F452525

General Info

Members Datasets Scaffolds Average Seq Length
481 294 472 203

Family's Representative Sequence

Representative Sequence 3300053090|Ga0500646_0000786|Ga0500646_0000786_7053_7775
Length 240
Sequence MGAGELFHESNNHIRSGVFRTTVRSNTFPALHQQTDFRRNIVNILQINSSARADGSQSTLLANDISARLSAANPGAKLTVRDFASTPHPALDEATLQALFTPAGQHTPEQAARVALDDALIAELQAADAVVLGVPMYNFAISTQLKNWIDAVCRVRVTFRYTEKGPEGLLKGKKVYVALARGGIYRDGPADSQVPYLKTVLGFLGMTDVQFFYAEGLSISPENAQKALAQARSEIETALA

Samples

Sample ID Description Type Environment
1 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
2 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
3 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
4 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
5 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
6 2818991436 Collimonas arenae 515 Isolate Unclassified
7 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
8 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
9 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
10 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
11 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
12 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
13 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
14 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
15 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
16 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
17 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
18 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
19 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
20 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
21 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
22 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
23 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
24 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
25 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
26 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
27 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
28 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
29 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
30 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
31 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
32 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
33 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
34 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
35 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
36 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
37 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
38 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
39 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
40 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
41 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
42 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
43 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
44 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
45 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
46 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
47 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
48 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
49 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
50 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
51 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
52 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
53 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
54 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
55 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
56 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
57 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
58 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
59 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
60 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
61 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
62 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
63 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
64 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
65 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
66 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
67 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
68 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
69 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
70 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
71 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
72 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
73 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
74 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
75 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
76 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
77 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
78 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
79 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
80 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
81 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
82 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
83 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
84 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
85 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
86 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
87 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
88 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
89 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
90 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
91 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
92 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
93 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
94 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
95 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
96 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
97 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
98 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
99 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
100 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
101 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
102 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
103 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
104 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
105 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
106 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
107 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
108 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
109 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
110 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
111 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
112 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
113 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
114 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
115 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
116 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
117 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
118 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
119 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
120 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
121 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
122 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
123 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
124 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
125 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
126 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
127 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
128 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
133 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
134 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
136 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
137 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
138 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
140 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
202 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
205 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
206 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
207 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
208 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
209 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
210 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
211 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
212 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
213 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
214 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
215 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
216 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
217 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
218 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
219 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
220 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
221 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
222 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
223 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
224 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
225 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
226 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
227 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
228 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
229 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
230 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
231 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
232 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
233 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
234 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
235 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
236 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
237 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
238 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
239 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
240 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
241 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
242 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
243 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
244 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
245 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
246 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
247 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
248 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
249 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
250 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
251 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
252 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
253 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
254 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
255 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
256 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
257 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
258 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
259 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
260 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
261 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
262 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
263 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
264 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
265 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
266 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
267 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
268 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
269 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
270 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
271 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
272 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
273 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
274 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
275 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
276 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
277 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
278 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
279 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
280 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
281 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
282 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
283 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
284 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
285 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
286 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
287 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
288 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
289 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
290 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
291 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
292 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
293 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
294 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.71
Metatranscriptomes 0.42
Isolates 1.87

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.23
Nodule 0.42
Rhizoplane 3.74
Rhizosphere 82.95
Stem 0
Stem Tuber 0
Unclassified 1.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24752J21851_1012656 3300001976 Bacteria 1103
2 JGI24752J21851_1014174 3300001976 Bacteria 1040
3 JGI24746J21847_1017993 3300001977 Bacteria 1001
4 JGI24743J22301_10013231 3300001991 Bacteria 1510
5 JGI24751J29686_10026323 3300002459 Bacteria 1207
6 JGI25162J39368_1000001 3300002737 Bacteria 740113
7 JGI25165J46597_1000001 3300003214 Bacteria 1111887
8 Ga0055538_1000001 3300003751 Bacteria 1111887
9 Ga0055539_1000001 3300003752 Bacteria 1111887
10 Ga0055533_1000003 3300003756 Bacteria 1111887
11 Ga0055525_1000003 3300003759 Bacteria 962094
12 Ga0055524_1000204 3300003775 Bacteria 64269
13 Ga0055540_1000026 3300003792 Bacteria 189071
14 Ga0055540_1000042 3300003792 Bacteria 156410
15 Ga0055531_10016062 3300003794 Bacteria 3256
16 Ga0055541_1000001 3300003841 Bacteria 1111887
17 Ga0065714_10077050 3300005288 Bacteria 2727
18 Ga0065715_10144015 3300005293 Bacteria 1813
19 Ga0070658_10016023 3300005327 Bacteria 5996
20 Ga0070658_10040557 3300005327 Bacteria 3756
21 Ga0070658_10143152 3300005327 Bacteria 1998
22 Ga0070658_10155173 3300005327 Bacteria 1919
23 Ga0070658_10202552 3300005327 Bacteria 1675
24 Ga0070658_10846206 3300005327 Bacteria 795
25 Ga0070683_100070646 3300005329 Bacteria 3257
26 Ga0070683_100072736 3300005329 Bacteria 3210
27 Ga0070683_100087359 3300005329 Bacteria 2924
28 Ga0070690_100427546 3300005330 Bacteria 978
29 Ga0070670_100054892 3300005331 Bacteria 3420
30 Ga0070670_100355990 3300005331 Bacteria 1286
31 Ga0070677_10047270 3300005333 Bacteria 1724
32 Ga0070677_10253920 3300005333 Bacteria 874
33 Ga0068869_100030153 3300005334 Bacteria 3805
34 Ga0068869_100088949 3300005334 Bacteria 2318
35 Ga0070666_10002655 3300005335 Bacteria 10784
36 Ga0070666_10030372 3300005335 Bacteria 3560
37 Ga0070680_100261742 3300005336 Bacteria 1463
38 Ga0068868_100047421 3300005338 Bacteria 3367
39 Ga0070660_100016897 3300005339 Bacteria 5309
40 Ga0070660_100037279 3300005339 Bacteria 3686
41 Ga0070660_100165594 3300005339 Bacteria 1783
42 Ga0070689_100040722 3300005340 Bacteria 3562
43 Ga0070689_100106678 3300005340 Bacteria 2223
44 Ga0070687_100005371 3300005343 Bacteria 5179
45 Ga0070661_100005014 3300005344 Bacteria 9121
46 Ga0070661_100024349 3300005344 Bacteria 4342
47 Ga0070661_100028042 3300005344 Bacteria 4059
48 Ga0070661_100087086 3300005344 Bacteria 2310
49 Ga0070661_100408038 3300005344 Bacteria 1075
50 Ga0070692_10034412 3300005345 Bacteria 2559
51 Ga0070668_100033744 3300005347 Bacteria 3899
52 Ga0070669_100210635 3300005353 Bacteria 1533
53 Ga0070669_100339172 3300005353 Bacteria 1217
54 Ga0070675_100085960 3300005354 Bacteria 2628
55 Ga0070675_100257053 3300005354 Bacteria 1530
56 Ga0070675_100462983 3300005354 Bacteria 1138
57 Ga0070671_100005440 3300005355 Bacteria 10166
58 Ga0070671_100093555 3300005355 Bacteria 2519
59 Ga0070671_100592758 3300005355 Bacteria 957
60 Ga0070673_100038126 3300005364 Bacteria 3668
61 Ga0070673_100424283 3300005364 Bacteria 1193
62 Ga0070673_100660221 3300005364 Bacteria 958
63 Ga0070688_100093029 3300005365 Bacteria 1973
64 Ga0070659_100003324 3300005366 Bacteria 11445
65 Ga0070659_100084341 3300005366 Bacteria 2541
66 Ga0070659_100242623 3300005366 Bacteria 1492
67 Ga0070659_100266525 3300005366 Bacteria 1422
68 Ga0070667_100009568 3300005367 Bacteria 8034
69 Ga0070667_100016725 3300005367 Bacteria 6071
70 Ga0070667_100874500 3300005367 Bacteria 836
71 Ga0070703_10099580 3300005406 Bacteria 1022
72 Ga0070709_10524820 3300005434 Bacteria 903
73 Ga0070714_100224951 3300005435 Bacteria 1726
74 Ga0070714_100238149 3300005435 Bacteria 1679
75 Ga0070713_100060993 3300005436 Bacteria 3155
76 Ga0070711_100208187 3300005439 Bacteria 1513
77 Ga0070694_100493070 3300005444 Bacteria 974
78 Ga0070708_100028894 3300005445 Bacteria 4775
79 Ga0070663_100055910 3300005455 Bacteria 2826
80 Ga0070663_100058347 3300005455 Bacteria 2771
81 Ga0070678_100042004 3300005456 Bacteria 3247
82 Ga0070678_100357844 3300005456 Bacteria 1257
83 Ga0070678_100610930 3300005456 Bacteria 974
84 Ga0070662_100865631 3300005457 Bacteria 770
85 Ga0068867_100014842 3300005459 Bacteria 5523
86 Ga0068867_100058852 3300005459 Bacteria 2847
87 Ga0068867_100132305 3300005459 Bacteria 1940
88 Ga0068867_100224410 3300005459 Bacteria 1516
89 Ga0070685_10095206 3300005466 Bacteria 1810
90 Ga0070706_100120937 3300005467 Bacteria 2441
91 Ga0070707_100008881 3300005468 Bacteria 9321
92 Ga0070698_100135569 3300005471 Bacteria 2416
93 Ga0070699_100302347 3300005518 Bacteria 1435
94 Ga0070679_100126652 3300005530 Bacteria 2536
95 Ga0070679_100302106 3300005530 Bacteria 1551
96 Ga0070679_101099066 3300005530 Bacteria 740
97 Ga0070684_100006408 3300005535 Bacteria 9104
98 Ga0068853_100050650 3300005539 Bacteria 3573
99 Ga0068853_100652779 3300005539 Bacteria 1001
100 Ga0070672_100055448 3300005543 Bacteria 3105
101 Ga0070672_100063630 3300005543 Bacteria 2913
102 Ga0070686_100003655 3300005544 Bacteria 8442
103 Ga0070686_100738902 3300005544 Bacteria 788
104 Ga0070695_100655418 3300005545 Bacteria 829
105 Ga0070665_100007975 3300005548 Bacteria 10731
106 Ga0070665_100044397 3300005548 Bacteria 4463
107 Ga0070665_100252413 3300005548 Bacteria 1764
108 Ga0070665_100529669 3300005548 Bacteria 1190
109 Ga0068855_100022858 3300005563 Bacteria 7494
110 Ga0068855_100025794 3300005563 Bacteria 7029
111 Ga0068855_100097539 3300005563 Bacteria 3386
112 Ga0070664_100239819 3300005564 Bacteria 1627
113 Ga0070664_100780944 3300005564 Bacteria 892
114 Ga0068857_100087707 3300005577 Bacteria 2783
115 Ga0068857_101456861 3300005577 Bacteria 667
116 Ga0068854_100006558 3300005578 Bacteria 7410
117 Ga0068854_100053820 3300005578 Bacteria 2892
118 Ga0068854_100100193 3300005578 Bacteria 2171
119 Ga0068856_100076010 3300005614 Bacteria 3327
120 Ga0068856_100358119 3300005614 Bacteria 1478
121 Ga0068856_100451087 3300005614 Bacteria 1307
122 Ga0070702_100147426 3300005615 Bacteria 1506
123 Ga0068852_100001878 3300005616 Bacteria 14297
124 Ga0068852_100067037 3300005616 Bacteria 3137
125 Ga0068852_100215729 3300005616 Bacteria 1823
126 Ga0068859_100028494 3300005617 Bacteria 5599
127 Ga0068859_100289329 3300005617 Bacteria 1731
128 Ga0068864_100006715 3300005618 Bacteria 9427
129 Ga0068864_100028485 3300005618 Bacteria 4722
130 Ga0068851_10002022 3300005834 Bacteria 8945
131 Ga0068851_10004293 3300005834 Bacteria 6419
132 Ga0068870_10243452 3300005840 Bacteria 1111
133 Ga0068863_100007463 3300005841 Bacteria 10703
134 Ga0068863_100115056 3300005841 Bacteria 2563
135 Ga0068863_100265460 3300005841 Bacteria 1660
136 Ga0068858_100005763 3300005842 Bacteria 12102
137 Ga0068858_100006723 3300005842 Bacteria 11190
138 Ga0068858_100097454 3300005842 Bacteria 2741
139 Ga0068858_100741713 3300005842 Bacteria 957
140 Ga0068860_100007369 3300005843 Bacteria 11000
141 Ga0068860_100078639 3300005843 Bacteria 3136
142 Ga0068860_101120425 3300005843 Bacteria 806
143 Ga0068862_100100611 3300005844 Bacteria 2528
144 Ga0068862_100241518 3300005844 Bacteria 1642
145 Ga0075365_10006101 3300006038 Bacteria 6588
146 Ga0075368_10010496 3300006042 Bacteria 3348
147 Ga0075363_100009281 3300006048 Bacteria 4620
148 Ga0075364_10079108 3300006051 Bacteria 2172
149 Ga0070712_100121732 3300006175 Bacteria 1964
150 Ga0075362_10370238 3300006177 Bacteria 719
151 Ga0075367_10039428 3300006178 Bacteria 2754
152 Ga0075369_10002108 3300006186 Bacteria 7029
153 Ga0097621_100001231 3300006237 Bacteria 17731
154 Ga0097621_100030668 3300006237 Bacteria 4259
155 Ga0097621_100164529 3300006237 Bacteria 1909
156 Ga0097621_100606167 3300006237 Bacteria 1001
157 Ga0075370_10052436 3300006353 Bacteria 2314
158 Ga0068871_100049763 3300006358 Bacteria 3388
159 Ga0068871_101203877 3300006358 Bacteria 710
160 Ga0075428_100333774 3300006844 Bacteria 1629
161 Ga0075433_10236302 3300006852 Bacteria 1622
162 Ga0075434_100117152 3300006871 Bacteria 2676
163 Ga0075434_100679906 3300006871 Bacteria 1047
164 Ga0097620_100028493 3300006931 Bacteria 5599
165 Ga0097620_100289316 3300006931 Bacteria 1731
166 Ga0079104_1000012 3300006946 Bacteria 355143
167 Ga0075435_100105799 3300007076 Bacteria 2336
168 Ga0105240_10049207 3300009093 Bacteria 5322
169 Ga0105240_10108588 3300009093 Bacteria 3362
170 Ga0111539_10023201 3300009094 Bacteria 7621
171 Ga0114129_10147537 3300009147 Bacteria 3221
172 Ga0105243_10000026 3300009148 Bacteria 191522
173 Ga0105243_10245497 3300009148 Bacteria 1595
174 Ga0105241_10950430 3300009174 Unclassified 801
175 Ga0105248_10349733 3300009177 Bacteria 1664
176 Ga0105248_10499323 3300009177 Bacteria 1372
177 Ga0105237_10012537 3300009545 Bacteria 8929
178 Ga0105237_10189495 3300009545 Bacteria 2057
179 Ga0105237_10659328 3300009545 Bacteria 1053
180 Ga0105238_10165641 3300009551 Bacteria 2186
181 Ga0105238_10180709 3300009551 Bacteria 2086
182 Ga0105249_10267644 3300009553 Bacteria 1701
183 Ga0105249_10283424 3300009553 Bacteria 1656
184 Ga0105239_10027940 3300010375 Bacteria 6207
185 Ga0105246_10000009 3300011119 Bacteria 79055
186 Ga0105246_11118787 3300011119 Bacteria 720
187 Ga0157371_10020162 3300013102 Bacteria 4907
188 Ga0157370_10268602 3300013104 Bacteria 1576
189 Ga0157369_10004002 3300013105 Bacteria 17483
190 Ga0157369_10065883 3300013105 Bacteria 3898
191 Ga0157369_10478663 3300013105 Bacteria 1289
192 Ga0157374_10078308 3300013296 Bacteria 3130
193 Ga0157374_10209630 3300013296 Bacteria 1910
194 Ga0157374_10350122 3300013296 Bacteria 1468
195 Ga0157372_10043081 3300013307 Bacteria 4996
196 Ga0157372_10085616 3300013307 Bacteria 3575
197 Ga0157372_10351789 3300013307 Bacteria 1716
198 Ga0157375_10161514 3300013308 Bacteria 2382
199 Ga0163163_10025578 3300014325 Bacteria 5627
200 Ga0163163_10677623 3300014325 Bacteria 1095
201 Ga0157380_10312290 3300014326 Bacteria 1453
202 Ga0157380_10540109 3300014326 Bacteria 1141
203 Ga0157377_10006645 3300014745 Bacteria 5528
204 Ga0157379_10004094 3300014968 Bacteria 12438
205 Ga0157379_10006148 3300014968 Bacteria 10336
206 Ga0157379_10014978 3300014968 Bacteria 6802
207 Ga0157379_10021303 3300014968 Bacteria 5736
208 Ga0157376_10008653 3300014969 Bacteria 7356
209 Ga0157376_10925065 3300014969 Bacteria 891
210 Ga0182006_1005754 3300015261 Bacteria 5849
211 Ga0182005_1000426 3300015265 Bacteria 22438
212 Ga0163161_10016555 3300017792 Bacteria 5148
213 Ga0163161_10043174 3300017792 Bacteria 3246
214 Ga0163161_10170800 3300017792 Bacteria 1662
215 Ga0209784_100004 3300025224 Bacteria 1378156
216 Ga0209566_100004 3300025225 Bacteria 1531866
217 Ga0209674_100006 3300025226 Bacteria 1531866
218 Ga0209563_100009 3300025230 Bacteria 1378156
219 Ga0207427_101002 3300025231 Bacteria 11854
220 Ga0209437_100004 3300025233 Bacteria 1378156
221 Ga0209677_100005 3300025253 Bacteria 1378156
222 Ga0209233_1000005 3300025261 Bacteria 1531866
223 Ga0209565_1015283 3300025263 Bacteria 1735
224 Ga0209675_1003824 3300025291 Bacteria 6942
225 Ga0209050_1001164 3300025298 Bacteria 31211
226 Ga0209050_1006021 3300025298 Bacteria 7347
227 Ga0209256_1000030 3300025299 Bacteria 414828
228 Ga0209051_1000004 3300025303 Bacteria 1155596
229 Ga0209257_1000063 3300025304 Bacteria 359089
230 Ga0207697_10000327 3300025315 Bacteria 26562
231 Ga0207697_10068153 3300025315 Bacteria 1488
232 Ga0207713_1008074 3300025735 Bacteria 6106
233 Ga0207682_10000401 3300025893 Bacteria 19968
234 Ga0207692_10169314 3300025898 Bacteria 1265
235 Ga0207642_10026405 3300025899 Bacteria 2364
236 Ga0207688_10001039 3300025901 Bacteria 14229
237 Ga0207680_10059029 3300025903 Bacteria 2328
238 Ga0207680_10074922 3300025903 Bacteria 2109
239 Ga0207680_10109779 3300025903 Bacteria 1787
240 Ga0207647_10301081 3300025904 Bacteria 913
241 Ga0207699_10219826 3300025906 Bacteria 1296
242 Ga0207699_10394096 3300025906 Bacteria 985
243 Ga0207645_10001404 3300025907 Bacteria 19722
244 Ga0207645_10005645 3300025907 Bacteria 9041
245 Ga0207645_10059653 3300025907 Bacteria 2437
246 Ga0207643_10001077 3300025908 Bacteria 16138
247 Ga0207643_10263960 3300025908 Bacteria 1064
248 Ga0207705_10088362 3300025909 Bacteria 2267
249 Ga0207705_10090492 3300025909 Bacteria 2240
250 Ga0207684_10178842 3300025910 Bacteria 1829
251 Ga0207684_10182198 3300025910 Bacteria 1811
252 Ga0207654_10167568 3300025911 Bacteria 1424
253 Ga0207707_10040947 3300025912 Bacteria 4045
254 Ga0207695_10039528 3300025913 Bacteria 5070
255 Ga0207695_10190589 3300025913 Bacteria 1968
256 Ga0207671_10350166 3300025914 Unclassified 1171
257 Ga0207663_10631217 3300025916 Bacteria 844
258 Ga0207660_10058257 3300025917 Bacteria 2769
259 Ga0207660_10562267 3300025917 Bacteria 928
260 Ga0207662_10015568 3300025918 Bacteria 4282
261 Ga0207657_10000148 3300025919 Bacteria 71376
262 Ga0207657_10040493 3300025919 Bacteria 4128
263 Ga0207657_10057663 3300025919 Bacteria 3346
264 Ga0207649_10013644 3300025920 Bacteria 4540
265 Ga0207649_10095082 3300025920 Bacteria 1960
266 Ga0207649_10225853 3300025920 Bacteria 1336
267 Ga0207649_10308233 3300025920 Bacteria 1160
268 Ga0207652_10049993 3300025921 Bacteria 3581
269 Ga0207652_10297455 3300025921 Bacteria 1457
270 Ga0207652_10944417 3300025921 Unclassified 760
271 Ga0207681_10012826 3300025923 Bacteria 5181
272 Ga0207681_10195425 3300025923 Bacteria 1550
273 Ga0207694_10034794 3300025924 Bacteria 3863
274 Ga0207694_10172309 3300025924 Bacteria 1753
275 Ga0207650_10005466 3300025925 Bacteria 8670
276 Ga0207650_10011303 3300025925 Bacteria 6143
277 Ga0207650_10125055 3300025925 Bacteria 2006
278 Ga0207659_10010014 3300025926 Bacteria 5937
279 Ga0207664_10077783 3300025929 Bacteria 2689
280 Ga0207664_10093532 3300025929 Bacteria 2469
281 Ga0207644_10066958 3300025931 Bacteria 2616
282 Ga0207644_10144641 3300025931 Bacteria 1834
283 Ga0207644_10337278 3300025931 Bacteria 1222
284 Ga0207644_10561703 3300025931 Bacteria 945
285 Ga0207690_10065525 3300025932 Bacteria 2485
286 Ga0207690_10131881 3300025932 Bacteria 1830
287 Ga0207690_10139516 3300025932 Bacteria 1784
288 Ga0207690_10142205 3300025932 Bacteria 1769
289 Ga0207690_10239018 3300025932 Bacteria 1398
290 Ga0207706_10065640 3300025933 Bacteria 3196
291 Ga0207709_10000004 3300025935 Bacteria 825156
292 Ga0207670_10047310 3300025936 Bacteria 2864
293 Ga0207670_11136065 3300025936 Bacteria 660
294 Ga0207669_10002243 3300025937 Bacteria 8217
295 Ga0207704_10308472 3300025938 Bacteria 1215
296 Ga0207704_10613198 3300025938 Bacteria 892
297 Ga0207691_10001645 3300025940 Bacteria 22169
298 Ga0207691_10039202 3300025940 Bacteria 4382
299 Ga0207711_10038962 3300025941 Bacteria 4041
300 Ga0207711_10199086 3300025941 Bacteria 1827
301 Ga0207689_10004738 3300025942 Bacteria 12265
302 Ga0207661_10061603 3300025944 Bacteria 3032
303 Ga0207661_10118076 3300025944 Bacteria 2254
304 Ga0207661_10158633 3300025944 Bacteria 1961
305 Ga0207679_10030925 3300025945 Bacteria 3743
306 Ga0207679_10077167 3300025945 Bacteria 2533
307 Ga0207679_10332491 3300025945 Bacteria 1319
308 Ga0207679_10364131 3300025945 Bacteria 1263
309 Ga0207667_10002522 3300025949 Bacteria 22797
310 Ga0207667_10038232 3300025949 Bacteria 5127
311 Ga0207667_11217075 3300025949 Bacteria 732
312 Ga0207651_10001670 3300025960 Bacteria 10194
313 Ga0207651_10133517 3300025960 Bacteria 1904
314 Ga0207651_11095671 3300025960 Bacteria 714
315 Ga0207712_10111953 3300025961 Bacteria 2049
316 Ga0207668_10002211 3300025972 Bacteria 11341
317 Ga0207668_10113583 3300025972 Bacteria 2037
318 Ga0207668_10930833 3300025972 Bacteria 774
319 Ga0207640_10042529 3300025981 Bacteria 2898
320 Ga0207640_10055621 3300025981 Bacteria 2593
321 Ga0207640_10104025 3300025981 Bacteria 1998
322 Ga0207658_10016322 3300025986 Bacteria 5107
323 Ga0207658_10240601 3300025986 Bacteria 1533
324 Ga0207658_10432680 3300025986 Bacteria 1162
325 Ga0207658_10903931 3300025986 Bacteria 804
326 Ga0207658_10920117 3300025986 Bacteria 796
327 Ga0207677_10728089 3300026023 Bacteria 882
328 Ga0207703_10007765 3300026035 Bacteria 8491
329 Ga0207703_10160539 3300026035 Bacteria 1968
330 Ga0207703_10791642 3300026035 Bacteria 905
331 Ga0207639_10128041 3300026041 Bacteria 2097
332 Ga0207639_10128749 3300026041 Bacteria 2092
333 Ga0207678_10000214 3300026067 Bacteria 51419
334 Ga0207678_10000936 3300026067 Bacteria 26595
335 Ga0207678_10302560 3300026067 Bacteria 1374
336 Ga0207708_10016844 3300026075 Bacteria 5502
337 Ga0207708_10068289 3300026075 Bacteria 2721
338 Ga0207702_10027810 3300026078 Bacteria 4698
339 Ga0207702_10069608 3300026078 Bacteria 3025
340 Ga0207702_10306814 3300026078 Bacteria 1508
341 Ga0207702_10373329 3300026078 Bacteria 1370
342 Ga0207641_10004511 3300026088 Bacteria 12038
343 Ga0207641_10090080 3300026088 Bacteria 2682
344 Ga0207641_10554957 3300026088 Bacteria 1120
345 Ga0207648_10000251 3300026089 Bacteria 58026
346 Ga0207648_10016512 3300026089 Bacteria 6742
347 Ga0207648_10124977 3300026089 Bacteria 2262
348 Ga0207676_10085638 3300026095 Bacteria 2572
349 Ga0207674_10000312 3300026116 Bacteria 61824
350 Ga0207674_10001327 3300026116 Bacteria 32088
351 Ga0207674_11416016 3300026116 Bacteria 664
352 Ga0207675_100000240 3300026118 Bacteria 52035
353 Ga0207683_10001464 3300026121 Bacteria 21278
354 Ga0207683_10015062 3300026121 Bacteria 6581
355 Ga0207683_10652936 3300026121 Bacteria 974
356 Ga0207698_10000387 3300026142 Bacteria 25394
357 Ga0207698_10072876 3300026142 Bacteria 2732
358 Ga0207698_10081199 3300026142 Bacteria 2616
359 Ga0207698_10201098 3300026142 Bacteria 1784
360 Ga0209281_1000039 3300027111 Bacteria 355150
361 Ga0268266_10058800 3300028379 Bacteria 3310
362 Ga0268266_10076058 3300028379 Bacteria 2917
363 Ga0268266_10336193 3300028379 Bacteria 1417
364 Ga0268265_10198532 3300028380 Bacteria 1738
365 Ga0268265_10520293 3300028380 Bacteria 1124
366 Ga0307517_10004553 3300028786 Bacteria 21271
367 Ga0307517_10157925 3300028786 Bacteria 1532
368 Ga0307511_10002108 3300030521 Bacteria 20827
369 Ga0307512_10214989 3300030522 Bacteria 1015
370 Ga0307509_10128491 3300031507 Bacteria 2495
371 Ga0373939_0074926 3300035114 Bacteria 1111
372 Ga0373945_0016787 3300035116 Bacteria 2474
373 Ga0373945_0061544 3300035116 Bacteria 1402
374 Ga0373957_0053024 3300035120 Bacteria 1555
375 Ga0373935_0168619 3300035692 Bacteria 1496
376 Ga0373935_0197946 3300035692 Bacteria 1387
377 Ga0373927_0010570 3300035695 Bacteria 6152
378 Ga0373947_0103574 3300035725 Bacteria 1791
379 Ga0373937_0062385 3300036401 Bacteria 3427
380 Ga0373937_0161929 3300036401 Bacteria 2098
381 Ga0373937_0313924 3300036401 Bacteria 1483
382 Ga0373925_0194032 3300037068 Bacteria 1612
383 Ga0373925_0251460 3300037068 Bacteria 1418
384 Ga0395900_0229589 3300037418 Bacteria 1867
385 Ga0395905_0228029 3300037471 Bacteria 1742
386 Ga0395901_0364597 3300038443 Bacteria 1489
387 Ga0237819_00427 3300038705 Bacteria 14476
388 Ga0451577_0000288 3300042876 Bacteria 97988
389 Ga0453683_0722176 3300044673 Bacteria 653
390 Ga0466961_0261373 3300044693 Bacteria 1061
391 Ga0453684_0001971 3300044712 Bacteria 52708
392 Ga0466959_0172704 3300045049 Bacteria 1515
393 Ga0495592_0028815 3300046454 Bacteria 4202
394 Ga0495590_0125658 3300046457 Bacteria 920
395 Ga0495629_0255188 3300046459 Bacteria 1206
396 Ga0495651_0003178 3300046462 Bacteria 12620
397 Ga0495651_0087041 3300046462 Bacteria 2349
398 Ga0495651_0122783 3300046462 Bacteria 1905
399 Ga0495653_0001379 3300046463 Bacteria 18872
400 Ga0495580_0280443 3300046472 Bacteria 1137
401 Ga0495639_0100557 3300046475 Bacteria 1365
402 Ga0495594_0243144 3300046499 Bacteria 1026
403 Ga0495608_0015364 3300046511 Bacteria 5310
404 Ga0495608_0542279 3300046511 Bacteria 701
405 Ga0495618_0107453 3300046514 Bacteria 1787
406 Ga0495628_0000835 3300046516 Bacteria 28571
407 Ga0495628_0106315 3300046516 Bacteria 2161
408 Ga0495648_0241049 3300046524 Bacteria 879
409 Ga0495642_0031355 3300046528 Bacteria 2131
410 Ga0495652_0007889 3300046529 Bacteria 9776
411 Ga0495652_0243190 3300046529 Bacteria 1337
412 Ga0495586_0079721 3300046535 Bacteria 1798
413 Ga0495598_0047173 3300046537 Bacteria 1283
414 Ga0495621_0007222 3300046539 Bacteria 3281
415 Ga0495625_0078461 3300046660 Bacteria 2305
416 Ga0495635_0116222 3300046663 Bacteria 1826
417 Ga0495623_0110417 3300046679 Bacteria 1667
418 Ga0495646_0102786 3300046680 Bacteria 1636
419 Ga0495613_0250151 3300046689 Bacteria 1237
420 Ga0495600_0008733 3300046809 Bacteria 6233
421 Ga0495660_0033876 3300046810 Bacteria 2861
422 Ga0495604_0015311 3300047317 Bacteria 6121
423 Ga0495636_0003615 3300047318 Bacteria 5997
424 Ga0495672_0000022 3300047320 Bacteria 420632
425 Ga0495676_0038136 3300047321 Bacteria 3994
426 Ga0495687_049396 3300047443 Bacteria 1798
427 Ga0495685_017197 3300047447 Bacteria 2475
428 Ga0495673_0176363 3300047469 Bacteria 812
429 Ga0495602_0165513 3300048088 Bacteria 1721
430 Ga0495602_0366389 3300048088 Bacteria 1036
431 Ga0496100_0053750 3300048903 Bacteria 2624
432 Ga0496101_0046391 3300048904 Bacteria 3116
433 Ga0496102_0326542 3300048905 Bacteria 1445
434 Ga0496103_0135465 3300048906 Bacteria 1574
435 Ga0496104_0009523 3300048907 Bacteria 8647
436 Ga0496105_0039566 3300048908 Bacteria 3887
437 Ga0496106_0010089 3300048909 Bacteria 6976
438 Ga0496107_0174958 3300048910 Bacteria 1593
439 Ga0496108_0033008 3300048911 Bacteria 4300
440 Ga0496109_0023114 3300048912 Bacteria 5515
441 Ga0496111_0143554 3300048914 Bacteria 1769
442 Ga0496114_0009447 3300048917 Bacteria 7742
443 Ga0496114_0030958 3300048917 Bacteria 4401
444 Ga0496114_0802381 3300048917 Bacteria 820
445 Ga0496115_0306108 3300048918 Bacteria 1302
446 Ga0501308_038018 3300049128 Bacteria 669
447 Ga0501320_027345 3300049536 Bacteria 693
448 nmdc:mga0yw44_13601_c1 3300050492 Bacteria 4290
449 nmdc:mga0yw44_537880_c1 3300050492 Bacteria 793
450 nmdc:mga0k408_293311_c1 3300050493 Bacteria 971
451 nmdc:mga07m45_2935_c1 3300050496 Bacteria 8096
452 nmdc:mga05p37_171071_c1 3300050507 Bacteria 2649
453 nmdc:mga0n895_1399622_c1 3300050512 Bacteria 668
454 nmdc:mga0sz30_306989_c1 3300050516 Bacteria 708
455 Ga0495601_0002871 3300053077 Bacteria 9800
456 Ga0495601_0264635 3300053077 Bacteria 1122
457 Ga0495595_0145352 3300053084 Bacteria 1165
458 Ga0500644_0112041 3300053088 Bacteria 1052
459 Ga0500646_0000786 3300053090 Bacteria 8853
460 Ga0500583_0055371 3300053092 Bacteria 1854
461 Ga0500650_0004587 3300053098 Bacteria 5017
462 Ga0500555_047096 3300053103 Bacteria 1187
463 Ga0500593_000624 3300053117 Bacteria 13611
464 Ga0500595_002293 3300053119 Bacteria 9600
465 Ga0500655_001002 3300053133 Bacteria 5456
466 Ga0500568_0026321 3300053139 Bacteria 2443
467 Ga0500574_018796 3300053141 Bacteria 1710
468 Ga0500604_0000537 3300053151 Bacteria 10439
469 Ga0500616_0234772 3300053153 Bacteria 792
470 Ga0500619_000493 3300053154 Bacteria 6893
471 Ga0500622_0182403 3300053156 Unclassified 969
472 Ga0500645_053977 3300053730 Bacteria 1169

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046457 Ga0495590_0125658 Ga0495590_0125658_29_529 164
2 3300046511 Ga0495608_0542279 Ga0495608_0542279_131_676 176
3 3300046528 Ga0495642_0031355 Ga0495642_0031355_546_1247 187
4 3300047318 Ga0495636_0003615 Ga0495636_0003615_1262_1963 187
5 3300047447 Ga0495685_017197 Ga0495685_017197_815_1516 187
6 3300044673 Ga0453683_0722176 Ga0453683_0722176_22_636 190
7 3300006844 Ga0075428_100333774 Ga0075428_1003337742 194
8 iso_pu_bacteria 2600255318 2601799630 196
9 iso_pu_bacteria 2603880185 2606078136 196
10 iso_pu_bacteria 2603880199 2606130244 196
11 iso_pu_bacteria 2623620443 2624480657 196
12 iso_pu_bacteria 2713897149 2715756616 196
13 iso_pu_bacteria 2818991436 2819540593 196
14 iso_pu_bacteria 2878029506 2878032532 196
15 iso_pu_bacteria 2919063839 2919065090 196
16 iso_pu_bacteria 3007718800 3007719169 196
17 3300005330 Ga0070690_100427546 Ga0070690_1004275461 199
18 3300005331 Ga0070670_100054892 Ga0070670_1000548923 199
19 3300005334 Ga0068869_100088949 Ga0068869_1000889492 199
20 3300005335 Ga0070666_10002655 Ga0070666_100026551 199
21 3300005338 Ga0068868_100047421 Ga0068868_1000474212 199
22 3300005347 Ga0070668_100033744 Ga0070668_1000337442 199
23 3300005354 Ga0070675_100462983 Ga0070675_1004629832 199
24 3300005355 Ga0070671_100005440 Ga0070671_1000054401 199
25 3300005364 Ga0070673_100038126 Ga0070673_1000381263 199
26 3300005367 Ga0070667_100016725 Ga0070667_1000167255 199
27 3300005456 Ga0070678_100610930 Ga0070678_1006109301 199
28 3300005459 Ga0068867_100014842 Ga0068867_1000148426 199
29 3300005548 Ga0070665_100007975 Ga0070665_1000079753 199
30 3300005617 Ga0068859_100289329 Ga0068859_1002893292 199
31 3300005618 Ga0068864_100006715 Ga0068864_1000067152 199
32 3300005841 Ga0068863_100007463 Ga0068863_1000074632 199
33 3300005842 Ga0068858_100006723 Ga0068858_1000067234 199
34 3300005843 Ga0068860_100007369 Ga0068860_1000073698 199
35 3300005844 Ga0068862_100100611 Ga0068862_1001006112 199
36 3300006038 Ga0075365_10006101 Ga0075365_1000610110 199
37 3300006042 Ga0075368_10010496 Ga0075368_100104963 199
38 3300006048 Ga0075363_100009281 Ga0075363_1000092816 199
39 3300006051 Ga0075364_10079108 Ga0075364_100791081 199
40 3300006178 Ga0075367_10039428 Ga0075367_100394282 199
41 3300006186 Ga0075369_10002108 Ga0075369_100021084 199
42 3300006237 Ga0097621_100001231 Ga0097621_1000012312 199
43 3300006353 Ga0075370_10052436 Ga0075370_100524364 199
44 3300006931 Ga0097620_100289316 Ga0097620_1002893161 199
45 3300009148 Ga0105243_10245497 Ga0105243_102454971 199
46 3300009177 Ga0105248_10349733 Ga0105248_103497332 199
47 3300009553 Ga0105249_10283424 Ga0105249_102834242 199
48 3300013296 Ga0157374_10209630 Ga0157374_102096302 199
49 3300014968 Ga0157379_10014978 Ga0157379_100149783 199
50 3300017792 Ga0163161_10043174 Ga0163161_100431742 199
51 3300025315 Ga0207697_10068153 Ga0207697_100681532 199
52 3300025903 Ga0207680_10059029 Ga0207680_100590291 199
53 3300025907 Ga0207645_10001404 Ga0207645_100014042 199
54 3300025908 Ga0207643_10263960 Ga0207643_102639602 199
55 3300025923 Ga0207681_10012826 Ga0207681_100128263 199
56 3300025925 Ga0207650_10011303 Ga0207650_100113035 199
57 3300025931 Ga0207644_10144641 Ga0207644_101446412 199
58 3300025940 Ga0207691_10001645 Ga0207691_100016459 199
59 3300025941 Ga0207711_10199086 Ga0207711_101990862 199
60 3300025960 Ga0207651_10001670 Ga0207651_100016708 199
61 3300025972 Ga0207668_10002211 Ga0207668_100022119 199
62 3300025986 Ga0207658_10016322 Ga0207658_100163225 199
63 3300026088 Ga0207641_10004511 Ga0207641_100045113 199
64 3300026089 Ga0207648_10000251 Ga0207648_100002519 199
65 3300026095 Ga0207676_10085638 Ga0207676_100856382 199
66 3300026121 Ga0207683_10652936 Ga0207683_106529362 199
67 3300028380 Ga0268265_10198532 Ga0268265_101985322 199
68 3300030521 Ga0307511_10002108 Ga0307511_1000210822 199
69 3300042876 Ga0451577_0000288 Ga0451577_0000288_37240_37839 199
70 3300044712 Ga0453684_0001971 Ga0453684_0001971_37241_37840 199
71 3300046475 Ga0495639_0100557 Ga0495639_0100557_64_675 199
72 3300046535 Ga0495586_0079721 Ga0495586_0079721_646_1257 199
73 3300046810 Ga0495660_0033876 Ga0495660_0033876_800_1399 199
74 3300047320 Ga0495672_0000022 Ga0495672_0000022_105641_106240 199
75 3300048917 Ga0496114_0802381 Ga0496114_0802381_126_755 199
76 3300050492 nmdc:mga0yw44_13601_c1 nmdc:mga0yw44_13601_c1_53_652 199
77 3300050492 nmdc:mga0yw44_537880_c1 nmdc:mga0yw44_537880_c1_184_783 199
78 3300050493 nmdc:mga0k408_293311_c1 nmdc:mga0k408_293311_c1_164_763 199
79 3300050496 nmdc:mga07m45_2935_c1 nmdc:mga07m45_2935_c1_941_1540 199
80 3300050516 nmdc:mga0sz30_306989_c1 nmdc:mga0sz30_306989_c1_97_696 199
81 3300053088 Ga0500644_0112041 Ga0500644_0112041_47_646 199
82 3300053090 Ga0500646_0000786 Ga0500646_0000786_7053_7775 199
83 3300053092 Ga0500583_0055371 Ga0500583_0055371_722_1321 199
84 3300053103 Ga0500555_047096 Ga0500555_047096_112_834 199
85 3300053133 Ga0500655_001002 Ga0500655_001002_857_1579 199
86 3300053139 Ga0500568_0026321 Ga0500568_0026321_1210_1932 199
87 3300053151 Ga0500604_0000537 Ga0500604_0000537_3789_4511 199
88 3300053153 Ga0500616_0234772 Ga0500616_0234772_62_661 199
89 3300053156 Ga0500622_0182403 Ga0500622_0182403_22_654 199
90 3300053730 Ga0500645_053977 Ga0500645_053977_184_906 199
91 3300001976 JGI24752J21851_1012656 JGI24752J21851_10126562 200
92 3300001976 JGI24752J21851_1014174 JGI24752J21851_10141742 200
93 3300001977 JGI24746J21847_1017993 JGI24746J21847_10179931 200
94 3300001991 JGI24743J22301_10013231 JGI24743J22301_100132312 200
95 3300002459 JGI24751J29686_10026323 JGI24751J29686_100263232 200
96 3300002737 JGI25162J39368_1000001 JGI25162J39368_1000001579 200
97 3300003214 JGI25165J46597_1000001 JGI25165J46597_1000001567 200
98 3300003751 Ga0055538_1000001 Ga0055538_1000001467 200
99 3300003752 Ga0055539_1000001 Ga0055539_1000001467 200
100 3300003756 Ga0055533_1000003 Ga0055533_1000003567 200
101 3300003759 Ga0055525_1000003 Ga0055525_1000003567 200
102 3300003775 Ga0055524_1000204 Ga0055524_100020434 200
103 3300003792 Ga0055540_1000026 Ga0055540_1000026118 200
104 3300003792 Ga0055540_1000042 Ga0055540_10000426 200
105 3300003794 Ga0055531_10016062 Ga0055531_100160623 200
106 3300003841 Ga0055541_1000001 Ga0055541_1000001567 200
107 3300005288 Ga0065714_10077050 Ga0065714_100770504 200
108 3300005293 Ga0065715_10144015 Ga0065715_101440152 200
109 3300005327 Ga0070658_10016023 Ga0070658_100160234 200
110 3300005327 Ga0070658_10040557 Ga0070658_100405572 200
111 3300005327 Ga0070658_10143152 Ga0070658_101431522 200
112 3300005327 Ga0070658_10155173 Ga0070658_101551732 200
113 3300005327 Ga0070658_10202552 Ga0070658_102025522 200
114 3300005327 Ga0070658_10846206 Ga0070658_108462061 200
115 3300005329 Ga0070683_100070646 Ga0070683_1000706461 200
116 3300005329 Ga0070683_100072736 Ga0070683_1000727363 200
117 3300005329 Ga0070683_100087359 Ga0070683_1000873592 200
118 3300005331 Ga0070670_100355990 Ga0070670_1003559901 200
119 3300005333 Ga0070677_10047270 Ga0070677_100472703 200
120 3300005333 Ga0070677_10253920 Ga0070677_102539201 200
121 3300005334 Ga0068869_100030153 Ga0068869_1000301533 200
122 3300005335 Ga0070666_10030372 Ga0070666_100303723 200
123 3300005336 Ga0070680_100261742 Ga0070680_1002617421 200
124 3300005339 Ga0070660_100016897 Ga0070660_1000168972 200
125 3300005339 Ga0070660_100037279 Ga0070660_1000372793 200
126 3300005339 Ga0070660_100165594 Ga0070660_1001655943 200
127 3300005340 Ga0070689_100040722 Ga0070689_1000407222 200
128 3300005340 Ga0070689_100106678 Ga0070689_1001066783 200
129 3300005343 Ga0070687_100005371 Ga0070687_1000053711 200
130 3300005344 Ga0070661_100005014 Ga0070661_1000050145 200
131 3300005344 Ga0070661_100024349 Ga0070661_1000243494 200
132 3300005344 Ga0070661_100028042 Ga0070661_1000280424 200
133 3300005344 Ga0070661_100087086 Ga0070661_1000870863 200
134 3300005344 Ga0070661_100408038 Ga0070661_1004080382 200
135 3300005345 Ga0070692_10034412 Ga0070692_100344122 200
136 3300005353 Ga0070669_100210635 Ga0070669_1002106352 200
137 3300005353 Ga0070669_100339172 Ga0070669_1003391722 200
138 3300005354 Ga0070675_100085960 Ga0070675_1000859601 200
139 3300005354 Ga0070675_100257053 Ga0070675_1002570532 200
140 3300005355 Ga0070671_100093555 Ga0070671_1000935552 200
141 3300005355 Ga0070671_100592758 Ga0070671_1005927581 200
142 3300005364 Ga0070673_100424283 Ga0070673_1004242832 200
143 3300005364 Ga0070673_100660221 Ga0070673_1006602211 200
144 3300005365 Ga0070688_100093029 Ga0070688_1000930292 200
145 3300005366 Ga0070659_100003324 Ga0070659_1000033247 200
146 3300005366 Ga0070659_100084341 Ga0070659_1000843413 200
147 3300005366 Ga0070659_100242623 Ga0070659_1002426231 200
148 3300005366 Ga0070659_100266525 Ga0070659_1002665252 200
149 3300005367 Ga0070667_100009568 Ga0070667_1000095687 200
150 3300005367 Ga0070667_100874500 Ga0070667_1008745002 200
151 3300005406 Ga0070703_10099580 Ga0070703_100995801 200
152 3300005434 Ga0070709_10524820 Ga0070709_105248201 200
153 3300005435 Ga0070714_100224951 Ga0070714_1002249511 200
154 3300005435 Ga0070714_100238149 Ga0070714_1002381492 200
155 3300005436 Ga0070713_100060993 Ga0070713_1000609933 200
156 3300005439 Ga0070711_100208187 Ga0070711_1002081872 200
157 3300005444 Ga0070694_100493070 Ga0070694_1004930702 200
158 3300005445 Ga0070708_100028894 Ga0070708_1000288943 200
159 3300005455 Ga0070663_100055910 Ga0070663_1000559104 200
160 3300005455 Ga0070663_100058347 Ga0070663_1000583472 200
161 3300005456 Ga0070678_100042004 Ga0070678_1000420043 200
162 3300005456 Ga0070678_100357844 Ga0070678_1003578442 200
163 3300005457 Ga0070662_100865631 Ga0070662_1008656311 200
164 3300005459 Ga0068867_100058852 Ga0068867_1000588522 200
165 3300005459 Ga0068867_100132305 Ga0068867_1001323052 200
166 3300005459 Ga0068867_100224410 Ga0068867_1002244102 200
167 3300005466 Ga0070685_10095206 Ga0070685_100952062 200
168 3300005467 Ga0070706_100120937 Ga0070706_1001209373 200
169 3300005468 Ga0070707_100008881 Ga0070707_10000888112 200
170 3300005471 Ga0070698_100135569 Ga0070698_1001355692 200
171 3300005518 Ga0070699_100302347 Ga0070699_1003023471 200
172 3300005530 Ga0070679_100126652 Ga0070679_1001266522 200
173 3300005530 Ga0070679_100302106 Ga0070679_1003021062 200
174 3300005530 Ga0070679_101099066 Ga0070679_1010990661 200
175 3300005535 Ga0070684_100006408 Ga0070684_1000064084 200
176 3300005539 Ga0068853_100050650 Ga0068853_1000506502 200
177 3300005539 Ga0068853_100652779 Ga0068853_1006527791 200
178 3300005543 Ga0070672_100055448 Ga0070672_1000554483 200
179 3300005543 Ga0070672_100063630 Ga0070672_1000636303 200
180 3300005544 Ga0070686_100003655 Ga0070686_1000036557 200
181 3300005544 Ga0070686_100738902 Ga0070686_1007389021 200
182 3300005545 Ga0070695_100655418 Ga0070695_1006554181 200
183 3300005548 Ga0070665_100044397 Ga0070665_1000443976 200
184 3300005548 Ga0070665_100252413 Ga0070665_1002524131 200
185 3300005548 Ga0070665_100529669 Ga0070665_1005296692 200
186 3300005563 Ga0068855_100022858 Ga0068855_1000228587 200
187 3300005563 Ga0068855_100025794 Ga0068855_1000257947 200
188 3300005563 Ga0068855_100097539 Ga0068855_1000975391 200
189 3300005564 Ga0070664_100239819 Ga0070664_1002398192 200
190 3300005564 Ga0070664_100780944 Ga0070664_1007809442 200
191 3300005577 Ga0068857_100087707 Ga0068857_1000877072 200
192 3300005577 Ga0068857_101456861 Ga0068857_1014568611 200
193 3300005578 Ga0068854_100006558 Ga0068854_1000065582 200
194 3300005578 Ga0068854_100053820 Ga0068854_1000538202 200
195 3300005578 Ga0068854_100100193 Ga0068854_1001001933 200
196 3300005614 Ga0068856_100076010 Ga0068856_1000760103 200
197 3300005614 Ga0068856_100358119 Ga0068856_1003581192 200
198 3300005614 Ga0068856_100451087 Ga0068856_1004510871 200
199 3300005615 Ga0070702_100147426 Ga0070702_1001474262 200
200 3300005616 Ga0068852_100001878 Ga0068852_1000018784 200
201 3300005616 Ga0068852_100067037 Ga0068852_1000670373 200
202 3300005616 Ga0068852_100215729 Ga0068852_1002157292 200
203 3300005617 Ga0068859_100028494 Ga0068859_1000284942 200
204 3300005618 Ga0068864_100028485 Ga0068864_1000284853 200
205 3300005834 Ga0068851_10002022 Ga0068851_100020226 200
206 3300005834 Ga0068851_10004293 Ga0068851_100042937 200
207 3300005840 Ga0068870_10243452 Ga0068870_102434522 200
208 3300005841 Ga0068863_100115056 Ga0068863_1001150563 200
209 3300005841 Ga0068863_100265460 Ga0068863_1002654602 200
210 3300005842 Ga0068858_100005763 Ga0068858_1000057639 200
211 3300005842 Ga0068858_100097454 Ga0068858_1000974542 200
212 3300005842 Ga0068858_100741713 Ga0068858_1007417132 200
213 3300005843 Ga0068860_100078639 Ga0068860_1000786392 200
214 3300005843 Ga0068860_101120425 Ga0068860_1011204252 200
215 3300005844 Ga0068862_100241518 Ga0068862_1002415182 200
216 3300006175 Ga0070712_100121732 Ga0070712_1001217322 200
217 3300006177 Ga0075362_10370238 Ga0075362_103702381 200
218 3300006237 Ga0097621_100030668 Ga0097621_1000306684 200
219 3300006237 Ga0097621_100164529 Ga0097621_1001645292 200
220 3300006237 Ga0097621_100606167 Ga0097621_1006061671 200
221 3300006358 Ga0068871_100049763 Ga0068871_1000497634 200
222 3300006358 Ga0068871_101203877 Ga0068871_1012038771 200
223 3300006852 Ga0075433_10236302 Ga0075433_102363022 200
224 3300006871 Ga0075434_100117152 Ga0075434_1001171523 200
225 3300006871 Ga0075434_100679906 Ga0075434_1006799061 200
226 3300006931 Ga0097620_100028493 Ga0097620_1000284932 200
227 3300006946 Ga0079104_1000012 Ga0079104_100001225 200
228 3300007076 Ga0075435_100105799 Ga0075435_1001057992 200
229 3300009093 Ga0105240_10049207 Ga0105240_100492074 200
230 3300009093 Ga0105240_10108588 Ga0105240_101085882 200
231 3300009094 Ga0111539_10023201 Ga0111539_100232019 200
232 3300009147 Ga0114129_10147537 Ga0114129_101475373 200
233 3300009148 Ga0105243_10000026 Ga0105243_10000026175 200
234 3300009174 Ga0105241_10950430 Ga0105241_109504301 200
235 3300009177 Ga0105248_10499323 Ga0105248_104993232 200
236 3300009545 Ga0105237_10012537 Ga0105237_100125374 200
237 3300009545 Ga0105237_10189495 Ga0105237_101894953 200
238 3300009545 Ga0105237_10659328 Ga0105237_106593282 200
239 3300009551 Ga0105238_10165641 Ga0105238_101656412 200
240 3300009551 Ga0105238_10180709 Ga0105238_101807092 200
241 3300009553 Ga0105249_10267644 Ga0105249_102676442 200
242 3300010375 Ga0105239_10027940 Ga0105239_100279405 200
243 3300011119 Ga0105246_10000009 Ga0105246_1000000953 200
244 3300011119 Ga0105246_11118787 Ga0105246_111187871 200
245 3300013102 Ga0157371_10020162 Ga0157371_100201625 200
246 3300013104 Ga0157370_10268602 Ga0157370_102686022 200
247 3300013105 Ga0157369_10004002 Ga0157369_1000400218 200
248 3300013105 Ga0157369_10065883 Ga0157369_100658832 200
249 3300013105 Ga0157369_10478663 Ga0157369_104786632 200
250 3300013296 Ga0157374_10078308 Ga0157374_100783083 200
251 3300013296 Ga0157374_10350122 Ga0157374_103501222 200
252 3300013307 Ga0157372_10043081 Ga0157372_100430815 200
253 3300013307 Ga0157372_10085616 Ga0157372_100856162 200
254 3300013307 Ga0157372_10351789 Ga0157372_103517892 200
255 3300013308 Ga0157375_10161514 Ga0157375_101615142 200
256 3300014325 Ga0163163_10025578 Ga0163163_100255784 200
257 3300014325 Ga0163163_10677623 Ga0163163_106776232 200
258 3300014326 Ga0157380_10312290 Ga0157380_103122902 200
259 3300014326 Ga0157380_10540109 Ga0157380_105401092 200
260 3300014745 Ga0157377_10006645 Ga0157377_100066453 200
261 3300014968 Ga0157379_10004094 Ga0157379_1000409413 200
262 3300014968 Ga0157379_10006148 Ga0157379_100061481 200
263 3300014968 Ga0157379_10021303 Ga0157379_100213035 200
264 3300014969 Ga0157376_10008653 Ga0157376_100086531 200
265 3300014969 Ga0157376_10925065 Ga0157376_109250652 200
266 3300015261 Ga0182006_1005754 Ga0182006_10057542 200
267 3300015265 Ga0182005_1000426 Ga0182005_100042620 200
268 3300017792 Ga0163161_10016555 Ga0163161_100165551 200
269 3300017792 Ga0163161_10170800 Ga0163161_101708002 200
270 3300025224 Ga0209784_100004 Ga0209784_100004562 200
271 3300025225 Ga0209566_100004 Ga0209566_100004719 200
272 3300025226 Ga0209674_100006 Ga0209674_100006719 200
273 3300025230 Ga0209563_100009 Ga0209563_100009562 200
274 3300025231 Ga0207427_101002 Ga0207427_1010027 200
275 3300025233 Ga0209437_100004 Ga0209437_100004562 200
276 3300025253 Ga0209677_100005 Ga0209677_100005562 200
277 3300025261 Ga0209233_1000005 Ga0209233_1000005719 200
278 3300025263 Ga0209565_1015283 Ga0209565_10152832 200
279 3300025291 Ga0209675_1003824 Ga0209675_10038245 200
280 3300025298 Ga0209050_1001164 Ga0209050_100116428 200
281 3300025298 Ga0209050_1006021 Ga0209050_10060215 200
282 3300025299 Ga0209256_1000030 Ga0209256_1000030177 200
283 3300025303 Ga0209051_1000004 Ga0209051_1000004597 200
284 3300025304 Ga0209257_1000063 Ga0209257_100006383 200
285 3300025315 Ga0207697_10000327 Ga0207697_1000032723 200
286 3300025735 Ga0207713_1008074 Ga0207713_10080744 200
287 3300025893 Ga0207682_10000401 Ga0207682_100004018 200
288 3300025898 Ga0207692_10169314 Ga0207692_101693142 200
289 3300025899 Ga0207642_10026405 Ga0207642_100264052 200
290 3300025901 Ga0207688_10001039 Ga0207688_1000103913 200
291 3300025903 Ga0207680_10074922 Ga0207680_100749222 200
292 3300025903 Ga0207680_10109779 Ga0207680_101097792 200
293 3300025904 Ga0207647_10301081 Ga0207647_103010812 200
294 3300025906 Ga0207699_10219826 Ga0207699_102198262 200
295 3300025906 Ga0207699_10394096 Ga0207699_103940961 200
296 3300025907 Ga0207645_10005645 Ga0207645_100056458 200
297 3300025907 Ga0207645_10059653 Ga0207645_100596531 200
298 3300025908 Ga0207643_10001077 Ga0207643_100010778 200
299 3300025909 Ga0207705_10088362 Ga0207705_100883623 200
300 3300025909 Ga0207705_10090492 Ga0207705_100904923 200
301 3300025910 Ga0207684_10178842 Ga0207684_101788422 200
302 3300025910 Ga0207684_10182198 Ga0207684_101821981 200
303 3300025911 Ga0207654_10167568 Ga0207654_101675682 200
304 3300025912 Ga0207707_10040947 Ga0207707_100409473 200
305 3300025913 Ga0207695_10039528 Ga0207695_100395284 200
306 3300025913 Ga0207695_10190589 Ga0207695_101905892 200
307 3300025914 Ga0207671_10350166 Ga0207671_103501661 200
308 3300025916 Ga0207663_10631217 Ga0207663_106312171 200
309 3300025917 Ga0207660_10058257 Ga0207660_100582572 200
310 3300025917 Ga0207660_10562267 Ga0207660_105622672 200
311 3300025918 Ga0207662_10015568 Ga0207662_100155683 200
312 3300025919 Ga0207657_10000148 Ga0207657_1000014857 200
313 3300025919 Ga0207657_10040493 Ga0207657_100404934 200
314 3300025919 Ga0207657_10057663 Ga0207657_100576632 200
315 3300025920 Ga0207649_10013644 Ga0207649_100136443 200
316 3300025920 Ga0207649_10095082 Ga0207649_100950823 200
317 3300025920 Ga0207649_10225853 Ga0207649_102258532 200
318 3300025920 Ga0207649_10308233 Ga0207649_103082332 200
319 3300025921 Ga0207652_10049993 Ga0207652_100499933 200
320 3300025921 Ga0207652_10297455 Ga0207652_102974552 200
321 3300025921 Ga0207652_10944417 Ga0207652_109444171 200
322 3300025923 Ga0207681_10195425 Ga0207681_101954252 200
323 3300025924 Ga0207694_10034794 Ga0207694_100347943 200
324 3300025924 Ga0207694_10172309 Ga0207694_101723092 200
325 3300025925 Ga0207650_10005466 Ga0207650_100054663 200
326 3300025925 Ga0207650_10125055 Ga0207650_101250552 200
327 3300025926 Ga0207659_10010014 Ga0207659_100100146 200
328 3300025929 Ga0207664_10077783 Ga0207664_100777833 200
329 3300025929 Ga0207664_10093532 Ga0207664_100935322 200
330 3300025931 Ga0207644_10066958 Ga0207644_100669583 200
331 3300025931 Ga0207644_10337278 Ga0207644_103372782 200
332 3300025931 Ga0207644_10561703 Ga0207644_105617031 200
333 3300025932 Ga0207690_10065525 Ga0207690_100655251 200
334 3300025932 Ga0207690_10131881 Ga0207690_101318812 200
335 3300025932 Ga0207690_10139516 Ga0207690_101395162 200
336 3300025932 Ga0207690_10142205 Ga0207690_101422051 200
337 3300025932 Ga0207690_10239018 Ga0207690_102390182 200
338 3300025933 Ga0207706_10065640 Ga0207706_100656403 200
339 3300025935 Ga0207709_10000004 Ga0207709_10000004313 200
340 3300025936 Ga0207670_10047310 Ga0207670_100473102 200
341 3300025936 Ga0207670_11136065 Ga0207670_111360651 200
342 3300025937 Ga0207669_10002243 Ga0207669_100022438 200
343 3300025938 Ga0207704_10308472 Ga0207704_103084722 200
344 3300025938 Ga0207704_10613198 Ga0207704_106131981 200
345 3300025940 Ga0207691_10039202 Ga0207691_100392023 200
346 3300025941 Ga0207711_10038962 Ga0207711_100389623 200
347 3300025942 Ga0207689_10004738 Ga0207689_100047382 200
348 3300025944 Ga0207661_10061603 Ga0207661_100616033 200
349 3300025944 Ga0207661_10118076 Ga0207661_101180763 200
350 3300025944 Ga0207661_10158633 Ga0207661_101586332 200
351 3300025945 Ga0207679_10030925 Ga0207679_100309253 200
352 3300025945 Ga0207679_10077167 Ga0207679_100771672 200
353 3300025945 Ga0207679_10332491 Ga0207679_103324912 200
354 3300025945 Ga0207679_10364131 Ga0207679_103641312 200
355 3300025949 Ga0207667_10002522 Ga0207667_1000252219 200
356 3300025949 Ga0207667_10038232 Ga0207667_100382322 200
357 3300025949 Ga0207667_11217075 Ga0207667_112170751 200
358 3300025960 Ga0207651_10133517 Ga0207651_101335172 200
359 3300025960 Ga0207651_11095671 Ga0207651_110956711 200
360 3300025961 Ga0207712_10111953 Ga0207712_101119532 200
361 3300025972 Ga0207668_10113583 Ga0207668_101135832 200
362 3300025972 Ga0207668_10930833 Ga0207668_109308331 200
363 3300025981 Ga0207640_10042529 Ga0207640_100425294 200
364 3300025981 Ga0207640_10055621 Ga0207640_100556212 200
365 3300025981 Ga0207640_10104025 Ga0207640_101040253 200
366 3300025986 Ga0207658_10240601 Ga0207658_102406012 200
367 3300025986 Ga0207658_10432680 Ga0207658_104326801 200
368 3300025986 Ga0207658_10903931 Ga0207658_109039312 200
369 3300025986 Ga0207658_10920117 Ga0207658_109201171 200
370 3300026023 Ga0207677_10728089 Ga0207677_107280891 200
371 3300026035 Ga0207703_10007765 Ga0207703_100077658 200
372 3300026035 Ga0207703_10160539 Ga0207703_101605393 200
373 3300026035 Ga0207703_10791642 Ga0207703_107916421 200
374 3300026041 Ga0207639_10128041 Ga0207639_101280412 200
375 3300026041 Ga0207639_10128749 Ga0207639_101287491 200
376 3300026067 Ga0207678_10000214 Ga0207678_1000021426 200
377 3300026067 Ga0207678_10000936 Ga0207678_1000093611 200
378 3300026067 Ga0207678_10302560 Ga0207678_103025602 200
379 3300026075 Ga0207708_10016844 Ga0207708_100168443 200
380 3300026075 Ga0207708_10068289 Ga0207708_100682892 200
381 3300026078 Ga0207702_10027810 Ga0207702_100278104 200
382 3300026078 Ga0207702_10069608 Ga0207702_100696083 200
383 3300026078 Ga0207702_10306814 Ga0207702_103068142 200
384 3300026078 Ga0207702_10373329 Ga0207702_103733292 200
385 3300026088 Ga0207641_10090080 Ga0207641_100900801 200
386 3300026088 Ga0207641_10554957 Ga0207641_105549572 200
387 3300026089 Ga0207648_10016512 Ga0207648_100165125 200
388 3300026089 Ga0207648_10124977 Ga0207648_101249773 200
389 3300026116 Ga0207674_10000312 Ga0207674_1000031214 200
390 3300026116 Ga0207674_10001327 Ga0207674_1000132713 200
391 3300026116 Ga0207674_11416016 Ga0207674_114160161 200
392 3300026118 Ga0207675_100000240 Ga0207675_1000002403 200
393 3300026121 Ga0207683_10001464 Ga0207683_100014647 200
394 3300026121 Ga0207683_10015062 Ga0207683_100150625 200
395 3300026142 Ga0207698_10000387 Ga0207698_1000038725 200
396 3300026142 Ga0207698_10072876 Ga0207698_100728762 200
397 3300026142 Ga0207698_10081199 Ga0207698_100811993 200
398 3300026142 Ga0207698_10201098 Ga0207698_102010982 200
399 3300027111 Ga0209281_1000039 Ga0209281_1000039301 200
400 3300028379 Ga0268266_10058800 Ga0268266_100588001 200
401 3300028379 Ga0268266_10076058 Ga0268266_100760583 200
402 3300028379 Ga0268266_10336193 Ga0268266_103361932 200
403 3300028380 Ga0268265_10520293 Ga0268265_105202932 200
404 3300028786 Ga0307517_10004553 Ga0307517_1000455318 200
405 3300028786 Ga0307517_10157925 Ga0307517_101579252 200
406 3300030522 Ga0307512_10214989 Ga0307512_102149891 200
407 3300031507 Ga0307509_10128491 Ga0307509_101284912 200
408 3300035114 Ga0373939_0074926 Ga0373939_0074926_49_714 200
409 3300035116 Ga0373945_0016787 Ga0373945_0016787_1442_2056 200
410 3300035116 Ga0373945_0061544 Ga0373945_0061544_440_1042 200
411 3300035120 Ga0373957_0053024 Ga0373957_0053024_474_1088 200
412 3300035692 Ga0373935_0168619 Ga0373935_0168619_767_1369 200
413 3300035692 Ga0373935_0197946 Ga0373935_0197946_137_751 200
414 3300035695 Ga0373927_0010570 Ga0373927_0010570_263_877 200
415 3300035725 Ga0373947_0103574 Ga0373947_0103574_25_639 200
416 3300036401 Ga0373937_0062385 Ga0373937_0062385_1497_2099 200
417 3300036401 Ga0373937_0161929 Ga0373937_0161929_487_1101 200
418 3300036401 Ga0373937_0313924 Ga0373937_0313924_95_709 200
419 3300037068 Ga0373925_0194032 Ga0373925_0194032_656_1258 200
420 3300037068 Ga0373925_0251460 Ga0373925_0251460_717_1319 200
421 3300037418 Ga0395900_0229589 Ga0395900_0229589_1227_1832 200
422 3300037471 Ga0395905_0228029 Ga0395905_0228029_38_643 200
423 3300038443 Ga0395901_0364597 Ga0395901_0364597_226_828 200
424 3300038705 Ga0237819_00427 Ga0237819_00427_3447_4058 200
425 3300044693 Ga0466961_0261373 Ga0466961_0261373_92_733 200
426 3300045049 Ga0466959_0172704 Ga0466959_0172704_652_1323 200
427 3300046454 Ga0495592_0028815 Ga0495592_0028815_151_768 200
428 3300046459 Ga0495629_0255188 Ga0495629_0255188_359_970 200
429 3300046462 Ga0495651_0003178 Ga0495651_0003178_7812_8429 200
430 3300046462 Ga0495651_0087041 Ga0495651_0087041_351_968 200
431 3300046462 Ga0495651_0122783 Ga0495651_0122783_352_969 200
432 3300046463 Ga0495653_0001379 Ga0495653_0001379_11492_12109 200
433 3300046472 Ga0495580_0280443 Ga0495580_0280443_447_1049 200
434 3300046499 Ga0495594_0243144 Ga0495594_0243144_290_913 200
435 3300046511 Ga0495608_0015364 Ga0495608_0015364_132_749 200
436 3300046514 Ga0495618_0107453 Ga0495618_0107453_70_687 200
437 3300046516 Ga0495628_0000835 Ga0495628_0000835_230_847 200
438 3300046516 Ga0495628_0106315 Ga0495628_0106315_100_717 200
439 3300046524 Ga0495648_0241049 Ga0495648_0241049_186_788 200
440 3300046529 Ga0495652_0007889 Ga0495652_0007889_4731_5348 200
441 3300046529 Ga0495652_0243190 Ga0495652_0243190_168_785 200
442 3300046537 Ga0495598_0047173 Ga0495598_0047173_111_725 200
443 3300046539 Ga0495621_0007222 Ga0495621_0007222_2435_3037 200
444 3300046660 Ga0495625_0078461 Ga0495625_0078461_1096_1707 200
445 3300046663 Ga0495635_0116222 Ga0495635_0116222_42_659 200
446 3300046679 Ga0495623_0110417 Ga0495623_0110417_841_1458 200
447 3300046680 Ga0495646_0102786 Ga0495646_0102786_224_841 200
448 3300046689 Ga0495613_0250151 Ga0495613_0250151_15_626 200
449 3300046809 Ga0495600_0008733 Ga0495600_0008733_168_785 200
450 3300047317 Ga0495604_0015311 Ga0495604_0015311_5418_6035 200
451 3300047321 Ga0495676_0038136 Ga0495676_0038136_1990_2601 200
452 3300047443 Ga0495687_049396 Ga0495687_049396_61_699 200
453 3300047469 Ga0495673_0176363 Ga0495673_0176363_90_692 200
454 3300048088 Ga0495602_0165513 Ga0495602_0165513_168_785 200
455 3300048088 Ga0495602_0366389 Ga0495602_0366389_11_628 200
456 3300048903 Ga0496100_0053750 Ga0496100_0053750_13_615 200
457 3300048904 Ga0496101_0046391 Ga0496101_0046391_2051_2653 200
458 3300048905 Ga0496102_0326542 Ga0496102_0326542_184_786 200
459 3300048906 Ga0496103_0135465 Ga0496103_0135465_175_777 200
460 3300048907 Ga0496104_0009523 Ga0496104_0009523_5877_6479 200
461 3300048908 Ga0496105_0039566 Ga0496105_0039566_2226_2828 200
462 3300048909 Ga0496106_0010089 Ga0496106_0010089_2147_2749 200
463 3300048910 Ga0496107_0174958 Ga0496107_0174958_123_725 200
464 3300048911 Ga0496108_0033008 Ga0496108_0033008_1346_1948 200
465 3300048912 Ga0496109_0023114 Ga0496109_0023114_1583_2185 200
466 3300048914 Ga0496111_0143554 Ga0496111_0143554_937_1539 200
467 3300048917 Ga0496114_0009447 Ga0496114_0009447_2743_3345 200
468 3300048917 Ga0496114_0030958 Ga0496114_0030958_1332_1934 200
469 3300048918 Ga0496115_0306108 Ga0496115_0306108_233_835 200
470 3300049128 Ga0501308_038018 Ga0501308_038018_56_658 200
471 3300049536 Ga0501320_027345 Ga0501320_027345_80_682 200
472 3300050507 nmdc:mga05p37_171071_c1 nmdc:mga05p37_171071_c1_666_1316 200
473 3300050512 nmdc:mga0n895_1399622_c1 nmdc:mga0n895_1399622_c1_43_645 200
474 3300053077 Ga0495601_0002871 Ga0495601_0002871_7795_8412 200
475 3300053077 Ga0495601_0264635 Ga0495601_0264635_274_891 200
476 3300053084 Ga0495595_0145352 Ga0495595_0145352_151_765 200
477 3300053098 Ga0500650_0004587 Ga0500650_0004587_3578_4189 200
478 3300053117 Ga0500593_000624 Ga0500593_000624_9168_9770 200
479 3300053119 Ga0500595_002293 Ga0500595_002293_8217_8834 200
480 3300053141 Ga0500574_018796 Ga0500574_018796_952_1569 200
481 3300053154 Ga0500619_000493 Ga0500619_000493_5538_6155 200

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02525

Flavodoxin_2

Flavodoxin-like fold

42

239

0.93

PF03358

FMN_red

NADPH-dependent FMN reductase

42

216

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
2z98-assembly1.cif.gz_A-2 the crystal structure of azor (azoreductase) from escherichia coli: oxidized azor in tetragonal crystals (the resolution has improved from 1.8 (1v4b) to 1.4 angstrom) 0.9709 1 200
2z9b-assembly1.cif.gz_A-2 the crystal structure of azor (azoreductase) from escherichia coli: reduced azor in tetragonal crystals 0.9696 1 200
2z98-assembly1.cif.gz_A-2 the crystal structure of azor (azoreductase) from escherichia coli: oxidized azor in tetragonal crystals (the resolution has improved from 1.8 (1v4b) to 1.4 angstrom) 0.966 1 200
2z9b-assembly1.cif.gz_A-2 the crystal structure of azor (azoreductase) from escherichia coli: reduced azor in tetragonal crystals 0.9647 1 200
1t5b-assembly1.cif.gz_B structural genomics, a protein from salmonella typhimurium similar to e. coli acyl carrier protein phosphodiesterase 0.9622 2 200
ID Description Score Start End Superfamily
1tikA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.9557 2 199 3.40.50.360
4c0wA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.9555 1 195 3.40.50.360
1tikA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.9327 2 199 3.40.50.360
4c0wA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.9278 1 195 3.40.50.360
6dxpB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.9198 2 198 3.40.50.360
ID Description Score Start End GO Terms
AF-A0A519ZS40-F1-model_v4 FMN dependent NADH:quinone oxidoreductase (EC 1.6.5.-) (Azo-dye reductase) (FMN-dependent NADH-azo compound oxidoreductase) (FMN-dependent NADH-azoreductase) (EC 1.7.1.17) 0.9976 1 198 GO:0009055
GO:0010181
GO:0016652
GO:0016655
AF-A0A2N2SJD0-F1-model_v4 FMN-dependent NADH-azoreductase (EC 1.7.1.17) 0.9961 1 168 GO:0010181
GO:0016655
AF-A0A239LNP3-F1-model_v4 FMN dependent NADH:quinone oxidoreductase (EC 1.6.5.-) (Azo-dye reductase) (FMN-dependent NADH-azo compound oxidoreductase) (FMN-dependent NADH-azoreductase) (EC 1.7.1.17) 0.9957 1 200 GO:0009055
GO:0010181
GO:0016652
GO:0016655
AF-A0A845BPX1-F1-model_v4 FMN-dependent NADH-azoreductase 0.9915 1 138
AF-A0A239LNP3-F1-model_v4 FMN dependent NADH:quinone oxidoreductase (EC 1.6.5.-) (Azo-dye reductase) (FMN-dependent NADH-azo compound oxidoreductase) (FMN-dependent NADH-azoreductase) (EC 1.7.1.17) 0.9908 1 200 GO:0009055
GO:0010181
GO:0016652
GO:0016655

Feature Viewer

pLDDT pTM Quality
96.91 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map