F452525
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 481 | 294 | 472 | 203 |
Family's Representative Sequence
| Representative Sequence | 3300053090|Ga0500646_0000786|Ga0500646_0000786_7053_7775 |
| Length | 240 |
| Sequence | MGAGELFHESNNHIRSGVFRTTVRSNTFPALHQQTDFRRNIVNILQINSSARADGSQSTLLANDISARLSAANPGAKLTVRDFASTPHPALDEATLQALFTPAGQHTPEQAARVALDDALIAELQAADAVVLGVPMYNFAISTQLKNWIDAVCRVRVTFRYTEKGPEGLLKGKKVYVALARGGIYRDGPADSQVPYLKTVLGFLGMTDVQFFYAEGLSISPENAQKALAQARSEIETALA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2600255318 | Pseudomonas putida NFIX47 | Isolate | Rhizoplane |
| 2 | 2603880185 | Pseudomonas sp. NFIX46 | Isolate | Rhizoplane |
| 3 | 2603880199 | Pseudomonas sp. NFIX49 | Isolate | Rhizoplane |
| 4 | 2623620443 | Pseudomonas sp. DR 5-09 | Isolate | Unclassified |
| 5 | 2713897149 | Pseudomonas fluorescens SF4c | Isolate | Rhizosphere |
| 6 | 2818991436 | Collimonas arenae 515 | Isolate | Unclassified |
| 7 | 2878029506 | Pseudomonas fluorescens DR397 | Isolate | Rhizosphere |
| 8 | 2919063839 | Pseudomonas pharyngis 1098 | Isolate | Rhizosphere |
| 9 | 3007718800 | Pseudomonas fluorescens BW11P2 | Isolate | Rhizosphere |
| 10 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 11 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 12 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 13 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 14 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 15 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 16 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 17 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 18 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 19 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 20 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 21 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 22 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 23 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 24 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 25 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 26 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 32 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 35 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 37 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 46 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 59 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 60 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 65 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 66 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 67 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 69 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 72 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 74 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 75 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 76 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 78 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 79 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 80 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 81 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 82 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 83 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 84 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 85 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 86 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 87 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 88 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 89 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 90 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 91 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 92 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 93 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 94 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 96 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 97 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 98 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 99 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 100 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 102 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 103 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 126 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 127 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 137 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 138 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 140 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 202 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 205 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 206 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 207 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 208 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 209 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 210 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 211 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 212 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 213 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 214 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 215 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 216 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 217 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 218 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 219 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 220 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 221 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 222 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 223 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 224 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 225 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 258 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 259 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 260 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 261 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 262 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 263 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 264 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 265 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 266 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 267 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 268 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 269 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 270 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 271 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 272 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 273 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 274 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 275 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 276 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 277 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 278 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 281 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 282 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 283 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 284 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 285 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 286 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 287 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 288 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 289 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 290 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 291 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 292 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 293 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 294 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.71 |
| Metatranscriptomes | 0.42 |
| Isolates | 1.87 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.23 |
| Nodule | 0.42 |
| Rhizoplane | 3.74 |
| Rhizosphere | 82.95 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.66 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24752J21851_1012656 | 3300001976 | Bacteria | 1103 |
| 2 | JGI24752J21851_1014174 | 3300001976 | Bacteria | 1040 |
| 3 | JGI24746J21847_1017993 | 3300001977 | Bacteria | 1001 |
| 4 | JGI24743J22301_10013231 | 3300001991 | Bacteria | 1510 |
| 5 | JGI24751J29686_10026323 | 3300002459 | Bacteria | 1207 |
| 6 | JGI25162J39368_1000001 | 3300002737 | Bacteria | 740113 |
| 7 | JGI25165J46597_1000001 | 3300003214 | Bacteria | 1111887 |
| 8 | Ga0055538_1000001 | 3300003751 | Bacteria | 1111887 |
| 9 | Ga0055539_1000001 | 3300003752 | Bacteria | 1111887 |
| 10 | Ga0055533_1000003 | 3300003756 | Bacteria | 1111887 |
| 11 | Ga0055525_1000003 | 3300003759 | Bacteria | 962094 |
| 12 | Ga0055524_1000204 | 3300003775 | Bacteria | 64269 |
| 13 | Ga0055540_1000026 | 3300003792 | Bacteria | 189071 |
| 14 | Ga0055540_1000042 | 3300003792 | Bacteria | 156410 |
| 15 | Ga0055531_10016062 | 3300003794 | Bacteria | 3256 |
| 16 | Ga0055541_1000001 | 3300003841 | Bacteria | 1111887 |
| 17 | Ga0065714_10077050 | 3300005288 | Bacteria | 2727 |
| 18 | Ga0065715_10144015 | 3300005293 | Bacteria | 1813 |
| 19 | Ga0070658_10016023 | 3300005327 | Bacteria | 5996 |
| 20 | Ga0070658_10040557 | 3300005327 | Bacteria | 3756 |
| 21 | Ga0070658_10143152 | 3300005327 | Bacteria | 1998 |
| 22 | Ga0070658_10155173 | 3300005327 | Bacteria | 1919 |
| 23 | Ga0070658_10202552 | 3300005327 | Bacteria | 1675 |
| 24 | Ga0070658_10846206 | 3300005327 | Bacteria | 795 |
| 25 | Ga0070683_100070646 | 3300005329 | Bacteria | 3257 |
| 26 | Ga0070683_100072736 | 3300005329 | Bacteria | 3210 |
| 27 | Ga0070683_100087359 | 3300005329 | Bacteria | 2924 |
| 28 | Ga0070690_100427546 | 3300005330 | Bacteria | 978 |
| 29 | Ga0070670_100054892 | 3300005331 | Bacteria | 3420 |
| 30 | Ga0070670_100355990 | 3300005331 | Bacteria | 1286 |
| 31 | Ga0070677_10047270 | 3300005333 | Bacteria | 1724 |
| 32 | Ga0070677_10253920 | 3300005333 | Bacteria | 874 |
| 33 | Ga0068869_100030153 | 3300005334 | Bacteria | 3805 |
| 34 | Ga0068869_100088949 | 3300005334 | Bacteria | 2318 |
| 35 | Ga0070666_10002655 | 3300005335 | Bacteria | 10784 |
| 36 | Ga0070666_10030372 | 3300005335 | Bacteria | 3560 |
| 37 | Ga0070680_100261742 | 3300005336 | Bacteria | 1463 |
| 38 | Ga0068868_100047421 | 3300005338 | Bacteria | 3367 |
| 39 | Ga0070660_100016897 | 3300005339 | Bacteria | 5309 |
| 40 | Ga0070660_100037279 | 3300005339 | Bacteria | 3686 |
| 41 | Ga0070660_100165594 | 3300005339 | Bacteria | 1783 |
| 42 | Ga0070689_100040722 | 3300005340 | Bacteria | 3562 |
| 43 | Ga0070689_100106678 | 3300005340 | Bacteria | 2223 |
| 44 | Ga0070687_100005371 | 3300005343 | Bacteria | 5179 |
| 45 | Ga0070661_100005014 | 3300005344 | Bacteria | 9121 |
| 46 | Ga0070661_100024349 | 3300005344 | Bacteria | 4342 |
| 47 | Ga0070661_100028042 | 3300005344 | Bacteria | 4059 |
| 48 | Ga0070661_100087086 | 3300005344 | Bacteria | 2310 |
| 49 | Ga0070661_100408038 | 3300005344 | Bacteria | 1075 |
| 50 | Ga0070692_10034412 | 3300005345 | Bacteria | 2559 |
| 51 | Ga0070668_100033744 | 3300005347 | Bacteria | 3899 |
| 52 | Ga0070669_100210635 | 3300005353 | Bacteria | 1533 |
| 53 | Ga0070669_100339172 | 3300005353 | Bacteria | 1217 |
| 54 | Ga0070675_100085960 | 3300005354 | Bacteria | 2628 |
| 55 | Ga0070675_100257053 | 3300005354 | Bacteria | 1530 |
| 56 | Ga0070675_100462983 | 3300005354 | Bacteria | 1138 |
| 57 | Ga0070671_100005440 | 3300005355 | Bacteria | 10166 |
| 58 | Ga0070671_100093555 | 3300005355 | Bacteria | 2519 |
| 59 | Ga0070671_100592758 | 3300005355 | Bacteria | 957 |
| 60 | Ga0070673_100038126 | 3300005364 | Bacteria | 3668 |
| 61 | Ga0070673_100424283 | 3300005364 | Bacteria | 1193 |
| 62 | Ga0070673_100660221 | 3300005364 | Bacteria | 958 |
| 63 | Ga0070688_100093029 | 3300005365 | Bacteria | 1973 |
| 64 | Ga0070659_100003324 | 3300005366 | Bacteria | 11445 |
| 65 | Ga0070659_100084341 | 3300005366 | Bacteria | 2541 |
| 66 | Ga0070659_100242623 | 3300005366 | Bacteria | 1492 |
| 67 | Ga0070659_100266525 | 3300005366 | Bacteria | 1422 |
| 68 | Ga0070667_100009568 | 3300005367 | Bacteria | 8034 |
| 69 | Ga0070667_100016725 | 3300005367 | Bacteria | 6071 |
| 70 | Ga0070667_100874500 | 3300005367 | Bacteria | 836 |
| 71 | Ga0070703_10099580 | 3300005406 | Bacteria | 1022 |
| 72 | Ga0070709_10524820 | 3300005434 | Bacteria | 903 |
| 73 | Ga0070714_100224951 | 3300005435 | Bacteria | 1726 |
| 74 | Ga0070714_100238149 | 3300005435 | Bacteria | 1679 |
| 75 | Ga0070713_100060993 | 3300005436 | Bacteria | 3155 |
| 76 | Ga0070711_100208187 | 3300005439 | Bacteria | 1513 |
| 77 | Ga0070694_100493070 | 3300005444 | Bacteria | 974 |
| 78 | Ga0070708_100028894 | 3300005445 | Bacteria | 4775 |
| 79 | Ga0070663_100055910 | 3300005455 | Bacteria | 2826 |
| 80 | Ga0070663_100058347 | 3300005455 | Bacteria | 2771 |
| 81 | Ga0070678_100042004 | 3300005456 | Bacteria | 3247 |
| 82 | Ga0070678_100357844 | 3300005456 | Bacteria | 1257 |
| 83 | Ga0070678_100610930 | 3300005456 | Bacteria | 974 |
| 84 | Ga0070662_100865631 | 3300005457 | Bacteria | 770 |
| 85 | Ga0068867_100014842 | 3300005459 | Bacteria | 5523 |
| 86 | Ga0068867_100058852 | 3300005459 | Bacteria | 2847 |
| 87 | Ga0068867_100132305 | 3300005459 | Bacteria | 1940 |
| 88 | Ga0068867_100224410 | 3300005459 | Bacteria | 1516 |
| 89 | Ga0070685_10095206 | 3300005466 | Bacteria | 1810 |
| 90 | Ga0070706_100120937 | 3300005467 | Bacteria | 2441 |
| 91 | Ga0070707_100008881 | 3300005468 | Bacteria | 9321 |
| 92 | Ga0070698_100135569 | 3300005471 | Bacteria | 2416 |
| 93 | Ga0070699_100302347 | 3300005518 | Bacteria | 1435 |
| 94 | Ga0070679_100126652 | 3300005530 | Bacteria | 2536 |
| 95 | Ga0070679_100302106 | 3300005530 | Bacteria | 1551 |
| 96 | Ga0070679_101099066 | 3300005530 | Bacteria | 740 |
| 97 | Ga0070684_100006408 | 3300005535 | Bacteria | 9104 |
| 98 | Ga0068853_100050650 | 3300005539 | Bacteria | 3573 |
| 99 | Ga0068853_100652779 | 3300005539 | Bacteria | 1001 |
| 100 | Ga0070672_100055448 | 3300005543 | Bacteria | 3105 |
| 101 | Ga0070672_100063630 | 3300005543 | Bacteria | 2913 |
| 102 | Ga0070686_100003655 | 3300005544 | Bacteria | 8442 |
| 103 | Ga0070686_100738902 | 3300005544 | Bacteria | 788 |
| 104 | Ga0070695_100655418 | 3300005545 | Bacteria | 829 |
| 105 | Ga0070665_100007975 | 3300005548 | Bacteria | 10731 |
| 106 | Ga0070665_100044397 | 3300005548 | Bacteria | 4463 |
| 107 | Ga0070665_100252413 | 3300005548 | Bacteria | 1764 |
| 108 | Ga0070665_100529669 | 3300005548 | Bacteria | 1190 |
| 109 | Ga0068855_100022858 | 3300005563 | Bacteria | 7494 |
| 110 | Ga0068855_100025794 | 3300005563 | Bacteria | 7029 |
| 111 | Ga0068855_100097539 | 3300005563 | Bacteria | 3386 |
| 112 | Ga0070664_100239819 | 3300005564 | Bacteria | 1627 |
| 113 | Ga0070664_100780944 | 3300005564 | Bacteria | 892 |
| 114 | Ga0068857_100087707 | 3300005577 | Bacteria | 2783 |
| 115 | Ga0068857_101456861 | 3300005577 | Bacteria | 667 |
| 116 | Ga0068854_100006558 | 3300005578 | Bacteria | 7410 |
| 117 | Ga0068854_100053820 | 3300005578 | Bacteria | 2892 |
| 118 | Ga0068854_100100193 | 3300005578 | Bacteria | 2171 |
| 119 | Ga0068856_100076010 | 3300005614 | Bacteria | 3327 |
| 120 | Ga0068856_100358119 | 3300005614 | Bacteria | 1478 |
| 121 | Ga0068856_100451087 | 3300005614 | Bacteria | 1307 |
| 122 | Ga0070702_100147426 | 3300005615 | Bacteria | 1506 |
| 123 | Ga0068852_100001878 | 3300005616 | Bacteria | 14297 |
| 124 | Ga0068852_100067037 | 3300005616 | Bacteria | 3137 |
| 125 | Ga0068852_100215729 | 3300005616 | Bacteria | 1823 |
| 126 | Ga0068859_100028494 | 3300005617 | Bacteria | 5599 |
| 127 | Ga0068859_100289329 | 3300005617 | Bacteria | 1731 |
| 128 | Ga0068864_100006715 | 3300005618 | Bacteria | 9427 |
| 129 | Ga0068864_100028485 | 3300005618 | Bacteria | 4722 |
| 130 | Ga0068851_10002022 | 3300005834 | Bacteria | 8945 |
| 131 | Ga0068851_10004293 | 3300005834 | Bacteria | 6419 |
| 132 | Ga0068870_10243452 | 3300005840 | Bacteria | 1111 |
| 133 | Ga0068863_100007463 | 3300005841 | Bacteria | 10703 |
| 134 | Ga0068863_100115056 | 3300005841 | Bacteria | 2563 |
| 135 | Ga0068863_100265460 | 3300005841 | Bacteria | 1660 |
| 136 | Ga0068858_100005763 | 3300005842 | Bacteria | 12102 |
| 137 | Ga0068858_100006723 | 3300005842 | Bacteria | 11190 |
| 138 | Ga0068858_100097454 | 3300005842 | Bacteria | 2741 |
| 139 | Ga0068858_100741713 | 3300005842 | Bacteria | 957 |
| 140 | Ga0068860_100007369 | 3300005843 | Bacteria | 11000 |
| 141 | Ga0068860_100078639 | 3300005843 | Bacteria | 3136 |
| 142 | Ga0068860_101120425 | 3300005843 | Bacteria | 806 |
| 143 | Ga0068862_100100611 | 3300005844 | Bacteria | 2528 |
| 144 | Ga0068862_100241518 | 3300005844 | Bacteria | 1642 |
| 145 | Ga0075365_10006101 | 3300006038 | Bacteria | 6588 |
| 146 | Ga0075368_10010496 | 3300006042 | Bacteria | 3348 |
| 147 | Ga0075363_100009281 | 3300006048 | Bacteria | 4620 |
| 148 | Ga0075364_10079108 | 3300006051 | Bacteria | 2172 |
| 149 | Ga0070712_100121732 | 3300006175 | Bacteria | 1964 |
| 150 | Ga0075362_10370238 | 3300006177 | Bacteria | 719 |
| 151 | Ga0075367_10039428 | 3300006178 | Bacteria | 2754 |
| 152 | Ga0075369_10002108 | 3300006186 | Bacteria | 7029 |
| 153 | Ga0097621_100001231 | 3300006237 | Bacteria | 17731 |
| 154 | Ga0097621_100030668 | 3300006237 | Bacteria | 4259 |
| 155 | Ga0097621_100164529 | 3300006237 | Bacteria | 1909 |
| 156 | Ga0097621_100606167 | 3300006237 | Bacteria | 1001 |
| 157 | Ga0075370_10052436 | 3300006353 | Bacteria | 2314 |
| 158 | Ga0068871_100049763 | 3300006358 | Bacteria | 3388 |
| 159 | Ga0068871_101203877 | 3300006358 | Bacteria | 710 |
| 160 | Ga0075428_100333774 | 3300006844 | Bacteria | 1629 |
| 161 | Ga0075433_10236302 | 3300006852 | Bacteria | 1622 |
| 162 | Ga0075434_100117152 | 3300006871 | Bacteria | 2676 |
| 163 | Ga0075434_100679906 | 3300006871 | Bacteria | 1047 |
| 164 | Ga0097620_100028493 | 3300006931 | Bacteria | 5599 |
| 165 | Ga0097620_100289316 | 3300006931 | Bacteria | 1731 |
| 166 | Ga0079104_1000012 | 3300006946 | Bacteria | 355143 |
| 167 | Ga0075435_100105799 | 3300007076 | Bacteria | 2336 |
| 168 | Ga0105240_10049207 | 3300009093 | Bacteria | 5322 |
| 169 | Ga0105240_10108588 | 3300009093 | Bacteria | 3362 |
| 170 | Ga0111539_10023201 | 3300009094 | Bacteria | 7621 |
| 171 | Ga0114129_10147537 | 3300009147 | Bacteria | 3221 |
| 172 | Ga0105243_10000026 | 3300009148 | Bacteria | 191522 |
| 173 | Ga0105243_10245497 | 3300009148 | Bacteria | 1595 |
| 174 | Ga0105241_10950430 | 3300009174 | Unclassified | 801 |
| 175 | Ga0105248_10349733 | 3300009177 | Bacteria | 1664 |
| 176 | Ga0105248_10499323 | 3300009177 | Bacteria | 1372 |
| 177 | Ga0105237_10012537 | 3300009545 | Bacteria | 8929 |
| 178 | Ga0105237_10189495 | 3300009545 | Bacteria | 2057 |
| 179 | Ga0105237_10659328 | 3300009545 | Bacteria | 1053 |
| 180 | Ga0105238_10165641 | 3300009551 | Bacteria | 2186 |
| 181 | Ga0105238_10180709 | 3300009551 | Bacteria | 2086 |
| 182 | Ga0105249_10267644 | 3300009553 | Bacteria | 1701 |
| 183 | Ga0105249_10283424 | 3300009553 | Bacteria | 1656 |
| 184 | Ga0105239_10027940 | 3300010375 | Bacteria | 6207 |
| 185 | Ga0105246_10000009 | 3300011119 | Bacteria | 79055 |
| 186 | Ga0105246_11118787 | 3300011119 | Bacteria | 720 |
| 187 | Ga0157371_10020162 | 3300013102 | Bacteria | 4907 |
| 188 | Ga0157370_10268602 | 3300013104 | Bacteria | 1576 |
| 189 | Ga0157369_10004002 | 3300013105 | Bacteria | 17483 |
| 190 | Ga0157369_10065883 | 3300013105 | Bacteria | 3898 |
| 191 | Ga0157369_10478663 | 3300013105 | Bacteria | 1289 |
| 192 | Ga0157374_10078308 | 3300013296 | Bacteria | 3130 |
| 193 | Ga0157374_10209630 | 3300013296 | Bacteria | 1910 |
| 194 | Ga0157374_10350122 | 3300013296 | Bacteria | 1468 |
| 195 | Ga0157372_10043081 | 3300013307 | Bacteria | 4996 |
| 196 | Ga0157372_10085616 | 3300013307 | Bacteria | 3575 |
| 197 | Ga0157372_10351789 | 3300013307 | Bacteria | 1716 |
| 198 | Ga0157375_10161514 | 3300013308 | Bacteria | 2382 |
| 199 | Ga0163163_10025578 | 3300014325 | Bacteria | 5627 |
| 200 | Ga0163163_10677623 | 3300014325 | Bacteria | 1095 |
| 201 | Ga0157380_10312290 | 3300014326 | Bacteria | 1453 |
| 202 | Ga0157380_10540109 | 3300014326 | Bacteria | 1141 |
| 203 | Ga0157377_10006645 | 3300014745 | Bacteria | 5528 |
| 204 | Ga0157379_10004094 | 3300014968 | Bacteria | 12438 |
| 205 | Ga0157379_10006148 | 3300014968 | Bacteria | 10336 |
| 206 | Ga0157379_10014978 | 3300014968 | Bacteria | 6802 |
| 207 | Ga0157379_10021303 | 3300014968 | Bacteria | 5736 |
| 208 | Ga0157376_10008653 | 3300014969 | Bacteria | 7356 |
| 209 | Ga0157376_10925065 | 3300014969 | Bacteria | 891 |
| 210 | Ga0182006_1005754 | 3300015261 | Bacteria | 5849 |
| 211 | Ga0182005_1000426 | 3300015265 | Bacteria | 22438 |
| 212 | Ga0163161_10016555 | 3300017792 | Bacteria | 5148 |
| 213 | Ga0163161_10043174 | 3300017792 | Bacteria | 3246 |
| 214 | Ga0163161_10170800 | 3300017792 | Bacteria | 1662 |
| 215 | Ga0209784_100004 | 3300025224 | Bacteria | 1378156 |
| 216 | Ga0209566_100004 | 3300025225 | Bacteria | 1531866 |
| 217 | Ga0209674_100006 | 3300025226 | Bacteria | 1531866 |
| 218 | Ga0209563_100009 | 3300025230 | Bacteria | 1378156 |
| 219 | Ga0207427_101002 | 3300025231 | Bacteria | 11854 |
| 220 | Ga0209437_100004 | 3300025233 | Bacteria | 1378156 |
| 221 | Ga0209677_100005 | 3300025253 | Bacteria | 1378156 |
| 222 | Ga0209233_1000005 | 3300025261 | Bacteria | 1531866 |
| 223 | Ga0209565_1015283 | 3300025263 | Bacteria | 1735 |
| 224 | Ga0209675_1003824 | 3300025291 | Bacteria | 6942 |
| 225 | Ga0209050_1001164 | 3300025298 | Bacteria | 31211 |
| 226 | Ga0209050_1006021 | 3300025298 | Bacteria | 7347 |
| 227 | Ga0209256_1000030 | 3300025299 | Bacteria | 414828 |
| 228 | Ga0209051_1000004 | 3300025303 | Bacteria | 1155596 |
| 229 | Ga0209257_1000063 | 3300025304 | Bacteria | 359089 |
| 230 | Ga0207697_10000327 | 3300025315 | Bacteria | 26562 |
| 231 | Ga0207697_10068153 | 3300025315 | Bacteria | 1488 |
| 232 | Ga0207713_1008074 | 3300025735 | Bacteria | 6106 |
| 233 | Ga0207682_10000401 | 3300025893 | Bacteria | 19968 |
| 234 | Ga0207692_10169314 | 3300025898 | Bacteria | 1265 |
| 235 | Ga0207642_10026405 | 3300025899 | Bacteria | 2364 |
| 236 | Ga0207688_10001039 | 3300025901 | Bacteria | 14229 |
| 237 | Ga0207680_10059029 | 3300025903 | Bacteria | 2328 |
| 238 | Ga0207680_10074922 | 3300025903 | Bacteria | 2109 |
| 239 | Ga0207680_10109779 | 3300025903 | Bacteria | 1787 |
| 240 | Ga0207647_10301081 | 3300025904 | Bacteria | 913 |
| 241 | Ga0207699_10219826 | 3300025906 | Bacteria | 1296 |
| 242 | Ga0207699_10394096 | 3300025906 | Bacteria | 985 |
| 243 | Ga0207645_10001404 | 3300025907 | Bacteria | 19722 |
| 244 | Ga0207645_10005645 | 3300025907 | Bacteria | 9041 |
| 245 | Ga0207645_10059653 | 3300025907 | Bacteria | 2437 |
| 246 | Ga0207643_10001077 | 3300025908 | Bacteria | 16138 |
| 247 | Ga0207643_10263960 | 3300025908 | Bacteria | 1064 |
| 248 | Ga0207705_10088362 | 3300025909 | Bacteria | 2267 |
| 249 | Ga0207705_10090492 | 3300025909 | Bacteria | 2240 |
| 250 | Ga0207684_10178842 | 3300025910 | Bacteria | 1829 |
| 251 | Ga0207684_10182198 | 3300025910 | Bacteria | 1811 |
| 252 | Ga0207654_10167568 | 3300025911 | Bacteria | 1424 |
| 253 | Ga0207707_10040947 | 3300025912 | Bacteria | 4045 |
| 254 | Ga0207695_10039528 | 3300025913 | Bacteria | 5070 |
| 255 | Ga0207695_10190589 | 3300025913 | Bacteria | 1968 |
| 256 | Ga0207671_10350166 | 3300025914 | Unclassified | 1171 |
| 257 | Ga0207663_10631217 | 3300025916 | Bacteria | 844 |
| 258 | Ga0207660_10058257 | 3300025917 | Bacteria | 2769 |
| 259 | Ga0207660_10562267 | 3300025917 | Bacteria | 928 |
| 260 | Ga0207662_10015568 | 3300025918 | Bacteria | 4282 |
| 261 | Ga0207657_10000148 | 3300025919 | Bacteria | 71376 |
| 262 | Ga0207657_10040493 | 3300025919 | Bacteria | 4128 |
| 263 | Ga0207657_10057663 | 3300025919 | Bacteria | 3346 |
| 264 | Ga0207649_10013644 | 3300025920 | Bacteria | 4540 |
| 265 | Ga0207649_10095082 | 3300025920 | Bacteria | 1960 |
| 266 | Ga0207649_10225853 | 3300025920 | Bacteria | 1336 |
| 267 | Ga0207649_10308233 | 3300025920 | Bacteria | 1160 |
| 268 | Ga0207652_10049993 | 3300025921 | Bacteria | 3581 |
| 269 | Ga0207652_10297455 | 3300025921 | Bacteria | 1457 |
| 270 | Ga0207652_10944417 | 3300025921 | Unclassified | 760 |
| 271 | Ga0207681_10012826 | 3300025923 | Bacteria | 5181 |
| 272 | Ga0207681_10195425 | 3300025923 | Bacteria | 1550 |
| 273 | Ga0207694_10034794 | 3300025924 | Bacteria | 3863 |
| 274 | Ga0207694_10172309 | 3300025924 | Bacteria | 1753 |
| 275 | Ga0207650_10005466 | 3300025925 | Bacteria | 8670 |
| 276 | Ga0207650_10011303 | 3300025925 | Bacteria | 6143 |
| 277 | Ga0207650_10125055 | 3300025925 | Bacteria | 2006 |
| 278 | Ga0207659_10010014 | 3300025926 | Bacteria | 5937 |
| 279 | Ga0207664_10077783 | 3300025929 | Bacteria | 2689 |
| 280 | Ga0207664_10093532 | 3300025929 | Bacteria | 2469 |
| 281 | Ga0207644_10066958 | 3300025931 | Bacteria | 2616 |
| 282 | Ga0207644_10144641 | 3300025931 | Bacteria | 1834 |
| 283 | Ga0207644_10337278 | 3300025931 | Bacteria | 1222 |
| 284 | Ga0207644_10561703 | 3300025931 | Bacteria | 945 |
| 285 | Ga0207690_10065525 | 3300025932 | Bacteria | 2485 |
| 286 | Ga0207690_10131881 | 3300025932 | Bacteria | 1830 |
| 287 | Ga0207690_10139516 | 3300025932 | Bacteria | 1784 |
| 288 | Ga0207690_10142205 | 3300025932 | Bacteria | 1769 |
| 289 | Ga0207690_10239018 | 3300025932 | Bacteria | 1398 |
| 290 | Ga0207706_10065640 | 3300025933 | Bacteria | 3196 |
| 291 | Ga0207709_10000004 | 3300025935 | Bacteria | 825156 |
| 292 | Ga0207670_10047310 | 3300025936 | Bacteria | 2864 |
| 293 | Ga0207670_11136065 | 3300025936 | Bacteria | 660 |
| 294 | Ga0207669_10002243 | 3300025937 | Bacteria | 8217 |
| 295 | Ga0207704_10308472 | 3300025938 | Bacteria | 1215 |
| 296 | Ga0207704_10613198 | 3300025938 | Bacteria | 892 |
| 297 | Ga0207691_10001645 | 3300025940 | Bacteria | 22169 |
| 298 | Ga0207691_10039202 | 3300025940 | Bacteria | 4382 |
| 299 | Ga0207711_10038962 | 3300025941 | Bacteria | 4041 |
| 300 | Ga0207711_10199086 | 3300025941 | Bacteria | 1827 |
| 301 | Ga0207689_10004738 | 3300025942 | Bacteria | 12265 |
| 302 | Ga0207661_10061603 | 3300025944 | Bacteria | 3032 |
| 303 | Ga0207661_10118076 | 3300025944 | Bacteria | 2254 |
| 304 | Ga0207661_10158633 | 3300025944 | Bacteria | 1961 |
| 305 | Ga0207679_10030925 | 3300025945 | Bacteria | 3743 |
| 306 | Ga0207679_10077167 | 3300025945 | Bacteria | 2533 |
| 307 | Ga0207679_10332491 | 3300025945 | Bacteria | 1319 |
| 308 | Ga0207679_10364131 | 3300025945 | Bacteria | 1263 |
| 309 | Ga0207667_10002522 | 3300025949 | Bacteria | 22797 |
| 310 | Ga0207667_10038232 | 3300025949 | Bacteria | 5127 |
| 311 | Ga0207667_11217075 | 3300025949 | Bacteria | 732 |
| 312 | Ga0207651_10001670 | 3300025960 | Bacteria | 10194 |
| 313 | Ga0207651_10133517 | 3300025960 | Bacteria | 1904 |
| 314 | Ga0207651_11095671 | 3300025960 | Bacteria | 714 |
| 315 | Ga0207712_10111953 | 3300025961 | Bacteria | 2049 |
| 316 | Ga0207668_10002211 | 3300025972 | Bacteria | 11341 |
| 317 | Ga0207668_10113583 | 3300025972 | Bacteria | 2037 |
| 318 | Ga0207668_10930833 | 3300025972 | Bacteria | 774 |
| 319 | Ga0207640_10042529 | 3300025981 | Bacteria | 2898 |
| 320 | Ga0207640_10055621 | 3300025981 | Bacteria | 2593 |
| 321 | Ga0207640_10104025 | 3300025981 | Bacteria | 1998 |
| 322 | Ga0207658_10016322 | 3300025986 | Bacteria | 5107 |
| 323 | Ga0207658_10240601 | 3300025986 | Bacteria | 1533 |
| 324 | Ga0207658_10432680 | 3300025986 | Bacteria | 1162 |
| 325 | Ga0207658_10903931 | 3300025986 | Bacteria | 804 |
| 326 | Ga0207658_10920117 | 3300025986 | Bacteria | 796 |
| 327 | Ga0207677_10728089 | 3300026023 | Bacteria | 882 |
| 328 | Ga0207703_10007765 | 3300026035 | Bacteria | 8491 |
| 329 | Ga0207703_10160539 | 3300026035 | Bacteria | 1968 |
| 330 | Ga0207703_10791642 | 3300026035 | Bacteria | 905 |
| 331 | Ga0207639_10128041 | 3300026041 | Bacteria | 2097 |
| 332 | Ga0207639_10128749 | 3300026041 | Bacteria | 2092 |
| 333 | Ga0207678_10000214 | 3300026067 | Bacteria | 51419 |
| 334 | Ga0207678_10000936 | 3300026067 | Bacteria | 26595 |
| 335 | Ga0207678_10302560 | 3300026067 | Bacteria | 1374 |
| 336 | Ga0207708_10016844 | 3300026075 | Bacteria | 5502 |
| 337 | Ga0207708_10068289 | 3300026075 | Bacteria | 2721 |
| 338 | Ga0207702_10027810 | 3300026078 | Bacteria | 4698 |
| 339 | Ga0207702_10069608 | 3300026078 | Bacteria | 3025 |
| 340 | Ga0207702_10306814 | 3300026078 | Bacteria | 1508 |
| 341 | Ga0207702_10373329 | 3300026078 | Bacteria | 1370 |
| 342 | Ga0207641_10004511 | 3300026088 | Bacteria | 12038 |
| 343 | Ga0207641_10090080 | 3300026088 | Bacteria | 2682 |
| 344 | Ga0207641_10554957 | 3300026088 | Bacteria | 1120 |
| 345 | Ga0207648_10000251 | 3300026089 | Bacteria | 58026 |
| 346 | Ga0207648_10016512 | 3300026089 | Bacteria | 6742 |
| 347 | Ga0207648_10124977 | 3300026089 | Bacteria | 2262 |
| 348 | Ga0207676_10085638 | 3300026095 | Bacteria | 2572 |
| 349 | Ga0207674_10000312 | 3300026116 | Bacteria | 61824 |
| 350 | Ga0207674_10001327 | 3300026116 | Bacteria | 32088 |
| 351 | Ga0207674_11416016 | 3300026116 | Bacteria | 664 |
| 352 | Ga0207675_100000240 | 3300026118 | Bacteria | 52035 |
| 353 | Ga0207683_10001464 | 3300026121 | Bacteria | 21278 |
| 354 | Ga0207683_10015062 | 3300026121 | Bacteria | 6581 |
| 355 | Ga0207683_10652936 | 3300026121 | Bacteria | 974 |
| 356 | Ga0207698_10000387 | 3300026142 | Bacteria | 25394 |
| 357 | Ga0207698_10072876 | 3300026142 | Bacteria | 2732 |
| 358 | Ga0207698_10081199 | 3300026142 | Bacteria | 2616 |
| 359 | Ga0207698_10201098 | 3300026142 | Bacteria | 1784 |
| 360 | Ga0209281_1000039 | 3300027111 | Bacteria | 355150 |
| 361 | Ga0268266_10058800 | 3300028379 | Bacteria | 3310 |
| 362 | Ga0268266_10076058 | 3300028379 | Bacteria | 2917 |
| 363 | Ga0268266_10336193 | 3300028379 | Bacteria | 1417 |
| 364 | Ga0268265_10198532 | 3300028380 | Bacteria | 1738 |
| 365 | Ga0268265_10520293 | 3300028380 | Bacteria | 1124 |
| 366 | Ga0307517_10004553 | 3300028786 | Bacteria | 21271 |
| 367 | Ga0307517_10157925 | 3300028786 | Bacteria | 1532 |
| 368 | Ga0307511_10002108 | 3300030521 | Bacteria | 20827 |
| 369 | Ga0307512_10214989 | 3300030522 | Bacteria | 1015 |
| 370 | Ga0307509_10128491 | 3300031507 | Bacteria | 2495 |
| 371 | Ga0373939_0074926 | 3300035114 | Bacteria | 1111 |
| 372 | Ga0373945_0016787 | 3300035116 | Bacteria | 2474 |
| 373 | Ga0373945_0061544 | 3300035116 | Bacteria | 1402 |
| 374 | Ga0373957_0053024 | 3300035120 | Bacteria | 1555 |
| 375 | Ga0373935_0168619 | 3300035692 | Bacteria | 1496 |
| 376 | Ga0373935_0197946 | 3300035692 | Bacteria | 1387 |
| 377 | Ga0373927_0010570 | 3300035695 | Bacteria | 6152 |
| 378 | Ga0373947_0103574 | 3300035725 | Bacteria | 1791 |
| 379 | Ga0373937_0062385 | 3300036401 | Bacteria | 3427 |
| 380 | Ga0373937_0161929 | 3300036401 | Bacteria | 2098 |
| 381 | Ga0373937_0313924 | 3300036401 | Bacteria | 1483 |
| 382 | Ga0373925_0194032 | 3300037068 | Bacteria | 1612 |
| 383 | Ga0373925_0251460 | 3300037068 | Bacteria | 1418 |
| 384 | Ga0395900_0229589 | 3300037418 | Bacteria | 1867 |
| 385 | Ga0395905_0228029 | 3300037471 | Bacteria | 1742 |
| 386 | Ga0395901_0364597 | 3300038443 | Bacteria | 1489 |
| 387 | Ga0237819_00427 | 3300038705 | Bacteria | 14476 |
| 388 | Ga0451577_0000288 | 3300042876 | Bacteria | 97988 |
| 389 | Ga0453683_0722176 | 3300044673 | Bacteria | 653 |
| 390 | Ga0466961_0261373 | 3300044693 | Bacteria | 1061 |
| 391 | Ga0453684_0001971 | 3300044712 | Bacteria | 52708 |
| 392 | Ga0466959_0172704 | 3300045049 | Bacteria | 1515 |
| 393 | Ga0495592_0028815 | 3300046454 | Bacteria | 4202 |
| 394 | Ga0495590_0125658 | 3300046457 | Bacteria | 920 |
| 395 | Ga0495629_0255188 | 3300046459 | Bacteria | 1206 |
| 396 | Ga0495651_0003178 | 3300046462 | Bacteria | 12620 |
| 397 | Ga0495651_0087041 | 3300046462 | Bacteria | 2349 |
| 398 | Ga0495651_0122783 | 3300046462 | Bacteria | 1905 |
| 399 | Ga0495653_0001379 | 3300046463 | Bacteria | 18872 |
| 400 | Ga0495580_0280443 | 3300046472 | Bacteria | 1137 |
| 401 | Ga0495639_0100557 | 3300046475 | Bacteria | 1365 |
| 402 | Ga0495594_0243144 | 3300046499 | Bacteria | 1026 |
| 403 | Ga0495608_0015364 | 3300046511 | Bacteria | 5310 |
| 404 | Ga0495608_0542279 | 3300046511 | Bacteria | 701 |
| 405 | Ga0495618_0107453 | 3300046514 | Bacteria | 1787 |
| 406 | Ga0495628_0000835 | 3300046516 | Bacteria | 28571 |
| 407 | Ga0495628_0106315 | 3300046516 | Bacteria | 2161 |
| 408 | Ga0495648_0241049 | 3300046524 | Bacteria | 879 |
| 409 | Ga0495642_0031355 | 3300046528 | Bacteria | 2131 |
| 410 | Ga0495652_0007889 | 3300046529 | Bacteria | 9776 |
| 411 | Ga0495652_0243190 | 3300046529 | Bacteria | 1337 |
| 412 | Ga0495586_0079721 | 3300046535 | Bacteria | 1798 |
| 413 | Ga0495598_0047173 | 3300046537 | Bacteria | 1283 |
| 414 | Ga0495621_0007222 | 3300046539 | Bacteria | 3281 |
| 415 | Ga0495625_0078461 | 3300046660 | Bacteria | 2305 |
| 416 | Ga0495635_0116222 | 3300046663 | Bacteria | 1826 |
| 417 | Ga0495623_0110417 | 3300046679 | Bacteria | 1667 |
| 418 | Ga0495646_0102786 | 3300046680 | Bacteria | 1636 |
| 419 | Ga0495613_0250151 | 3300046689 | Bacteria | 1237 |
| 420 | Ga0495600_0008733 | 3300046809 | Bacteria | 6233 |
| 421 | Ga0495660_0033876 | 3300046810 | Bacteria | 2861 |
| 422 | Ga0495604_0015311 | 3300047317 | Bacteria | 6121 |
| 423 | Ga0495636_0003615 | 3300047318 | Bacteria | 5997 |
| 424 | Ga0495672_0000022 | 3300047320 | Bacteria | 420632 |
| 425 | Ga0495676_0038136 | 3300047321 | Bacteria | 3994 |
| 426 | Ga0495687_049396 | 3300047443 | Bacteria | 1798 |
| 427 | Ga0495685_017197 | 3300047447 | Bacteria | 2475 |
| 428 | Ga0495673_0176363 | 3300047469 | Bacteria | 812 |
| 429 | Ga0495602_0165513 | 3300048088 | Bacteria | 1721 |
| 430 | Ga0495602_0366389 | 3300048088 | Bacteria | 1036 |
| 431 | Ga0496100_0053750 | 3300048903 | Bacteria | 2624 |
| 432 | Ga0496101_0046391 | 3300048904 | Bacteria | 3116 |
| 433 | Ga0496102_0326542 | 3300048905 | Bacteria | 1445 |
| 434 | Ga0496103_0135465 | 3300048906 | Bacteria | 1574 |
| 435 | Ga0496104_0009523 | 3300048907 | Bacteria | 8647 |
| 436 | Ga0496105_0039566 | 3300048908 | Bacteria | 3887 |
| 437 | Ga0496106_0010089 | 3300048909 | Bacteria | 6976 |
| 438 | Ga0496107_0174958 | 3300048910 | Bacteria | 1593 |
| 439 | Ga0496108_0033008 | 3300048911 | Bacteria | 4300 |
| 440 | Ga0496109_0023114 | 3300048912 | Bacteria | 5515 |
| 441 | Ga0496111_0143554 | 3300048914 | Bacteria | 1769 |
| 442 | Ga0496114_0009447 | 3300048917 | Bacteria | 7742 |
| 443 | Ga0496114_0030958 | 3300048917 | Bacteria | 4401 |
| 444 | Ga0496114_0802381 | 3300048917 | Bacteria | 820 |
| 445 | Ga0496115_0306108 | 3300048918 | Bacteria | 1302 |
| 446 | Ga0501308_038018 | 3300049128 | Bacteria | 669 |
| 447 | Ga0501320_027345 | 3300049536 | Bacteria | 693 |
| 448 | nmdc:mga0yw44_13601_c1 | 3300050492 | Bacteria | 4290 |
| 449 | nmdc:mga0yw44_537880_c1 | 3300050492 | Bacteria | 793 |
| 450 | nmdc:mga0k408_293311_c1 | 3300050493 | Bacteria | 971 |
| 451 | nmdc:mga07m45_2935_c1 | 3300050496 | Bacteria | 8096 |
| 452 | nmdc:mga05p37_171071_c1 | 3300050507 | Bacteria | 2649 |
| 453 | nmdc:mga0n895_1399622_c1 | 3300050512 | Bacteria | 668 |
| 454 | nmdc:mga0sz30_306989_c1 | 3300050516 | Bacteria | 708 |
| 455 | Ga0495601_0002871 | 3300053077 | Bacteria | 9800 |
| 456 | Ga0495601_0264635 | 3300053077 | Bacteria | 1122 |
| 457 | Ga0495595_0145352 | 3300053084 | Bacteria | 1165 |
| 458 | Ga0500644_0112041 | 3300053088 | Bacteria | 1052 |
| 459 | Ga0500646_0000786 | 3300053090 | Bacteria | 8853 |
| 460 | Ga0500583_0055371 | 3300053092 | Bacteria | 1854 |
| 461 | Ga0500650_0004587 | 3300053098 | Bacteria | 5017 |
| 462 | Ga0500555_047096 | 3300053103 | Bacteria | 1187 |
| 463 | Ga0500593_000624 | 3300053117 | Bacteria | 13611 |
| 464 | Ga0500595_002293 | 3300053119 | Bacteria | 9600 |
| 465 | Ga0500655_001002 | 3300053133 | Bacteria | 5456 |
| 466 | Ga0500568_0026321 | 3300053139 | Bacteria | 2443 |
| 467 | Ga0500574_018796 | 3300053141 | Bacteria | 1710 |
| 468 | Ga0500604_0000537 | 3300053151 | Bacteria | 10439 |
| 469 | Ga0500616_0234772 | 3300053153 | Bacteria | 792 |
| 470 | Ga0500619_000493 | 3300053154 | Bacteria | 6893 |
| 471 | Ga0500622_0182403 | 3300053156 | Unclassified | 969 |
| 472 | Ga0500645_053977 | 3300053730 | Bacteria | 1169 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046457 | Ga0495590_0125658 | Ga0495590_0125658_29_529 | 164 |
| 2 | 3300046511 | Ga0495608_0542279 | Ga0495608_0542279_131_676 | 176 |
| 3 | 3300046528 | Ga0495642_0031355 | Ga0495642_0031355_546_1247 | 187 |
| 4 | 3300047318 | Ga0495636_0003615 | Ga0495636_0003615_1262_1963 | 187 |
| 5 | 3300047447 | Ga0495685_017197 | Ga0495685_017197_815_1516 | 187 |
| 6 | 3300044673 | Ga0453683_0722176 | Ga0453683_0722176_22_636 | 190 |
| 7 | 3300006844 | Ga0075428_100333774 | Ga0075428_1003337742 | 194 |
| 8 | iso_pu_bacteria | 2600255318 | 2601799630 | 196 |
| 9 | iso_pu_bacteria | 2603880185 | 2606078136 | 196 |
| 10 | iso_pu_bacteria | 2603880199 | 2606130244 | 196 |
| 11 | iso_pu_bacteria | 2623620443 | 2624480657 | 196 |
| 12 | iso_pu_bacteria | 2713897149 | 2715756616 | 196 |
| 13 | iso_pu_bacteria | 2818991436 | 2819540593 | 196 |
| 14 | iso_pu_bacteria | 2878029506 | 2878032532 | 196 |
| 15 | iso_pu_bacteria | 2919063839 | 2919065090 | 196 |
| 16 | iso_pu_bacteria | 3007718800 | 3007719169 | 196 |
| 17 | 3300005330 | Ga0070690_100427546 | Ga0070690_1004275461 | 199 |
| 18 | 3300005331 | Ga0070670_100054892 | Ga0070670_1000548923 | 199 |
| 19 | 3300005334 | Ga0068869_100088949 | Ga0068869_1000889492 | 199 |
| 20 | 3300005335 | Ga0070666_10002655 | Ga0070666_100026551 | 199 |
| 21 | 3300005338 | Ga0068868_100047421 | Ga0068868_1000474212 | 199 |
| 22 | 3300005347 | Ga0070668_100033744 | Ga0070668_1000337442 | 199 |
| 23 | 3300005354 | Ga0070675_100462983 | Ga0070675_1004629832 | 199 |
| 24 | 3300005355 | Ga0070671_100005440 | Ga0070671_1000054401 | 199 |
| 25 | 3300005364 | Ga0070673_100038126 | Ga0070673_1000381263 | 199 |
| 26 | 3300005367 | Ga0070667_100016725 | Ga0070667_1000167255 | 199 |
| 27 | 3300005456 | Ga0070678_100610930 | Ga0070678_1006109301 | 199 |
| 28 | 3300005459 | Ga0068867_100014842 | Ga0068867_1000148426 | 199 |
| 29 | 3300005548 | Ga0070665_100007975 | Ga0070665_1000079753 | 199 |
| 30 | 3300005617 | Ga0068859_100289329 | Ga0068859_1002893292 | 199 |
| 31 | 3300005618 | Ga0068864_100006715 | Ga0068864_1000067152 | 199 |
| 32 | 3300005841 | Ga0068863_100007463 | Ga0068863_1000074632 | 199 |
| 33 | 3300005842 | Ga0068858_100006723 | Ga0068858_1000067234 | 199 |
| 34 | 3300005843 | Ga0068860_100007369 | Ga0068860_1000073698 | 199 |
| 35 | 3300005844 | Ga0068862_100100611 | Ga0068862_1001006112 | 199 |
| 36 | 3300006038 | Ga0075365_10006101 | Ga0075365_1000610110 | 199 |
| 37 | 3300006042 | Ga0075368_10010496 | Ga0075368_100104963 | 199 |
| 38 | 3300006048 | Ga0075363_100009281 | Ga0075363_1000092816 | 199 |
| 39 | 3300006051 | Ga0075364_10079108 | Ga0075364_100791081 | 199 |
| 40 | 3300006178 | Ga0075367_10039428 | Ga0075367_100394282 | 199 |
| 41 | 3300006186 | Ga0075369_10002108 | Ga0075369_100021084 | 199 |
| 42 | 3300006237 | Ga0097621_100001231 | Ga0097621_1000012312 | 199 |
| 43 | 3300006353 | Ga0075370_10052436 | Ga0075370_100524364 | 199 |
| 44 | 3300006931 | Ga0097620_100289316 | Ga0097620_1002893161 | 199 |
| 45 | 3300009148 | Ga0105243_10245497 | Ga0105243_102454971 | 199 |
| 46 | 3300009177 | Ga0105248_10349733 | Ga0105248_103497332 | 199 |
| 47 | 3300009553 | Ga0105249_10283424 | Ga0105249_102834242 | 199 |
| 48 | 3300013296 | Ga0157374_10209630 | Ga0157374_102096302 | 199 |
| 49 | 3300014968 | Ga0157379_10014978 | Ga0157379_100149783 | 199 |
| 50 | 3300017792 | Ga0163161_10043174 | Ga0163161_100431742 | 199 |
| 51 | 3300025315 | Ga0207697_10068153 | Ga0207697_100681532 | 199 |
| 52 | 3300025903 | Ga0207680_10059029 | Ga0207680_100590291 | 199 |
| 53 | 3300025907 | Ga0207645_10001404 | Ga0207645_100014042 | 199 |
| 54 | 3300025908 | Ga0207643_10263960 | Ga0207643_102639602 | 199 |
| 55 | 3300025923 | Ga0207681_10012826 | Ga0207681_100128263 | 199 |
| 56 | 3300025925 | Ga0207650_10011303 | Ga0207650_100113035 | 199 |
| 57 | 3300025931 | Ga0207644_10144641 | Ga0207644_101446412 | 199 |
| 58 | 3300025940 | Ga0207691_10001645 | Ga0207691_100016459 | 199 |
| 59 | 3300025941 | Ga0207711_10199086 | Ga0207711_101990862 | 199 |
| 60 | 3300025960 | Ga0207651_10001670 | Ga0207651_100016708 | 199 |
| 61 | 3300025972 | Ga0207668_10002211 | Ga0207668_100022119 | 199 |
| 62 | 3300025986 | Ga0207658_10016322 | Ga0207658_100163225 | 199 |
| 63 | 3300026088 | Ga0207641_10004511 | Ga0207641_100045113 | 199 |
| 64 | 3300026089 | Ga0207648_10000251 | Ga0207648_100002519 | 199 |
| 65 | 3300026095 | Ga0207676_10085638 | Ga0207676_100856382 | 199 |
| 66 | 3300026121 | Ga0207683_10652936 | Ga0207683_106529362 | 199 |
| 67 | 3300028380 | Ga0268265_10198532 | Ga0268265_101985322 | 199 |
| 68 | 3300030521 | Ga0307511_10002108 | Ga0307511_1000210822 | 199 |
| 69 | 3300042876 | Ga0451577_0000288 | Ga0451577_0000288_37240_37839 | 199 |
| 70 | 3300044712 | Ga0453684_0001971 | Ga0453684_0001971_37241_37840 | 199 |
| 71 | 3300046475 | Ga0495639_0100557 | Ga0495639_0100557_64_675 | 199 |
| 72 | 3300046535 | Ga0495586_0079721 | Ga0495586_0079721_646_1257 | 199 |
| 73 | 3300046810 | Ga0495660_0033876 | Ga0495660_0033876_800_1399 | 199 |
| 74 | 3300047320 | Ga0495672_0000022 | Ga0495672_0000022_105641_106240 | 199 |
| 75 | 3300048917 | Ga0496114_0802381 | Ga0496114_0802381_126_755 | 199 |
| 76 | 3300050492 | nmdc:mga0yw44_13601_c1 | nmdc:mga0yw44_13601_c1_53_652 | 199 |
| 77 | 3300050492 | nmdc:mga0yw44_537880_c1 | nmdc:mga0yw44_537880_c1_184_783 | 199 |
| 78 | 3300050493 | nmdc:mga0k408_293311_c1 | nmdc:mga0k408_293311_c1_164_763 | 199 |
| 79 | 3300050496 | nmdc:mga07m45_2935_c1 | nmdc:mga07m45_2935_c1_941_1540 | 199 |
| 80 | 3300050516 | nmdc:mga0sz30_306989_c1 | nmdc:mga0sz30_306989_c1_97_696 | 199 |
| 81 | 3300053088 | Ga0500644_0112041 | Ga0500644_0112041_47_646 | 199 |
| 82 | 3300053090 | Ga0500646_0000786 | Ga0500646_0000786_7053_7775 | 199 |
| 83 | 3300053092 | Ga0500583_0055371 | Ga0500583_0055371_722_1321 | 199 |
| 84 | 3300053103 | Ga0500555_047096 | Ga0500555_047096_112_834 | 199 |
| 85 | 3300053133 | Ga0500655_001002 | Ga0500655_001002_857_1579 | 199 |
| 86 | 3300053139 | Ga0500568_0026321 | Ga0500568_0026321_1210_1932 | 199 |
| 87 | 3300053151 | Ga0500604_0000537 | Ga0500604_0000537_3789_4511 | 199 |
| 88 | 3300053153 | Ga0500616_0234772 | Ga0500616_0234772_62_661 | 199 |
| 89 | 3300053156 | Ga0500622_0182403 | Ga0500622_0182403_22_654 | 199 |
| 90 | 3300053730 | Ga0500645_053977 | Ga0500645_053977_184_906 | 199 |
| 91 | 3300001976 | JGI24752J21851_1012656 | JGI24752J21851_10126562 | 200 |
| 92 | 3300001976 | JGI24752J21851_1014174 | JGI24752J21851_10141742 | 200 |
| 93 | 3300001977 | JGI24746J21847_1017993 | JGI24746J21847_10179931 | 200 |
| 94 | 3300001991 | JGI24743J22301_10013231 | JGI24743J22301_100132312 | 200 |
| 95 | 3300002459 | JGI24751J29686_10026323 | JGI24751J29686_100263232 | 200 |
| 96 | 3300002737 | JGI25162J39368_1000001 | JGI25162J39368_1000001579 | 200 |
| 97 | 3300003214 | JGI25165J46597_1000001 | JGI25165J46597_1000001567 | 200 |
| 98 | 3300003751 | Ga0055538_1000001 | Ga0055538_1000001467 | 200 |
| 99 | 3300003752 | Ga0055539_1000001 | Ga0055539_1000001467 | 200 |
| 100 | 3300003756 | Ga0055533_1000003 | Ga0055533_1000003567 | 200 |
| 101 | 3300003759 | Ga0055525_1000003 | Ga0055525_1000003567 | 200 |
| 102 | 3300003775 | Ga0055524_1000204 | Ga0055524_100020434 | 200 |
| 103 | 3300003792 | Ga0055540_1000026 | Ga0055540_1000026118 | 200 |
| 104 | 3300003792 | Ga0055540_1000042 | Ga0055540_10000426 | 200 |
| 105 | 3300003794 | Ga0055531_10016062 | Ga0055531_100160623 | 200 |
| 106 | 3300003841 | Ga0055541_1000001 | Ga0055541_1000001567 | 200 |
| 107 | 3300005288 | Ga0065714_10077050 | Ga0065714_100770504 | 200 |
| 108 | 3300005293 | Ga0065715_10144015 | Ga0065715_101440152 | 200 |
| 109 | 3300005327 | Ga0070658_10016023 | Ga0070658_100160234 | 200 |
| 110 | 3300005327 | Ga0070658_10040557 | Ga0070658_100405572 | 200 |
| 111 | 3300005327 | Ga0070658_10143152 | Ga0070658_101431522 | 200 |
| 112 | 3300005327 | Ga0070658_10155173 | Ga0070658_101551732 | 200 |
| 113 | 3300005327 | Ga0070658_10202552 | Ga0070658_102025522 | 200 |
| 114 | 3300005327 | Ga0070658_10846206 | Ga0070658_108462061 | 200 |
| 115 | 3300005329 | Ga0070683_100070646 | Ga0070683_1000706461 | 200 |
| 116 | 3300005329 | Ga0070683_100072736 | Ga0070683_1000727363 | 200 |
| 117 | 3300005329 | Ga0070683_100087359 | Ga0070683_1000873592 | 200 |
| 118 | 3300005331 | Ga0070670_100355990 | Ga0070670_1003559901 | 200 |
| 119 | 3300005333 | Ga0070677_10047270 | Ga0070677_100472703 | 200 |
| 120 | 3300005333 | Ga0070677_10253920 | Ga0070677_102539201 | 200 |
| 121 | 3300005334 | Ga0068869_100030153 | Ga0068869_1000301533 | 200 |
| 122 | 3300005335 | Ga0070666_10030372 | Ga0070666_100303723 | 200 |
| 123 | 3300005336 | Ga0070680_100261742 | Ga0070680_1002617421 | 200 |
| 124 | 3300005339 | Ga0070660_100016897 | Ga0070660_1000168972 | 200 |
| 125 | 3300005339 | Ga0070660_100037279 | Ga0070660_1000372793 | 200 |
| 126 | 3300005339 | Ga0070660_100165594 | Ga0070660_1001655943 | 200 |
| 127 | 3300005340 | Ga0070689_100040722 | Ga0070689_1000407222 | 200 |
| 128 | 3300005340 | Ga0070689_100106678 | Ga0070689_1001066783 | 200 |
| 129 | 3300005343 | Ga0070687_100005371 | Ga0070687_1000053711 | 200 |
| 130 | 3300005344 | Ga0070661_100005014 | Ga0070661_1000050145 | 200 |
| 131 | 3300005344 | Ga0070661_100024349 | Ga0070661_1000243494 | 200 |
| 132 | 3300005344 | Ga0070661_100028042 | Ga0070661_1000280424 | 200 |
| 133 | 3300005344 | Ga0070661_100087086 | Ga0070661_1000870863 | 200 |
| 134 | 3300005344 | Ga0070661_100408038 | Ga0070661_1004080382 | 200 |
| 135 | 3300005345 | Ga0070692_10034412 | Ga0070692_100344122 | 200 |
| 136 | 3300005353 | Ga0070669_100210635 | Ga0070669_1002106352 | 200 |
| 137 | 3300005353 | Ga0070669_100339172 | Ga0070669_1003391722 | 200 |
| 138 | 3300005354 | Ga0070675_100085960 | Ga0070675_1000859601 | 200 |
| 139 | 3300005354 | Ga0070675_100257053 | Ga0070675_1002570532 | 200 |
| 140 | 3300005355 | Ga0070671_100093555 | Ga0070671_1000935552 | 200 |
| 141 | 3300005355 | Ga0070671_100592758 | Ga0070671_1005927581 | 200 |
| 142 | 3300005364 | Ga0070673_100424283 | Ga0070673_1004242832 | 200 |
| 143 | 3300005364 | Ga0070673_100660221 | Ga0070673_1006602211 | 200 |
| 144 | 3300005365 | Ga0070688_100093029 | Ga0070688_1000930292 | 200 |
| 145 | 3300005366 | Ga0070659_100003324 | Ga0070659_1000033247 | 200 |
| 146 | 3300005366 | Ga0070659_100084341 | Ga0070659_1000843413 | 200 |
| 147 | 3300005366 | Ga0070659_100242623 | Ga0070659_1002426231 | 200 |
| 148 | 3300005366 | Ga0070659_100266525 | Ga0070659_1002665252 | 200 |
| 149 | 3300005367 | Ga0070667_100009568 | Ga0070667_1000095687 | 200 |
| 150 | 3300005367 | Ga0070667_100874500 | Ga0070667_1008745002 | 200 |
| 151 | 3300005406 | Ga0070703_10099580 | Ga0070703_100995801 | 200 |
| 152 | 3300005434 | Ga0070709_10524820 | Ga0070709_105248201 | 200 |
| 153 | 3300005435 | Ga0070714_100224951 | Ga0070714_1002249511 | 200 |
| 154 | 3300005435 | Ga0070714_100238149 | Ga0070714_1002381492 | 200 |
| 155 | 3300005436 | Ga0070713_100060993 | Ga0070713_1000609933 | 200 |
| 156 | 3300005439 | Ga0070711_100208187 | Ga0070711_1002081872 | 200 |
| 157 | 3300005444 | Ga0070694_100493070 | Ga0070694_1004930702 | 200 |
| 158 | 3300005445 | Ga0070708_100028894 | Ga0070708_1000288943 | 200 |
| 159 | 3300005455 | Ga0070663_100055910 | Ga0070663_1000559104 | 200 |
| 160 | 3300005455 | Ga0070663_100058347 | Ga0070663_1000583472 | 200 |
| 161 | 3300005456 | Ga0070678_100042004 | Ga0070678_1000420043 | 200 |
| 162 | 3300005456 | Ga0070678_100357844 | Ga0070678_1003578442 | 200 |
| 163 | 3300005457 | Ga0070662_100865631 | Ga0070662_1008656311 | 200 |
| 164 | 3300005459 | Ga0068867_100058852 | Ga0068867_1000588522 | 200 |
| 165 | 3300005459 | Ga0068867_100132305 | Ga0068867_1001323052 | 200 |
| 166 | 3300005459 | Ga0068867_100224410 | Ga0068867_1002244102 | 200 |
| 167 | 3300005466 | Ga0070685_10095206 | Ga0070685_100952062 | 200 |
| 168 | 3300005467 | Ga0070706_100120937 | Ga0070706_1001209373 | 200 |
| 169 | 3300005468 | Ga0070707_100008881 | Ga0070707_10000888112 | 200 |
| 170 | 3300005471 | Ga0070698_100135569 | Ga0070698_1001355692 | 200 |
| 171 | 3300005518 | Ga0070699_100302347 | Ga0070699_1003023471 | 200 |
| 172 | 3300005530 | Ga0070679_100126652 | Ga0070679_1001266522 | 200 |
| 173 | 3300005530 | Ga0070679_100302106 | Ga0070679_1003021062 | 200 |
| 174 | 3300005530 | Ga0070679_101099066 | Ga0070679_1010990661 | 200 |
| 175 | 3300005535 | Ga0070684_100006408 | Ga0070684_1000064084 | 200 |
| 176 | 3300005539 | Ga0068853_100050650 | Ga0068853_1000506502 | 200 |
| 177 | 3300005539 | Ga0068853_100652779 | Ga0068853_1006527791 | 200 |
| 178 | 3300005543 | Ga0070672_100055448 | Ga0070672_1000554483 | 200 |
| 179 | 3300005543 | Ga0070672_100063630 | Ga0070672_1000636303 | 200 |
| 180 | 3300005544 | Ga0070686_100003655 | Ga0070686_1000036557 | 200 |
| 181 | 3300005544 | Ga0070686_100738902 | Ga0070686_1007389021 | 200 |
| 182 | 3300005545 | Ga0070695_100655418 | Ga0070695_1006554181 | 200 |
| 183 | 3300005548 | Ga0070665_100044397 | Ga0070665_1000443976 | 200 |
| 184 | 3300005548 | Ga0070665_100252413 | Ga0070665_1002524131 | 200 |
| 185 | 3300005548 | Ga0070665_100529669 | Ga0070665_1005296692 | 200 |
| 186 | 3300005563 | Ga0068855_100022858 | Ga0068855_1000228587 | 200 |
| 187 | 3300005563 | Ga0068855_100025794 | Ga0068855_1000257947 | 200 |
| 188 | 3300005563 | Ga0068855_100097539 | Ga0068855_1000975391 | 200 |
| 189 | 3300005564 | Ga0070664_100239819 | Ga0070664_1002398192 | 200 |
| 190 | 3300005564 | Ga0070664_100780944 | Ga0070664_1007809442 | 200 |
| 191 | 3300005577 | Ga0068857_100087707 | Ga0068857_1000877072 | 200 |
| 192 | 3300005577 | Ga0068857_101456861 | Ga0068857_1014568611 | 200 |
| 193 | 3300005578 | Ga0068854_100006558 | Ga0068854_1000065582 | 200 |
| 194 | 3300005578 | Ga0068854_100053820 | Ga0068854_1000538202 | 200 |
| 195 | 3300005578 | Ga0068854_100100193 | Ga0068854_1001001933 | 200 |
| 196 | 3300005614 | Ga0068856_100076010 | Ga0068856_1000760103 | 200 |
| 197 | 3300005614 | Ga0068856_100358119 | Ga0068856_1003581192 | 200 |
| 198 | 3300005614 | Ga0068856_100451087 | Ga0068856_1004510871 | 200 |
| 199 | 3300005615 | Ga0070702_100147426 | Ga0070702_1001474262 | 200 |
| 200 | 3300005616 | Ga0068852_100001878 | Ga0068852_1000018784 | 200 |
| 201 | 3300005616 | Ga0068852_100067037 | Ga0068852_1000670373 | 200 |
| 202 | 3300005616 | Ga0068852_100215729 | Ga0068852_1002157292 | 200 |
| 203 | 3300005617 | Ga0068859_100028494 | Ga0068859_1000284942 | 200 |
| 204 | 3300005618 | Ga0068864_100028485 | Ga0068864_1000284853 | 200 |
| 205 | 3300005834 | Ga0068851_10002022 | Ga0068851_100020226 | 200 |
| 206 | 3300005834 | Ga0068851_10004293 | Ga0068851_100042937 | 200 |
| 207 | 3300005840 | Ga0068870_10243452 | Ga0068870_102434522 | 200 |
| 208 | 3300005841 | Ga0068863_100115056 | Ga0068863_1001150563 | 200 |
| 209 | 3300005841 | Ga0068863_100265460 | Ga0068863_1002654602 | 200 |
| 210 | 3300005842 | Ga0068858_100005763 | Ga0068858_1000057639 | 200 |
| 211 | 3300005842 | Ga0068858_100097454 | Ga0068858_1000974542 | 200 |
| 212 | 3300005842 | Ga0068858_100741713 | Ga0068858_1007417132 | 200 |
| 213 | 3300005843 | Ga0068860_100078639 | Ga0068860_1000786392 | 200 |
| 214 | 3300005843 | Ga0068860_101120425 | Ga0068860_1011204252 | 200 |
| 215 | 3300005844 | Ga0068862_100241518 | Ga0068862_1002415182 | 200 |
| 216 | 3300006175 | Ga0070712_100121732 | Ga0070712_1001217322 | 200 |
| 217 | 3300006177 | Ga0075362_10370238 | Ga0075362_103702381 | 200 |
| 218 | 3300006237 | Ga0097621_100030668 | Ga0097621_1000306684 | 200 |
| 219 | 3300006237 | Ga0097621_100164529 | Ga0097621_1001645292 | 200 |
| 220 | 3300006237 | Ga0097621_100606167 | Ga0097621_1006061671 | 200 |
| 221 | 3300006358 | Ga0068871_100049763 | Ga0068871_1000497634 | 200 |
| 222 | 3300006358 | Ga0068871_101203877 | Ga0068871_1012038771 | 200 |
| 223 | 3300006852 | Ga0075433_10236302 | Ga0075433_102363022 | 200 |
| 224 | 3300006871 | Ga0075434_100117152 | Ga0075434_1001171523 | 200 |
| 225 | 3300006871 | Ga0075434_100679906 | Ga0075434_1006799061 | 200 |
| 226 | 3300006931 | Ga0097620_100028493 | Ga0097620_1000284932 | 200 |
| 227 | 3300006946 | Ga0079104_1000012 | Ga0079104_100001225 | 200 |
| 228 | 3300007076 | Ga0075435_100105799 | Ga0075435_1001057992 | 200 |
| 229 | 3300009093 | Ga0105240_10049207 | Ga0105240_100492074 | 200 |
| 230 | 3300009093 | Ga0105240_10108588 | Ga0105240_101085882 | 200 |
| 231 | 3300009094 | Ga0111539_10023201 | Ga0111539_100232019 | 200 |
| 232 | 3300009147 | Ga0114129_10147537 | Ga0114129_101475373 | 200 |
| 233 | 3300009148 | Ga0105243_10000026 | Ga0105243_10000026175 | 200 |
| 234 | 3300009174 | Ga0105241_10950430 | Ga0105241_109504301 | 200 |
| 235 | 3300009177 | Ga0105248_10499323 | Ga0105248_104993232 | 200 |
| 236 | 3300009545 | Ga0105237_10012537 | Ga0105237_100125374 | 200 |
| 237 | 3300009545 | Ga0105237_10189495 | Ga0105237_101894953 | 200 |
| 238 | 3300009545 | Ga0105237_10659328 | Ga0105237_106593282 | 200 |
| 239 | 3300009551 | Ga0105238_10165641 | Ga0105238_101656412 | 200 |
| 240 | 3300009551 | Ga0105238_10180709 | Ga0105238_101807092 | 200 |
| 241 | 3300009553 | Ga0105249_10267644 | Ga0105249_102676442 | 200 |
| 242 | 3300010375 | Ga0105239_10027940 | Ga0105239_100279405 | 200 |
| 243 | 3300011119 | Ga0105246_10000009 | Ga0105246_1000000953 | 200 |
| 244 | 3300011119 | Ga0105246_11118787 | Ga0105246_111187871 | 200 |
| 245 | 3300013102 | Ga0157371_10020162 | Ga0157371_100201625 | 200 |
| 246 | 3300013104 | Ga0157370_10268602 | Ga0157370_102686022 | 200 |
| 247 | 3300013105 | Ga0157369_10004002 | Ga0157369_1000400218 | 200 |
| 248 | 3300013105 | Ga0157369_10065883 | Ga0157369_100658832 | 200 |
| 249 | 3300013105 | Ga0157369_10478663 | Ga0157369_104786632 | 200 |
| 250 | 3300013296 | Ga0157374_10078308 | Ga0157374_100783083 | 200 |
| 251 | 3300013296 | Ga0157374_10350122 | Ga0157374_103501222 | 200 |
| 252 | 3300013307 | Ga0157372_10043081 | Ga0157372_100430815 | 200 |
| 253 | 3300013307 | Ga0157372_10085616 | Ga0157372_100856162 | 200 |
| 254 | 3300013307 | Ga0157372_10351789 | Ga0157372_103517892 | 200 |
| 255 | 3300013308 | Ga0157375_10161514 | Ga0157375_101615142 | 200 |
| 256 | 3300014325 | Ga0163163_10025578 | Ga0163163_100255784 | 200 |
| 257 | 3300014325 | Ga0163163_10677623 | Ga0163163_106776232 | 200 |
| 258 | 3300014326 | Ga0157380_10312290 | Ga0157380_103122902 | 200 |
| 259 | 3300014326 | Ga0157380_10540109 | Ga0157380_105401092 | 200 |
| 260 | 3300014745 | Ga0157377_10006645 | Ga0157377_100066453 | 200 |
| 261 | 3300014968 | Ga0157379_10004094 | Ga0157379_1000409413 | 200 |
| 262 | 3300014968 | Ga0157379_10006148 | Ga0157379_100061481 | 200 |
| 263 | 3300014968 | Ga0157379_10021303 | Ga0157379_100213035 | 200 |
| 264 | 3300014969 | Ga0157376_10008653 | Ga0157376_100086531 | 200 |
| 265 | 3300014969 | Ga0157376_10925065 | Ga0157376_109250652 | 200 |
| 266 | 3300015261 | Ga0182006_1005754 | Ga0182006_10057542 | 200 |
| 267 | 3300015265 | Ga0182005_1000426 | Ga0182005_100042620 | 200 |
| 268 | 3300017792 | Ga0163161_10016555 | Ga0163161_100165551 | 200 |
| 269 | 3300017792 | Ga0163161_10170800 | Ga0163161_101708002 | 200 |
| 270 | 3300025224 | Ga0209784_100004 | Ga0209784_100004562 | 200 |
| 271 | 3300025225 | Ga0209566_100004 | Ga0209566_100004719 | 200 |
| 272 | 3300025226 | Ga0209674_100006 | Ga0209674_100006719 | 200 |
| 273 | 3300025230 | Ga0209563_100009 | Ga0209563_100009562 | 200 |
| 274 | 3300025231 | Ga0207427_101002 | Ga0207427_1010027 | 200 |
| 275 | 3300025233 | Ga0209437_100004 | Ga0209437_100004562 | 200 |
| 276 | 3300025253 | Ga0209677_100005 | Ga0209677_100005562 | 200 |
| 277 | 3300025261 | Ga0209233_1000005 | Ga0209233_1000005719 | 200 |
| 278 | 3300025263 | Ga0209565_1015283 | Ga0209565_10152832 | 200 |
| 279 | 3300025291 | Ga0209675_1003824 | Ga0209675_10038245 | 200 |
| 280 | 3300025298 | Ga0209050_1001164 | Ga0209050_100116428 | 200 |
| 281 | 3300025298 | Ga0209050_1006021 | Ga0209050_10060215 | 200 |
| 282 | 3300025299 | Ga0209256_1000030 | Ga0209256_1000030177 | 200 |
| 283 | 3300025303 | Ga0209051_1000004 | Ga0209051_1000004597 | 200 |
| 284 | 3300025304 | Ga0209257_1000063 | Ga0209257_100006383 | 200 |
| 285 | 3300025315 | Ga0207697_10000327 | Ga0207697_1000032723 | 200 |
| 286 | 3300025735 | Ga0207713_1008074 | Ga0207713_10080744 | 200 |
| 287 | 3300025893 | Ga0207682_10000401 | Ga0207682_100004018 | 200 |
| 288 | 3300025898 | Ga0207692_10169314 | Ga0207692_101693142 | 200 |
| 289 | 3300025899 | Ga0207642_10026405 | Ga0207642_100264052 | 200 |
| 290 | 3300025901 | Ga0207688_10001039 | Ga0207688_1000103913 | 200 |
| 291 | 3300025903 | Ga0207680_10074922 | Ga0207680_100749222 | 200 |
| 292 | 3300025903 | Ga0207680_10109779 | Ga0207680_101097792 | 200 |
| 293 | 3300025904 | Ga0207647_10301081 | Ga0207647_103010812 | 200 |
| 294 | 3300025906 | Ga0207699_10219826 | Ga0207699_102198262 | 200 |
| 295 | 3300025906 | Ga0207699_10394096 | Ga0207699_103940961 | 200 |
| 296 | 3300025907 | Ga0207645_10005645 | Ga0207645_100056458 | 200 |
| 297 | 3300025907 | Ga0207645_10059653 | Ga0207645_100596531 | 200 |
| 298 | 3300025908 | Ga0207643_10001077 | Ga0207643_100010778 | 200 |
| 299 | 3300025909 | Ga0207705_10088362 | Ga0207705_100883623 | 200 |
| 300 | 3300025909 | Ga0207705_10090492 | Ga0207705_100904923 | 200 |
| 301 | 3300025910 | Ga0207684_10178842 | Ga0207684_101788422 | 200 |
| 302 | 3300025910 | Ga0207684_10182198 | Ga0207684_101821981 | 200 |
| 303 | 3300025911 | Ga0207654_10167568 | Ga0207654_101675682 | 200 |
| 304 | 3300025912 | Ga0207707_10040947 | Ga0207707_100409473 | 200 |
| 305 | 3300025913 | Ga0207695_10039528 | Ga0207695_100395284 | 200 |
| 306 | 3300025913 | Ga0207695_10190589 | Ga0207695_101905892 | 200 |
| 307 | 3300025914 | Ga0207671_10350166 | Ga0207671_103501661 | 200 |
| 308 | 3300025916 | Ga0207663_10631217 | Ga0207663_106312171 | 200 |
| 309 | 3300025917 | Ga0207660_10058257 | Ga0207660_100582572 | 200 |
| 310 | 3300025917 | Ga0207660_10562267 | Ga0207660_105622672 | 200 |
| 311 | 3300025918 | Ga0207662_10015568 | Ga0207662_100155683 | 200 |
| 312 | 3300025919 | Ga0207657_10000148 | Ga0207657_1000014857 | 200 |
| 313 | 3300025919 | Ga0207657_10040493 | Ga0207657_100404934 | 200 |
| 314 | 3300025919 | Ga0207657_10057663 | Ga0207657_100576632 | 200 |
| 315 | 3300025920 | Ga0207649_10013644 | Ga0207649_100136443 | 200 |
| 316 | 3300025920 | Ga0207649_10095082 | Ga0207649_100950823 | 200 |
| 317 | 3300025920 | Ga0207649_10225853 | Ga0207649_102258532 | 200 |
| 318 | 3300025920 | Ga0207649_10308233 | Ga0207649_103082332 | 200 |
| 319 | 3300025921 | Ga0207652_10049993 | Ga0207652_100499933 | 200 |
| 320 | 3300025921 | Ga0207652_10297455 | Ga0207652_102974552 | 200 |
| 321 | 3300025921 | Ga0207652_10944417 | Ga0207652_109444171 | 200 |
| 322 | 3300025923 | Ga0207681_10195425 | Ga0207681_101954252 | 200 |
| 323 | 3300025924 | Ga0207694_10034794 | Ga0207694_100347943 | 200 |
| 324 | 3300025924 | Ga0207694_10172309 | Ga0207694_101723092 | 200 |
| 325 | 3300025925 | Ga0207650_10005466 | Ga0207650_100054663 | 200 |
| 326 | 3300025925 | Ga0207650_10125055 | Ga0207650_101250552 | 200 |
| 327 | 3300025926 | Ga0207659_10010014 | Ga0207659_100100146 | 200 |
| 328 | 3300025929 | Ga0207664_10077783 | Ga0207664_100777833 | 200 |
| 329 | 3300025929 | Ga0207664_10093532 | Ga0207664_100935322 | 200 |
| 330 | 3300025931 | Ga0207644_10066958 | Ga0207644_100669583 | 200 |
| 331 | 3300025931 | Ga0207644_10337278 | Ga0207644_103372782 | 200 |
| 332 | 3300025931 | Ga0207644_10561703 | Ga0207644_105617031 | 200 |
| 333 | 3300025932 | Ga0207690_10065525 | Ga0207690_100655251 | 200 |
| 334 | 3300025932 | Ga0207690_10131881 | Ga0207690_101318812 | 200 |
| 335 | 3300025932 | Ga0207690_10139516 | Ga0207690_101395162 | 200 |
| 336 | 3300025932 | Ga0207690_10142205 | Ga0207690_101422051 | 200 |
| 337 | 3300025932 | Ga0207690_10239018 | Ga0207690_102390182 | 200 |
| 338 | 3300025933 | Ga0207706_10065640 | Ga0207706_100656403 | 200 |
| 339 | 3300025935 | Ga0207709_10000004 | Ga0207709_10000004313 | 200 |
| 340 | 3300025936 | Ga0207670_10047310 | Ga0207670_100473102 | 200 |
| 341 | 3300025936 | Ga0207670_11136065 | Ga0207670_111360651 | 200 |
| 342 | 3300025937 | Ga0207669_10002243 | Ga0207669_100022438 | 200 |
| 343 | 3300025938 | Ga0207704_10308472 | Ga0207704_103084722 | 200 |
| 344 | 3300025938 | Ga0207704_10613198 | Ga0207704_106131981 | 200 |
| 345 | 3300025940 | Ga0207691_10039202 | Ga0207691_100392023 | 200 |
| 346 | 3300025941 | Ga0207711_10038962 | Ga0207711_100389623 | 200 |
| 347 | 3300025942 | Ga0207689_10004738 | Ga0207689_100047382 | 200 |
| 348 | 3300025944 | Ga0207661_10061603 | Ga0207661_100616033 | 200 |
| 349 | 3300025944 | Ga0207661_10118076 | Ga0207661_101180763 | 200 |
| 350 | 3300025944 | Ga0207661_10158633 | Ga0207661_101586332 | 200 |
| 351 | 3300025945 | Ga0207679_10030925 | Ga0207679_100309253 | 200 |
| 352 | 3300025945 | Ga0207679_10077167 | Ga0207679_100771672 | 200 |
| 353 | 3300025945 | Ga0207679_10332491 | Ga0207679_103324912 | 200 |
| 354 | 3300025945 | Ga0207679_10364131 | Ga0207679_103641312 | 200 |
| 355 | 3300025949 | Ga0207667_10002522 | Ga0207667_1000252219 | 200 |
| 356 | 3300025949 | Ga0207667_10038232 | Ga0207667_100382322 | 200 |
| 357 | 3300025949 | Ga0207667_11217075 | Ga0207667_112170751 | 200 |
| 358 | 3300025960 | Ga0207651_10133517 | Ga0207651_101335172 | 200 |
| 359 | 3300025960 | Ga0207651_11095671 | Ga0207651_110956711 | 200 |
| 360 | 3300025961 | Ga0207712_10111953 | Ga0207712_101119532 | 200 |
| 361 | 3300025972 | Ga0207668_10113583 | Ga0207668_101135832 | 200 |
| 362 | 3300025972 | Ga0207668_10930833 | Ga0207668_109308331 | 200 |
| 363 | 3300025981 | Ga0207640_10042529 | Ga0207640_100425294 | 200 |
| 364 | 3300025981 | Ga0207640_10055621 | Ga0207640_100556212 | 200 |
| 365 | 3300025981 | Ga0207640_10104025 | Ga0207640_101040253 | 200 |
| 366 | 3300025986 | Ga0207658_10240601 | Ga0207658_102406012 | 200 |
| 367 | 3300025986 | Ga0207658_10432680 | Ga0207658_104326801 | 200 |
| 368 | 3300025986 | Ga0207658_10903931 | Ga0207658_109039312 | 200 |
| 369 | 3300025986 | Ga0207658_10920117 | Ga0207658_109201171 | 200 |
| 370 | 3300026023 | Ga0207677_10728089 | Ga0207677_107280891 | 200 |
| 371 | 3300026035 | Ga0207703_10007765 | Ga0207703_100077658 | 200 |
| 372 | 3300026035 | Ga0207703_10160539 | Ga0207703_101605393 | 200 |
| 373 | 3300026035 | Ga0207703_10791642 | Ga0207703_107916421 | 200 |
| 374 | 3300026041 | Ga0207639_10128041 | Ga0207639_101280412 | 200 |
| 375 | 3300026041 | Ga0207639_10128749 | Ga0207639_101287491 | 200 |
| 376 | 3300026067 | Ga0207678_10000214 | Ga0207678_1000021426 | 200 |
| 377 | 3300026067 | Ga0207678_10000936 | Ga0207678_1000093611 | 200 |
| 378 | 3300026067 | Ga0207678_10302560 | Ga0207678_103025602 | 200 |
| 379 | 3300026075 | Ga0207708_10016844 | Ga0207708_100168443 | 200 |
| 380 | 3300026075 | Ga0207708_10068289 | Ga0207708_100682892 | 200 |
| 381 | 3300026078 | Ga0207702_10027810 | Ga0207702_100278104 | 200 |
| 382 | 3300026078 | Ga0207702_10069608 | Ga0207702_100696083 | 200 |
| 383 | 3300026078 | Ga0207702_10306814 | Ga0207702_103068142 | 200 |
| 384 | 3300026078 | Ga0207702_10373329 | Ga0207702_103733292 | 200 |
| 385 | 3300026088 | Ga0207641_10090080 | Ga0207641_100900801 | 200 |
| 386 | 3300026088 | Ga0207641_10554957 | Ga0207641_105549572 | 200 |
| 387 | 3300026089 | Ga0207648_10016512 | Ga0207648_100165125 | 200 |
| 388 | 3300026089 | Ga0207648_10124977 | Ga0207648_101249773 | 200 |
| 389 | 3300026116 | Ga0207674_10000312 | Ga0207674_1000031214 | 200 |
| 390 | 3300026116 | Ga0207674_10001327 | Ga0207674_1000132713 | 200 |
| 391 | 3300026116 | Ga0207674_11416016 | Ga0207674_114160161 | 200 |
| 392 | 3300026118 | Ga0207675_100000240 | Ga0207675_1000002403 | 200 |
| 393 | 3300026121 | Ga0207683_10001464 | Ga0207683_100014647 | 200 |
| 394 | 3300026121 | Ga0207683_10015062 | Ga0207683_100150625 | 200 |
| 395 | 3300026142 | Ga0207698_10000387 | Ga0207698_1000038725 | 200 |
| 396 | 3300026142 | Ga0207698_10072876 | Ga0207698_100728762 | 200 |
| 397 | 3300026142 | Ga0207698_10081199 | Ga0207698_100811993 | 200 |
| 398 | 3300026142 | Ga0207698_10201098 | Ga0207698_102010982 | 200 |
| 399 | 3300027111 | Ga0209281_1000039 | Ga0209281_1000039301 | 200 |
| 400 | 3300028379 | Ga0268266_10058800 | Ga0268266_100588001 | 200 |
| 401 | 3300028379 | Ga0268266_10076058 | Ga0268266_100760583 | 200 |
| 402 | 3300028379 | Ga0268266_10336193 | Ga0268266_103361932 | 200 |
| 403 | 3300028380 | Ga0268265_10520293 | Ga0268265_105202932 | 200 |
| 404 | 3300028786 | Ga0307517_10004553 | Ga0307517_1000455318 | 200 |
| 405 | 3300028786 | Ga0307517_10157925 | Ga0307517_101579252 | 200 |
| 406 | 3300030522 | Ga0307512_10214989 | Ga0307512_102149891 | 200 |
| 407 | 3300031507 | Ga0307509_10128491 | Ga0307509_101284912 | 200 |
| 408 | 3300035114 | Ga0373939_0074926 | Ga0373939_0074926_49_714 | 200 |
| 409 | 3300035116 | Ga0373945_0016787 | Ga0373945_0016787_1442_2056 | 200 |
| 410 | 3300035116 | Ga0373945_0061544 | Ga0373945_0061544_440_1042 | 200 |
| 411 | 3300035120 | Ga0373957_0053024 | Ga0373957_0053024_474_1088 | 200 |
| 412 | 3300035692 | Ga0373935_0168619 | Ga0373935_0168619_767_1369 | 200 |
| 413 | 3300035692 | Ga0373935_0197946 | Ga0373935_0197946_137_751 | 200 |
| 414 | 3300035695 | Ga0373927_0010570 | Ga0373927_0010570_263_877 | 200 |
| 415 | 3300035725 | Ga0373947_0103574 | Ga0373947_0103574_25_639 | 200 |
| 416 | 3300036401 | Ga0373937_0062385 | Ga0373937_0062385_1497_2099 | 200 |
| 417 | 3300036401 | Ga0373937_0161929 | Ga0373937_0161929_487_1101 | 200 |
| 418 | 3300036401 | Ga0373937_0313924 | Ga0373937_0313924_95_709 | 200 |
| 419 | 3300037068 | Ga0373925_0194032 | Ga0373925_0194032_656_1258 | 200 |
| 420 | 3300037068 | Ga0373925_0251460 | Ga0373925_0251460_717_1319 | 200 |
| 421 | 3300037418 | Ga0395900_0229589 | Ga0395900_0229589_1227_1832 | 200 |
| 422 | 3300037471 | Ga0395905_0228029 | Ga0395905_0228029_38_643 | 200 |
| 423 | 3300038443 | Ga0395901_0364597 | Ga0395901_0364597_226_828 | 200 |
| 424 | 3300038705 | Ga0237819_00427 | Ga0237819_00427_3447_4058 | 200 |
| 425 | 3300044693 | Ga0466961_0261373 | Ga0466961_0261373_92_733 | 200 |
| 426 | 3300045049 | Ga0466959_0172704 | Ga0466959_0172704_652_1323 | 200 |
| 427 | 3300046454 | Ga0495592_0028815 | Ga0495592_0028815_151_768 | 200 |
| 428 | 3300046459 | Ga0495629_0255188 | Ga0495629_0255188_359_970 | 200 |
| 429 | 3300046462 | Ga0495651_0003178 | Ga0495651_0003178_7812_8429 | 200 |
| 430 | 3300046462 | Ga0495651_0087041 | Ga0495651_0087041_351_968 | 200 |
| 431 | 3300046462 | Ga0495651_0122783 | Ga0495651_0122783_352_969 | 200 |
| 432 | 3300046463 | Ga0495653_0001379 | Ga0495653_0001379_11492_12109 | 200 |
| 433 | 3300046472 | Ga0495580_0280443 | Ga0495580_0280443_447_1049 | 200 |
| 434 | 3300046499 | Ga0495594_0243144 | Ga0495594_0243144_290_913 | 200 |
| 435 | 3300046511 | Ga0495608_0015364 | Ga0495608_0015364_132_749 | 200 |
| 436 | 3300046514 | Ga0495618_0107453 | Ga0495618_0107453_70_687 | 200 |
| 437 | 3300046516 | Ga0495628_0000835 | Ga0495628_0000835_230_847 | 200 |
| 438 | 3300046516 | Ga0495628_0106315 | Ga0495628_0106315_100_717 | 200 |
| 439 | 3300046524 | Ga0495648_0241049 | Ga0495648_0241049_186_788 | 200 |
| 440 | 3300046529 | Ga0495652_0007889 | Ga0495652_0007889_4731_5348 | 200 |
| 441 | 3300046529 | Ga0495652_0243190 | Ga0495652_0243190_168_785 | 200 |
| 442 | 3300046537 | Ga0495598_0047173 | Ga0495598_0047173_111_725 | 200 |
| 443 | 3300046539 | Ga0495621_0007222 | Ga0495621_0007222_2435_3037 | 200 |
| 444 | 3300046660 | Ga0495625_0078461 | Ga0495625_0078461_1096_1707 | 200 |
| 445 | 3300046663 | Ga0495635_0116222 | Ga0495635_0116222_42_659 | 200 |
| 446 | 3300046679 | Ga0495623_0110417 | Ga0495623_0110417_841_1458 | 200 |
| 447 | 3300046680 | Ga0495646_0102786 | Ga0495646_0102786_224_841 | 200 |
| 448 | 3300046689 | Ga0495613_0250151 | Ga0495613_0250151_15_626 | 200 |
| 449 | 3300046809 | Ga0495600_0008733 | Ga0495600_0008733_168_785 | 200 |
| 450 | 3300047317 | Ga0495604_0015311 | Ga0495604_0015311_5418_6035 | 200 |
| 451 | 3300047321 | Ga0495676_0038136 | Ga0495676_0038136_1990_2601 | 200 |
| 452 | 3300047443 | Ga0495687_049396 | Ga0495687_049396_61_699 | 200 |
| 453 | 3300047469 | Ga0495673_0176363 | Ga0495673_0176363_90_692 | 200 |
| 454 | 3300048088 | Ga0495602_0165513 | Ga0495602_0165513_168_785 | 200 |
| 455 | 3300048088 | Ga0495602_0366389 | Ga0495602_0366389_11_628 | 200 |
| 456 | 3300048903 | Ga0496100_0053750 | Ga0496100_0053750_13_615 | 200 |
| 457 | 3300048904 | Ga0496101_0046391 | Ga0496101_0046391_2051_2653 | 200 |
| 458 | 3300048905 | Ga0496102_0326542 | Ga0496102_0326542_184_786 | 200 |
| 459 | 3300048906 | Ga0496103_0135465 | Ga0496103_0135465_175_777 | 200 |
| 460 | 3300048907 | Ga0496104_0009523 | Ga0496104_0009523_5877_6479 | 200 |
| 461 | 3300048908 | Ga0496105_0039566 | Ga0496105_0039566_2226_2828 | 200 |
| 462 | 3300048909 | Ga0496106_0010089 | Ga0496106_0010089_2147_2749 | 200 |
| 463 | 3300048910 | Ga0496107_0174958 | Ga0496107_0174958_123_725 | 200 |
| 464 | 3300048911 | Ga0496108_0033008 | Ga0496108_0033008_1346_1948 | 200 |
| 465 | 3300048912 | Ga0496109_0023114 | Ga0496109_0023114_1583_2185 | 200 |
| 466 | 3300048914 | Ga0496111_0143554 | Ga0496111_0143554_937_1539 | 200 |
| 467 | 3300048917 | Ga0496114_0009447 | Ga0496114_0009447_2743_3345 | 200 |
| 468 | 3300048917 | Ga0496114_0030958 | Ga0496114_0030958_1332_1934 | 200 |
| 469 | 3300048918 | Ga0496115_0306108 | Ga0496115_0306108_233_835 | 200 |
| 470 | 3300049128 | Ga0501308_038018 | Ga0501308_038018_56_658 | 200 |
| 471 | 3300049536 | Ga0501320_027345 | Ga0501320_027345_80_682 | 200 |
| 472 | 3300050507 | nmdc:mga05p37_171071_c1 | nmdc:mga05p37_171071_c1_666_1316 | 200 |
| 473 | 3300050512 | nmdc:mga0n895_1399622_c1 | nmdc:mga0n895_1399622_c1_43_645 | 200 |
| 474 | 3300053077 | Ga0495601_0002871 | Ga0495601_0002871_7795_8412 | 200 |
| 475 | 3300053077 | Ga0495601_0264635 | Ga0495601_0264635_274_891 | 200 |
| 476 | 3300053084 | Ga0495595_0145352 | Ga0495595_0145352_151_765 | 200 |
| 477 | 3300053098 | Ga0500650_0004587 | Ga0500650_0004587_3578_4189 | 200 |
| 478 | 3300053117 | Ga0500593_000624 | Ga0500593_000624_9168_9770 | 200 |
| 479 | 3300053119 | Ga0500595_002293 | Ga0500595_002293_8217_8834 | 200 |
| 480 | 3300053141 | Ga0500574_018796 | Ga0500574_018796_952_1569 | 200 |
| 481 | 3300053154 | Ga0500619_000493 | Ga0500619_000493_5538_6155 | 200 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2z98-assembly1.cif.gz_A-2 | the crystal structure of azor (azoreductase) from escherichia coli: oxidized azor in tetragonal crystals (the resolution has improved from 1.8 (1v4b) to 1.4 angstrom) | 0.9709 | 1 | 200 |
| 2z9b-assembly1.cif.gz_A-2 | the crystal structure of azor (azoreductase) from escherichia coli: reduced azor in tetragonal crystals | 0.9696 | 1 | 200 |
| 2z98-assembly1.cif.gz_A-2 | the crystal structure of azor (azoreductase) from escherichia coli: oxidized azor in tetragonal crystals (the resolution has improved from 1.8 (1v4b) to 1.4 angstrom) | 0.966 | 1 | 200 |
| 2z9b-assembly1.cif.gz_A-2 | the crystal structure of azor (azoreductase) from escherichia coli: reduced azor in tetragonal crystals | 0.9647 | 1 | 200 |
| 1t5b-assembly1.cif.gz_B | structural genomics, a protein from salmonella typhimurium similar to e. coli acyl carrier protein phosphodiesterase | 0.9622 | 2 | 200 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1tikA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain | 0.9557 | 2 | 199 | 3.40.50.360 |
| 4c0wA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain | 0.9555 | 1 | 195 | 3.40.50.360 |
| 1tikA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain | 0.9327 | 2 | 199 | 3.40.50.360 |
| 4c0wA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain | 0.9278 | 1 | 195 | 3.40.50.360 |
| 6dxpB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain | 0.9198 | 2 | 198 | 3.40.50.360 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A519ZS40-F1-model_v4 | FMN dependent NADH:quinone oxidoreductase (EC 1.6.5.-) (Azo-dye reductase) (FMN-dependent NADH-azo compound oxidoreductase) (FMN-dependent NADH-azoreductase) (EC 1.7.1.17) | 0.9976 | 1 | 198 |
GO:0009055
GO:0010181 GO:0016652 GO:0016655 |
| AF-A0A2N2SJD0-F1-model_v4 | FMN-dependent NADH-azoreductase (EC 1.7.1.17) | 0.9961 | 1 | 168 |
GO:0010181
GO:0016655 |
| AF-A0A239LNP3-F1-model_v4 | FMN dependent NADH:quinone oxidoreductase (EC 1.6.5.-) (Azo-dye reductase) (FMN-dependent NADH-azo compound oxidoreductase) (FMN-dependent NADH-azoreductase) (EC 1.7.1.17) | 0.9957 | 1 | 200 |
GO:0009055
GO:0010181 GO:0016652 GO:0016655 |
| AF-A0A845BPX1-F1-model_v4 | FMN-dependent NADH-azoreductase | 0.9915 | 1 | 138 |
|
| AF-A0A239LNP3-F1-model_v4 | FMN dependent NADH:quinone oxidoreductase (EC 1.6.5.-) (Azo-dye reductase) (FMN-dependent NADH-azo compound oxidoreductase) (FMN-dependent NADH-azoreductase) (EC 1.7.1.17) | 0.9908 | 1 | 200 |
GO:0009055
GO:0010181 GO:0016652 GO:0016655 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar