642 Bacteria 3470
256 Ga0495611_0021075 3300046648 Bacteria 2813
257 Ga0495611_0239317 3300046648 Bacteria 842
258 Ga0495625_0007642 3300046660 Bacteria 9375
259 Ga0495625_0020792 3300046660 Bacteria 5060
260 Ga0495625_0051749 3300046660 Bacteria 2943
261 Ga0495635_0425195 3300046663 Bacteria 880
262 Ga0495661_0031539 3300046665 Bacteria 3361
263 Ga0495588_0000456 3300046674 Bacteria 20551
264 Ga0495588_0017197 3300046674 Bacteria 3506
265 Ga0495588_0212856 3300046674 Bacteria 1020
266 Ga0495657_0002648 3300046675 Bacteria 14971
267 Ga0495657_0026691 3300046675 Bacteria 4087
268 Ga0495657_0043956 3300046675 Bacteria 3042
269 Ga0495657_0087954 3300046675 Bacteria 1998
270 Ga0495657_0122010 3300046675 Bacteria 1640
271 Ga0495599_0454241 3300046678 Bacteria 758
272 Ga0495623_0020208 3300046679 Bacteria 4304
273 Ga0495646_0004954 3300046680 Bacteria 8406
274 Ga0495646_0039989 3300046680 Bacteria 2890
275 Ga0495613_0000687 3300046689 Bacteria 26727
276 Ga0495613_0005357 3300046689 Bacteria 9635
277 Ga0495613_0007592 3300046689 Bacteria 8062
278 Ga0495613_0011068 3300046689 Bacteria 6697
279 Ga0495613_0033715 3300046689 Bacteria 3803
280 Ga0495613_0057052 3300046689 Bacteria 2867
281 Ga0495613_0138689 3300046689 Bacteria 1738
282 Ga0495613_0157635 3300046689 Bacteria 1616
283 Ga0495613_0237706 3300046689 Bacteria 1274
284 Ga0495624_0113148 3300046690 Bacteria 1668
285 Ga0495624_0446070 3300046690 Bacteria 775
286 Ga0495624_0629936 3300046690 Bacteria 638
287 Ga0495670_0068859 3300046691 Bacteria 1789
288 Ga0495670_0230228 3300046691 Bacteria 985
289 Ga0495671_0028134 3300046692 Bacteria 2898
290 Ga0495671_0119157 3300046692 Bacteria 1288
291 Ga0495671_0606185 3300046692 Bacteria 521
292 Ga0495649_0053489 3300046694 Bacteria 2185
293 Ga0495649_0099965 3300046694 Bacteria 1542
294 Ga0495649_0368328 3300046694 Bacteria 724
295 Ga0495589_0008678 3300046794 Bacteria 5293
296 Ga0495589_0026502 3300046794 Bacteria 2936
297 Ga0495589_0050180 3300046794 Bacteria 2064
298 Ga0495589_0475803 3300046794 Bacteria 571
299 Ga0495600_0062716 3300046809 Bacteria 2428
300 Ga0495600_0094015 3300046809 Bacteria 1955
301 Ga0495660_0070476 3300046810 Bacteria 1855
302 Ga0495660_0174216 3300046810 Bacteria 1045
303 Ga0495581_0001578 3300047315 Bacteria 12716
304 Ga0495604_0000486 3300047317 Bacteria 34884
305 Ga0495604_0035541 3300047317 Bacteria 3935
306 Ga0495604_0130583 3300047317 Bacteria 1806
307 Ga0495636_0000378 3300047318 Bacteria 16752
308 Ga0495636_0056381 3300047318 Bacteria 1654
309 Ga0495636_0116581 3300047318 Bacteria 1179
310 Ga0495636_0378911 3300047318 Bacteria 671
311 Ga0495636_0429082 3300047318 Bacteria 633
312 Ga0495676_0004901 3300047321 Bacteria 12275
313 Ga0495676_0004905 3300047321 Bacteria 12271
314 Ga0495676_0018895 3300047321 Bacteria 6072
315 Ga0495676_0102183 3300047321 Bacteria 2118
316 Ga0495676_0122380 3300047321 Bacteria 1890
317 Ga0495680_0008869 3300047322 Bacteria 9095
318 Ga0495683_0022872 3300047323 Bacteria 3213
319 Ga0495687_002310 3300047443 Bacteria 15565
320 Ga0495687_022205 3300047443 Bacteria 3051
321 Ga0495687_045445 3300047443 Bacteria 1901
322 Ga0495687_049710 3300047443 Bacteria 1791
323 Ga0495687_072001 3300047443 Bacteria 1382
324 Ga0495687_133002 3300047443 Bacteria 877
325 Ga0495675_0022974 3300047444 Bacteria 3975
326 Ga0495675_0040124 3300047444 Bacteria 2982
327 Ga0495675_0043598 3300047444 Bacteria 2858
328 Ga0495677_0295955 3300047445 Bacteria 636
329 Ga0495685_012516 3300047447 Bacteria 2874
330 Ga0495685_019386 3300047447 Bacteria 2337
331 Ga0495685_020989 3300047447 Bacteria 2246
332 Ga0495685_147570 3300047447 Bacteria 764
333 Ga0495681_0002575 3300047470 Bacteria 12881
334 Ga0495686_0017484 3300047472 Bacteria 4829
335 Ga0495686_0074596 3300047472 Bacteria 2081
336 Ga0495686_0407302 3300047472 Bacteria 729
337 Ga0495593_0006628 3300047673 Bacteria 6775
338 Ga0495593_0023443 3300047673 Bacteria 3431
339 Ga0495614_0000680 3300048089 Bacteria 14306
340 Ga0495614_0009352 3300048089 Bacteria 4334
341 Ga0495614_0009954 3300048089 Bacteria 4196
342 Ga0495614_0124467 3300048089 Bacteria 1138
343 Ga0495614_0149414 3300048089 Bacteria 1041
344 Ga0495626_0024890 3300048091 Bacteria 2931
345 Ga0496103_0385198 3300048906 Bacteria 901
346 Ga0496104_0534992 3300048907 Bacteria 1083
347 Ga0496106_0015008 3300048909 Bacteria 5733
348 Ga0496109_0084805 3300048912 Bacteria 2923
349 Ga0496114_0342700 3300048917 Bacteria 1322
350 Ga0495678_125976 3300049459 Bacteria 854
351 Ga0501031_0030962 3300049568 Bacteria 3490
352 Ga0501031_0327612 3300049568 Bacteria 992
353 Ga0501032_0006618 3300049569 Bacteria 8508
354 Ga0501032_0616594 3300049569 Bacteria 690
355 Ga0501033_0000804 3300049570 Bacteria 28723
356 Ga0501033_0038289 3300049570 Bacteria 3587
357 Ga0501033_0066513 3300049570 Bacteria 2650
358 Ga0501033_0400549 3300049570 Bacteria 957
359 Ga0501033_0629293 3300049570 Bacteria 734
360 Ga0501034_0039202 3300049571 Bacteria 4799
361 Ga0501034_0047736 3300049571 Bacteria 4322
362 Ga0501034_0048785 3300049571 Bacteria 4272
363 Ga0501034_0051887 3300049571 Bacteria 4134
364 Ga0501034_0073050 3300049571 Bacteria 3439
365 Ga0501036_0030127 3300049572 Bacteria 4584
366 Ga0501036_0042744 3300049572 Bacteria 3836
367 Ga0501036_0062615 3300049572 Bacteria 3151
368 Ga0501036_0438026 3300049572 Bacteria 1089
369 Ga0501036_1598224 3300049572 Bacteria 526
370 Ga0501037_0004124 3300049573 Bacteria 10540
371 Ga0501037_0051182 3300049573 Bacteria 3021
372 Ga0501038_0003306 3300049574 Bacteria 15029
373 Ga0501038_0037612 3300049574 Bacteria 4243
374 Ga0501038_0079536 3300049574 Bacteria 2764
375 Ga0501039_0004258 3300049575 Bacteria 10774
376 Ga0501043_0002501 3300049579 Bacteria 15539
377 Ga0501043_0005706 3300049579 Bacteria 10027
378 Ga0501043_0125175 3300049579 Bacteria 2015
379 Ga0501043_0161285 3300049579 Bacteria 1752
380 Ga0501046_0040819 3300049580 Bacteria 3706
381 Ga0501047_0067948 3300049581 Bacteria 3433
382 Ga0501047_0091425 3300049581 Bacteria 2921
383 Ga0501047_0155207 3300049581 Bacteria 2163
384 Ga0501047_0498480 3300049581 Bacteria 1044
385 Ga0501047_0625788 3300049581 Bacteria 897
386 Ga0501048_0028851 3300049582 Bacteria 4027
387 Ga0501048_0468645 3300049582 Bacteria 902
388 Ga0501048_0543350 3300049582 Bacteria 834
389 Ga0501067_0066658 3300049583 Bacteria 1993
390 Ga0501070_0005046 3300049586 Bacteria 11258
391 Ga0501070_0299096 3300049586 Bacteria 1311
392 Ga0501070_0374236 3300049586 Bacteria 1154
393 Ga0501070_0392621 3300049586 Bacteria 1123
394 Ga0501070_0994456 3300049586 Bacteria 651
395 Ga0501073_0183358 3300049589 Bacteria 1449
396 Ga0501073_0310007 3300049589 Bacteria 1089
397 Ga0501074_0076212 3300049590 Bacteria 2407
398 Ga0501235_058633 3300049669 Bacteria 900
399 Ga0501080_0061620 3300049742 Bacteria 3492
400 Ga0501035_0022571 3300049822 Bacteria 5779
401 Ga0501035_0037388 3300049822 Bacteria 4396
402 Ga0501035_0058864 3300049822 Bacteria 3422
403 Ga0501035_0122067 3300049822 Bacteria 2277
404 Ga0501035_0317999 3300049822 Bacteria 1308
405 Ga0501035_0542655 3300049822 Bacteria 953
406 Ga0501035_0675260 3300049822 Bacteria 835
407 Ga0501044_0051282 3300049823 Bacteria 4254
408 Ga0501044_0068759 3300049823 Bacteria 3607
409 Ga0501044_0083363 3300049823 Bacteria 3233
410 Ga0501044_0139803 3300049823 Bacteria 2410
411 Ga0501044_0142032 3300049823 Bacteria 2389
412 Ga0501044_0181691 3300049823 Bacteria 2070
413 Ga0501045_0607081 3300049824 Bacteria 810
414 nmdc:mga03n38_72780_c1 3300050490 Bacteria 1594
415 nmdc:mga06z11_93521_c1 3300050494 Bacteria 1637
416 nmdc:mga07m45_218034_c1 3300050496 Bacteria 1110
417 nmdc:mga09592_309179_c1 3300050508 Bacteria 1370
418 Ga0495655_0058403 3300053083 Bacteria 1045
419 Ga0495619_0135262 3300053085 Bacteria 1695
420 Ga0500644_0295569 3300053088 Bacteria 692
421 Ga0500646_0287680 3300053090 Bacteria 587
422 Ga0500640_058975 3300053095 Bacteria 1666
423 Ga0500650_0177276 3300053098 Bacteria 978
424 Ga0500560_016514 3300053107 Bacteria 2016
425 Ga0500652_067224 3300053131 Bacteria 1482
426 Ga0500573_0038727 3300053140 Bacteria 2755
427 Ga0500600_0045793 3300053149 Bacteria 2502
428 Ga0466962_0000182 3300061719 Bacteria 26106
429 Ga0466962_0003204 3300061719 Bacteria 7772
430 Ga0466962_0116916 3300061719 Bacteria 1285
431 2547408955 2547132111 Bacteria 8013147
432 2585301711 2582581312 Bacteria 7308206
433 2585306505 2582581313 Bacteria 10042643
434 2585320041 2582581314 Bacteria 11452267
435 2616693295 2616644814 Bacteria 11555299
436 2616902932 2616644941 Bacteria 8510691
437 2644263348 2643221647 Bacteria 10741251
438 2644442071 2643221678 Bacteria 9540101
439 2644631668 2643221714 Bacteria 9015452
440 2784586346 2784132148 Bacteria 8627943
441 2785346460 2784746763 Bacteria 9783172
442 2785366600 2784746768 Bacteria 10036182
443 2786667680 2786546132 Bacteria 10419719
444 2804849324 2802429296 Bacteria 7227771
445 2808847141 2808606359 Bacteria 9866990
446 2808917948 2808606375 Bacteria 9466072
447 2809229846 2808606448 Bacteria 8656184
448 2812482744 2811994917 Bacteria 7761064
449 2852639447 2852635781 Bacteria 8251373
450 2862181239 2862178590 Bacteria 8583590
451 2862290160 2862281513 Bacteria 9621493
452 2862513479 2862507626 Bacteria 9425308
453 2863408051 2863404153 Bacteria 9672205
454 2867375145 2867369537 Bacteria 6501581
455 2867431790 2867428634 Bacteria 9590268
456 2873157915 2873151551 Bacteria 8625867
457 2877683948 2877676314 Bacteria 9512378
458 2912723141 2912715099 Bacteria 9460473
459 2912726605 2912723979 Bacteria 8557534
460 2919469993 2919468124 Bacteria 9133025
461 2946065049 2946064051 Bacteria 8957905
462 2946073482 2946072368 Bacteria 8999607
463 2947232386 2947224130 Bacteria 9938529
464 2954008395 2954002825 Bacteria 9173742
465 2954389246 2954380949 Bacteria 10050426
466 2954673820 2954673503 Bacteria 9685905
467 2954690171 2954682443 Bacteria 9862841
468 2954700021 2954691527 Bacteria 10720516
469 2954702197 2954701450 Bacteria 10834262
470 2954718847 2954711539 Bacteria 10867210
471 2954728817 2954721474 Bacteria 10456478
472 2954732995 2954731030 Bacteria 10243860
473 2954747716 2954740390 Bacteria 10229294
474 2954751875 2954749733 Bacteria 10366972
475 2954766838 2954759201 Bacteria 9358192
476 2990060188 2990059506 Bacteria 9321252
477 3006496960 3006493962 Bacteria 8825450
478 8008581161 8008574985 Bacteria 7815457
479 8023624469 8023623736 Bacteria 8593882
480 8048407280 8048406513 Bacteria 8936924
481 8056670029 8056667051 Bacteria 6953971
482 8056832753 8056829672 Bacteria 9045328
483 Ga0307515_10030191
484 JGI25153J46596_10094615
485 rootH1_10074698
486 rootH1_10092425
487 rootL2_10003342
488 rootL2_10026053
489 rootL2_10026640
490 rootL2_10236764
491 rootH1_10032465
492 rootH1_10043571
493 rootH1_10046623
494 Ga0006562J51391_1038768
495 Ga0006562J51391_1038769
496 Ga0006562J51391_1179300
497 Ga0006562J51391_1179301
498 Ga0070668_100015798
499 Ga0070668_101985522
500 Ga0070675_100639140
501 Ga0070714_100018530
502 Ga0070714_100367269
503 Ga0070713_100009785
504 Ga0070708_101275872
505 Ga0070663_100000197
506 Ga0070693_101498285
507 Ga0068855_100363192
508 Ga0081455_10406792
509 Ga0075363_100002708
510 Ga0075363_100088089
511 Ga0075370_10013186
512 Ga0075370_10140685
513 Ga0075429_100326839
514 Ga0105251_10087491
515 Ga0105250_10109888
516 Ga0105245_11051601
517 Ga0105238_12912057
518 Ga0105032_101302
519 Ga0105028_115896
520 Ga0105246_11048653
521 Ga0157369_10041246
522 Ga0182008_10001610
523 Ga0182007_10005470
524 Ga0183367_1003
525 Ga0209758_1003249
526 Ga0207713_1114164
527 Ga0207647_10023187
528 Ga0207681_11137770
529 Ga0207700_10083612
530 Ga0207664_10019453
531 Ga0207639_10119761
532 Ga0207702_10419673
533 Ga0207641_12161185
534 Ga0207683_10273465
535 Ga0268264_10239865
536 Ga0307517_10014742
537 Ga0307515_10000633
538 Ga0307515_10054676
539 Ga0307515_10400154
540 Ga0268256_1017132
541 Ga0307511_10112546
542 Ga0307511_10153330
543 Ga0307511_10156377
544 Ga0307512_10001476
545 Ga0307512_10031121
546 Ga0307512_10110383
547 Ga0307513_10006146
548 Ga0307513_10029503
549 Ga0307513_10080545
550 Ga0307513_10218749
551 Ga0307513_10388761
552 Ga0307509_10006938
553 Ga0307509_10014318
554 Ga0307509_10052935
555 Ga0307508_10004538
556 Ga0307508_10101300
557 Ga0307508_10122725
558 Ga0307514_10005798
559 Ga0307514_10054699
560 Ga0307514_10082203
561 Ga0307514_10105812
562 Ga0307516_10031212
563 Ga0307516_10087445
564 Ga0307518_10058191
565 Ga0307518_10082185
566 Ga0307518_10108491
567 Ga0307518_10194442
568 Ga0307411_10378377
569 Ga0307507_10009406
570 Ga0307507_10034033
571 Ga0307510_10032704
572 Ga0307510_10075312
573 Ga0307510_10137432
574 Ga0395900_0153468
575 Ga0395898_0025678
576 Ga0395898_0027824
577 Ga0395898_0032530
578 Ga0395905_0071895
579 Ga0395901_1032563
580 Ga0439436_0008303
581 Ga0439439_0011179
582 Ga0451800_1658700
583 Ga0451802_1954197
584 Ga0451833_1284733
585 Ga0451835_0312314
586 Ga0451845_0072849
587 Ga0451849_1537953
588 Ga0451843_0057485
589 Ga0451853_0014593
590 Ga0451853_0773861
591 Ga0451853_1597964
592 Ga0451853_2952698
593 Ga0439433_0002950
594 Ga0439448_0120104
595 Ga0439449_0004122
596 Ga0439449_0006819
597 Ga0439455_0001299
598 Ga0439457_000910
599 Ga0439457_003001
600 Ga0439457_046550
601 Ga0450894_000110
602 Ga0450895_006794
603 Ga0450896_001338
604 Ga0450898_134231
605 Ga0450899_004876
606 Ga0450906_001115
607 Ga0439458_0025991
608 Ga0450908_016107
609 Ga0466969_0016940
610 Ga0466969_0025577
611 Ga0466972_0004939
612 Ga0466972_0008654
613 Ga0466972_0187529
614 Ga0466965_0001600
615 Ga0466965_0010760
616 Ga0466965_0086610
617 Ga0466965_0236266
618 Ga0466966_0001512
619 Ga0466966_0006779
620 Ga0466966_0208133
621 Ga0466966_0526587
622 Ga0466961_0002718
623 Ga0466961_0014648
624 Ga0466961_0086471
625 Ga0466961_0096637
626 Ga0466961_0414181
627 Ga0466963_0000266
628 Ga0466963_0000924
629 Ga0466963_0047275
630 Ga0466963_1116818
631 Ga0466964_0094036
632 Ga0466971_0001812
633 Ga0466971_0003467
634 Ga0466971_0032283
635 Ga0466971_0049938
636 Ga0466971_0264082
637 Ga0466971_0629109
638 Ga0466968_0010862
639 Ga0466968_0485052
640 Ga0466970_0000459
641 Ga0466970_0004210
642 Ga0466970_0106148
643 Ga0466970_0157033
644 Ga0466970_0308990
645 Ga0466957_0002411
646 Ga0466960_0001440
647 Ga0466960_0121383
648 Ga0466960_0284026
649 Ga0466960_0294141
650 Ga0466959_0000407
651 Ga0466959_0168840
652 Ga0466959_0221878
653 Ga0466959_0261962
654 Ga0466958_0000629
655 Ga0466958_0151540
656 Ga0466967_0002626
657 Ga0466967_0162320
658 Ga0466967_0289756
659 Ga0466967_0452098
660 Ga0495617_051838
661 Ga0495592_0006017
662 Ga0495592_0011001
663 Ga0495603_0001079
664 Ga0495603_0020211
665 Ga0495603_0029676
666 Ga0495603_0129860
667 Ga0495629_0002834
668 Ga0495629_0003083
669 Ga0495629_0044938
670 Ga0495629_0055064
671 Ga0495629_0060685
672 Ga0495629_0095335
673 Ga0495638_0382055
674 Ga0495651_0027093
675 Ga0495651_0313927
676 Ga0495580_0103276
677 Ga0495582_0078997
678 Ga0495582_0102490
679 Ga0495582_0355897
680 Ga0495605_0003375
681 Ga0495605_0089420
682 Ga0495662_0005584
683 Ga0495662_0025506
684 Ga0495662_0100161
685 Ga0495662_0101953
686 Ga0495664_0003688
687 Ga0495664_0246482
688 Ga0495664_0477334
689 Ga0495585_0124282
690 Ga0495585_0143420
691 Ga0495594_0000572
692 Ga0495594_0015561
693 Ga0495594_0138150
694 Ga0495607_0046210
695 Ga0495583_0013025
696 Ga0495583_0060312
697 Ga0495606_0019391
698 Ga0495608_0150877
699 Ga0495610_0026077
700 Ga0495610_0233051
701 Ga0495616_0012684
702 Ga0495618_0058320
703 Ga0495618_0191805
704 Ga0495620_0027084
705 Ga0495620_0043412
706 Ga0495620_0306967
707 Ga0495628_0092128
708 Ga0495628_0126639
709 Ga0495630_0016486
710 Ga0495631_0002194
711 Ga0495631_0099779
712 Ga0495637_0046971
713 Ga0495643_0026535
714 Ga0495643_0114781
715 Ga0495648_0267659
716 Ga0495666_0045637
717 Ga0495666_0047541
718 Ga0495652_0013340
719 Ga0495652_0109449
720 Ga0495654_0204955
721 Ga0495665_0070518
722 Ga0495640_0009664
723 Ga0495640_0517309
724 Ga0495586_0089261
725 Ga0495587_0010659
726 Ga0495587_0393824
727 Ga0495609_0015882
728 Ga0495597_0043702
729 Ga0495597_0067606
730 Ga0495645_0014168
731 Ga0495645_0015907
732 Ga0495622_0007236
733 Ga0495633_0009958
734 Ga0495667_0067801
735 Ga0495667_0147347
736 Ga0495668_0035092
737 Ga0495634_0034526
738 Ga0495611_0021075
739 Ga0495611_0239317
740 Ga0495625_0007642
741 Ga0495625_0020792
742 Ga0495625_0051749
743 Ga0495635_0425195
744 Ga0495661_0031539
745 Ga0495588_0000456
746 Ga0495588_0017197
747 Ga0495588_0212856
748 Ga0495657_0002648
749 Ga0495657_0026691
750 Ga0495657_0043956
751 Ga0495657_0087954
752 Ga0495657_0122010
753 Ga0495599_0454241
754 Ga0495623_0020208
755 Ga0495646_0004954
756 Ga0495646_0039989
757 Ga0495613_0000687
758 Ga0495613_0005357
759 Ga0495613_0007592
760 Ga0495613_0011068
761 Ga0495613_0033715
762 Ga0495613_0057052
763 Ga0495613_0138689
764 Ga0495613_0157635
765 Ga0495613_0237706
766 Ga0495624_0113148
767 Ga0495624_0446070
768 Ga0495624_0629936
769 Ga0495670_0068859
770 Ga0495670_0230228
771 Ga0495671_0028134
772 Ga0495671_0119157
773 Ga0495671_0606185
774 Ga0495649_0053489
775 Ga0495649_0099965
776 Ga0495649_0368328
777 Ga0495589_0008678
778 Ga0495589_0026502
779 Ga0495589_0050180
780 Ga0495589_0475803
781 Ga0495600_0062716
782 Ga0495600_0094015
783 Ga0495660_0070476
784 Ga0495660_0174216
785 Ga0495581_0001578
786 Ga0495604_0000486
787 Ga0495604_0035541
788 Ga0495604_0130583
789 Ga0495636_0000378
790 Ga0495636_0056381
791 Ga0495636_0116581
792 Ga0495636_0378911
793 Ga0495636_0429082
794 Ga0495676_0004901
795 Ga0495676_0004905
796 Ga0495676_0018895
797 Ga0495676_0102183
798 Ga0495676_0122380
799 Ga0495680_0008869
800 Ga0495683_0022872
801 Ga0495687_002310
802 Ga0495687_022205
803 Ga0495687_045445
804 Ga0495687_049710
805 Ga0495687_072001
806 Ga0495687_133002
807 Ga0495675_0022974
808 Ga0495675_0040124
809 Ga0495675_0043598
810 Ga0495677_0295955
811 Ga0495685_012516
812 Ga0495685_019386
813 Ga0495685_020989
814 Ga0495685_147570
815 Ga0495681_0002575
816 Ga0495686_0017484
817 Ga0495686_0074596
818 Ga0495686_0407302
819 Ga0495593_0006628
820 Ga0495593_0023443
821 Ga0495614_0000680
822 Ga0495614_0009352
823 Ga0495614_0009954
824 Ga0495614_0124467
825 Ga0495614_0149414
826 Ga0495626_0024890
827 Ga0496103_0385198
828 Ga0496104_0534992
829 Ga0496106_0015008
830 Ga0496109_0084805
831 Ga0496114_0342700
832 Ga0495678_125976
833 Ga0501031_0030962
834 Ga0501031_0327612
835 Ga0501032_0006618
836 Ga0501032_0616594
837 Ga0501033_0000804
838 Ga0501033_0038289
839 Ga0501033_0066513
840 Ga0501033_0400549
841 Ga0501033_0629293
842 Ga0501034_0039202
843 Ga0501034_0047736
844 Ga0501034_0048785
845 Ga0501034_0051887
846 Ga0501034_0073050
847 Ga0501036_0030127
848 Ga0501036_0042744
849 Ga0501036_0062615
850 Ga0501036_0438026
851 Ga0501036_1598224
852 Ga0501037_0004124
853 Ga0501037_0051182
854 Ga0501038_0003306
855 Ga0501038_0037612
856 Ga0501038_0079536
857 Ga0501039_0004258
858 Ga0501043_0002501
859 Ga0501043_0005706
860 Ga0501043_0125175
861 Ga0501043_0161285
862 Ga0501046_0040819
863 Ga0501047_0067948
864 Ga0501047_0091425
865 Ga0501047_0155207
866 Ga0501047_0498480
867 Ga0501047_0625788
868 Ga0501048_0028851
869 Ga0501048_0468645
870 Ga0501048_0543350
871 Ga0501067_0066658
872 Ga0501070_0005046
873 Ga0501070_0299096
874 Ga0501070_0374236
875 Ga0501070_0392621
876 Ga0501070_0994456
877 Ga0501073_0183358
878 Ga0501073_0310007
879 Ga0501074_0076212
880 Ga0501235_058633
881 Ga0501080_0061620
882 Ga0501035_0022571
883 Ga0501035_0037388
884 Ga0501035_0058864
885 Ga0501035_0122067
886 Ga0501035_0317999
887 Ga0501035_0542655
888 Ga0501035_0675260
889 Ga0501044_0051282
890 Ga0501044_0068759
891 Ga0501044_0083363
892 Ga0501044_0139803
893 Ga0501044_0142032
894 Ga0501044_0181691
895 Ga0501045_0607081
896 nmdc:mga03n38_72780_c1
897 nmdc:mga06z11_93521_c1
898 nmdc:mga07m45_218034_c1
899 nmdc:mga09592_309179_c1
900 Ga0495655_0058403
901 Ga0495619_0135262
902 Ga0500644_0295569
903 Ga0500646_0287680
904 Ga0500640_058975
905 Ga0500650_0177276
906 Ga0500560_016514
907 Ga0500652_067224
908 Ga0500573_0038727
909 Ga0500600_0045793
910 Ga0466962_0000182
911 Ga0466962_0003204
912 Ga0466962_0116916
913 2547408955
914 2585301711
915 2585306505
916 2585320041
917 2616693295
918 2616902932
919 2644263348
920 2644442071
921 2644631668
922 2784586346
923 2785346460
924 2785366600
925 2786667680
926 2804849324
927 2808847141
928 2808917948
929 2809229846
930 2812482744
931 2852639447
932 2862181239
933 2862290160
934 2862513479
935 2863408051
936 2867375145
937 2867431790
938 2873157915
939 2877683948
940 2912723141
941 2912726605
942 2919469993
943 2946065049
944 2946073482
945 2947232386
946 2954008395
947 2954389246
948 2954673820
949 2954690171
950 2954700021
951 2954702197
952 2954718847
953 2954728817
954 2954732995
955 2954747716
956 2954751875
957 2954766838
958 2990060188
959 3006496960
960 8008581161
961 8023624469
962 8048407280
963 8056670029
964 8056832753

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

26

139

0.92

PF12681

Glyoxalase_2

Glyoxalase-like domain

31

143

0.89

PF18029

Glyoxalase_6

Glyoxalase-like domain

32

140

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
1fa5-assembly1.cif.gz_B crystal structure of the zn(ii)-bound glyoxalase i of escherichia coli 0.8105 4 117
6bnx-assembly1.cif.gz_A crystal structure of v278e-glyoxalase i mutant from zea mays in space group p6(3) 0.8101 8 124
6bnz-assembly1.cif.gz_A crystal structure of e144q-glyoxalase i mutant from zea mays in space group p4(1)2(1)2 0.81 8 124
4pav-assembly4.cif.gz_D structure of hypothetical protein sa1046 from s. aureus. 0.8099 4 117
5d7z-assembly1.cif.gz_A crystal structure of glyoxalase i from zea mays 0.8065 8 124
ID Description Score Start End Superfamily
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9404 65 115 3.30.720.110
af_O06412_6_120_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9122 7 122 3.10.180.10
af_O06412_6_120_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9046 7 122 3.10.180.10
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9014 67 119 3.30.720.110
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8879 65 115 3.30.720.110
ID Description Score Start End GO Terms
AF-A0A7Y3PK91-F1-model_v4 VOC family protein 0.9793 2 125
AF-A0A561TXK0-F1-model_v4 Putative enzyme related to lactoylglutathione lyase 0.9771 1 125 GO:0016829
AF-A0A7J9XX55-F1-model_v4 VOC domain-containing protein 0.9709 2 123 GO:0004756
GO:0005524
GO:0005737
GO:0016260
AF-A0A561TXK0-F1-model_v4 Putative enzyme related to lactoylglutathione lyase 0.9695 1 125 GO:0016829
AF-A0A6L5EXA2-F1-model_v4 VOC family protein 0.9692 2 118

Map