F452524

General Info

Members Datasets Scaffolds Average Seq Length
481 216 477 405

Family's Representative Sequence

Representative Sequence 3300053086|Ga0500578_0025149|Ga0500578_0025149_1149_2561
Length 463
Sequence MEKAAKTGKGQSAFAKACTRGRRTRVLKMGNYDPGFEKIIAKELSSRLTFVSSMSKTAVAVSFDNTENAFAYKSDKELKKAHFLFSSMGYQALVKMGTRLTPWAIKAGLPIKNLIRSTIFEQFVGGETLEETARVAAKLKQFNVQVILDYGVEGMEGEENFDHGTDEFIKVIEYAATQPNIPFMSVKVTGLARFTLLEKLDAAATTKSGFEGKVHTEVLTAGEKAEWQRVEQRIIRICETAAAKGIGVLIDAEESWIQDPVDALTMQMMEKFNRKRTVIYNTIQLYRHDRLQFLKDSFASAQQKGFILGAKLVRGAYMEKERKRAAAMNYPSPIQPNKKATDRDYNAALEFCVDYLEHIALIVASHNEFSNLYTTELLDKKGIPHNHPHVHFSQLYGMSDNITFNLAKNSFRVSKYLPFGPIKDVIPYLMRRAQENSSVSGQTGRELGLIKKEMERRKSGNEE

Samples

Sample ID Description Type Environment
1 2738541278 Niastella sp. CF465 Isolate Unclassified
2 2818991444 Filimonas endophytica 3197 Isolate Unclassified
3 2881955468 Edaphocola flava HME-24 Isolate Rhizosphere
4 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
5 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
10 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
12 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
13 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
26 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
83 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
84 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
98 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
99 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
145 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
146 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
147 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
148 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
149 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
150 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
151 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
152 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
153 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
154 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
155 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
156 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
157 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
158 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
159 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
160 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
161 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
162 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
163 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
164 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
165 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
166 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
167 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
168 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
169 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
170 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
171 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
172 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
173 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
174 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
175 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
176 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
177 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
178 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
179 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
180 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
181 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
182 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
183 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
184 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
185 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
186 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
187 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
188 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
189 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
190 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
191 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
192 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
193 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
194 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
201 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
202 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
203 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
205 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
206 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
207 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
208 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
209 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
210 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
211 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
212 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
213 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
214 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
215 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
216 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.17
Metatranscriptomes 0
Isolates 0.83

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.12
Nodule 0
Rhizoplane 0.62
Rhizosphere 90.85
Stem 0
Stem Tuber 0
Unclassified 5.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25152J39213_1000514 3300002773 Bacteria 21558
2 rootH2_10003965 3300003320 Bacteria 3337
3 rootH2_10008746 3300003320 Bacteria 51850
4 rootH2_10052413 3300003320 Bacteria 10588
5 rootL2_10125697 3300003322 Bacteria 3779
6 rootH1_10000182 3300003323 Bacteria 80743
7 rootH1_10026691 3300003323 Bacteria 3490
8 JGI25160J50197_1000482 3300003354 Bacteria 24215
9 Ga0065714_10073563 3300005288 Bacteria 3163
10 Ga0065704_10127792 3300005289 Bacteria 1670
11 Ga0065712_10001958 3300005290 Bacteria 5043
12 Ga0065712_10005944 3300005290 Bacteria 2723
13 Ga0065715_10113766 3300005293 Bacteria 2476
14 Ga0070658_10019260 3300005327 Bacteria 5467
15 Ga0070658_10028155 3300005327 Bacteria 4509
16 Ga0070658_10040698 3300005327 Bacteria 3750
17 Ga0070658_10049549 3300005327 Bacteria 3403
18 Ga0070676_10061331 3300005328 Bacteria 2235
19 Ga0070676_10130215 3300005328 Bacteria 1590
20 Ga0070683_100007500 3300005329 Bacteria 9221
21 Ga0070690_100178362 3300005330 Unclassified 1467
22 Ga0070670_100031691 3300005331 Bacteria 4553
23 Ga0070670_100041730 3300005331 Bacteria 3943
24 Ga0070670_100170578 3300005331 Bacteria 1887
25 Ga0068869_100004443 3300005334 Bacteria 8718
26 Ga0068869_100023125 3300005334 Bacteria 4289
27 Ga0070666_10000736 3300005335 Bacteria 19845
28 Ga0070666_10082580 3300005335 Bacteria 2197
29 Ga0070680_100009010 3300005336 Bacteria 7651
30 Ga0070680_100027625 3300005336 Bacteria 4544
31 Ga0070680_100032477 3300005336 Bacteria 4202
32 Ga0070682_100000039 3300005337 Bacteria 144400
33 Ga0070682_100027069 3300005337 Bacteria 3438
34 Ga0070682_100041851 3300005337 Bacteria 2826
35 Ga0068868_100025378 3300005338 Bacteria 4508
36 Ga0068868_100052341 3300005338 Bacteria 3214
37 Ga0068868_100159591 3300005338 Bacteria 1861
38 Ga0070660_100003861 3300005339 Bacteria 10345
39 Ga0070660_100084604 3300005339 Bacteria 2493
40 Ga0070660_100200131 3300005339 Unclassified 1620
41 Ga0070691_10007417 3300005341 Bacteria 5024
42 Ga0070687_100028851 3300005343 Bacteria 2695
43 Ga0070661_100006246 3300005344 Bacteria 8219
44 Ga0070668_100018964 3300005347 Bacteria 5169
45 Ga0070669_100053415 3300005353 Bacteria 2957
46 Ga0070675_100028501 3300005354 Bacteria 4494
47 Ga0070671_100013386 3300005355 Bacteria 6613
48 Ga0070671_100014761 3300005355 Bacteria 6312
49 Ga0070671_100035374 3300005355 Bacteria 4138
50 Ga0070674_100053414 3300005356 Bacteria 2790
51 Ga0070674_100055903 3300005356 Bacteria 2735
52 Ga0070674_100198682 3300005356 Unclassified 1547
53 Ga0070673_100002623 3300005364 Bacteria 10995
54 Ga0070673_100056847 3300005364 Bacteria 3088
55 Ga0070673_100060347 3300005364 Bacteria 3005
56 Ga0070688_100046682 3300005365 Bacteria 2683
57 Ga0070688_100085992 3300005365 Bacteria 2045
58 Ga0070659_100006225 3300005366 Bacteria 8620
59 Ga0070659_100024971 3300005366 Bacteria 4586
60 Ga0070662_100006256 3300005457 Bacteria 7668
61 Ga0070681_10005928 3300005458 Bacteria 11826
62 Ga0070681_10050534 3300005458 Bacteria 4148
63 Ga0070681_10073510 3300005458 Bacteria 3380
64 Ga0068867_100033289 3300005459 Bacteria 3731
65 Ga0068867_100142571 3300005459 Bacteria 1874
66 Ga0070685_10056827 3300005466 Bacteria 2276
67 Ga0070685_10065807 3300005466 Unclassified 2134
68 Ga0070698_100015685 3300005471 Bacteria 8002
69 Ga0070698_100025685 3300005471 Bacteria 6136
70 Ga0070679_100000261 3300005530 Bacteria 44142
71 Ga0070679_100004413 3300005530 Bacteria 13012
72 Ga0070684_100021170 3300005535 Bacteria 5405
73 Ga0068853_100037636 3300005539 Bacteria 4117
74 Ga0068853_100041737 3300005539 Bacteria 3920
75 Ga0068853_100043902 3300005539 Bacteria 3825
76 Ga0068853_100073763 3300005539 Bacteria 2976
77 Ga0068853_100123954 3300005539 Bacteria 2307
78 Ga0068853_100198969 3300005539 Bacteria 1823
79 Ga0068853_100245519 3300005539 Bacteria 1642
80 Ga0070672_100093178 3300005543 Unclassified 2433
81 Ga0070672_100105743 3300005543 Bacteria 2288
82 Ga0070672_100303950 3300005543 Bacteria 1353
83 Ga0070686_100096417 3300005544 Bacteria 1989
84 Ga0070665_100000001 3300005548 Bacteria 1083363
85 Ga0070665_100372159 3300005548 Bacteria 1436
86 Ga0070704_100059486 3300005549 Bacteria 2726
87 Ga0068855_100000943 3300005563 Bacteria 36241
88 Ga0068855_100003486 3300005563 Bacteria 19264
89 Ga0068855_100005029 3300005563 Bacteria 16134
90 Ga0068855_100034076 3300005563 Bacteria 6075
91 Ga0068855_100069098 3300005563 Bacteria 4111
92 Ga0068855_100178574 3300005563 Bacteria 2401
93 Ga0070664_100007173 3300005564 Bacteria 8984
94 Ga0068857_100021480 3300005577 Bacteria 5680
95 Ga0068857_100032455 3300005577 Bacteria 4617
96 Ga0068857_100150671 3300005577 Bacteria 2107
97 Ga0068856_100053527 3300005614 Bacteria 3980
98 Ga0068856_100060011 3300005614 Bacteria 3757
99 Ga0068856_100250628 3300005614 Bacteria 1786
100 Ga0070702_100008256 3300005615 Bacteria 5033
101 Ga0068852_100007382 3300005616 Bacteria 8021
102 Ga0068852_100026957 3300005616 Bacteria 4678
103 Ga0068859_100000037 3300005617 Bacteria 165480
104 Ga0068859_100000536 3300005617 Bacteria 37574
105 Ga0068859_100005033 3300005617 Bacteria 13412
106 Ga0068864_100036781 3300005618 Bacteria 4175
107 Ga0068864_100053004 3300005618 Bacteria 3498
108 Ga0068864_100091925 3300005618 Bacteria 2678
109 Ga0068864_100134451 3300005618 Bacteria 2225
110 Ga0068864_100217379 3300005618 Unclassified 1762
111 Ga0068861_100025507 3300005719 Bacteria 4288
112 Ga0068861_100121323 3300005719 Bacteria 2109
113 Ga0068851_10013893 3300005834 Bacteria 3815
114 Ga0068870_10013779 3300005840 Bacteria 3807
115 Ga0068863_100014271 3300005841 Bacteria 7651
116 Ga0068863_100067931 3300005841 Bacteria 3372
117 Ga0068863_100220780 3300005841 Unclassified 1826
118 Ga0068858_100002312 3300005842 Bacteria 19265
119 Ga0068858_100173721 3300005842 Bacteria 2033
120 Ga0068860_100000097 3300005843 Bacteria 146573
121 Ga0068860_100003825 3300005843 Bacteria 15482
122 Ga0068860_100006692 3300005843 Bacteria 11570
123 Ga0068860_100030783 3300005843 Bacteria 5160
124 Ga0068860_100221220 3300005843 Bacteria 1839
125 Ga0068862_100311235 3300005844 Unclassified 1451
126 Ga0081539_10000531 3300005985 Bacteria 79191
127 Ga0097621_100004955 3300006237 Bacteria 9334
128 Ga0097621_100023231 3300006237 Bacteria 4823
129 Ga0097621_100027982 3300006237 Bacteria 4438
130 Ga0097621_100114608 3300006237 Bacteria 2281
131 Ga0097621_100223512 3300006237 Bacteria 1641
132 Ga0075370_10069434 3300006353 Bacteria 2013
133 Ga0068871_100007194 3300006358 Bacteria 7939
134 Ga0068871_100022719 3300006358 Bacteria 4840
135 Ga0068871_100287537 3300006358 Bacteria 1440
136 Ga0075428_100032995 3300006844 Bacteria 5716
137 Ga0075428_100104574 3300006844 Bacteria 3088
138 Ga0075431_100017389 3300006847 Bacteria 7307
139 Ga0075434_100078349 3300006871 Bacteria 3300
140 Ga0075429_100014460 3300006880 Bacteria 6840
141 Ga0097620_100000037 3300006931 Bacteria 165480
142 Ga0097620_100000536 3300006931 Bacteria 37574
143 Ga0097620_100005033 3300006931 Bacteria 13412
144 Ga0105240_10000078 3300009093 Bacteria 196646
145 Ga0105240_10042369 3300009093 Bacteria 5801
146 Ga0105240_10205259 3300009093 Bacteria 2307
147 Ga0105240_10240910 3300009093 Bacteria 2097
148 Ga0105240_10330065 3300009093 Unclassified 1736
149 Ga0111539_10264083 3300009094 Bacteria 2004
150 Ga0111539_10297941 3300009094 Bacteria 1877
151 Ga0111539_10362089 3300009094 Bacteria 1688
152 Ga0105245_10104661 3300009098 Unclassified 2624
153 Ga0105247_10011542 3300009101 Bacteria 5320
154 Ga0114129_10034640 3300009147 Bacteria 7132
155 Ga0114129_10043562 3300009147 Bacteria 6314
156 Ga0105241_10006545 3300009174 Bacteria 8586
157 Ga0105241_10025931 3300009174 Bacteria 4359
158 Ga0105241_10113448 3300009174 Bacteria 2173
159 Ga0105237_10006110 3300009545 Bacteria 13459
160 Ga0105237_10011935 3300009545 Bacteria 9183
161 Ga0105237_10090061 3300009545 Bacteria 3058
162 Ga0105249_10009599 3300009553 Bacteria 8479
163 Ga0105249_10192373 3300009553 Unclassified 1992
164 Ga0105239_10007449 3300010375 Bacteria 12560
165 Ga0105239_10014614 3300010375 Bacteria 8709
166 Ga0105239_10050855 3300010375 Bacteria 4544
167 Ga0105239_10062529 3300010375 Bacteria 4086
168 Ga0105239_10194085 3300010375 Bacteria 2273
169 Ga0105246_10092279 3300011119 Bacteria 2185
170 Ga0157373_10000166 3300013100 Bacteria 53680
171 Ga0157373_10024026 3300013100 Bacteria 4417
172 Ga0157373_10036243 3300013100 Unclassified 3541
173 Ga0157373_10079460 3300013100 Bacteria 2313
174 Ga0157371_10007233 3300013102 Bacteria 9016
175 Ga0157371_10007399 3300013102 Bacteria 8895
176 Ga0157371_10008547 3300013102 Bacteria 8147
177 Ga0157371_10008995 3300013102 Bacteria 7899
178 Ga0157371_10009339 3300013102 Bacteria 7731
179 Ga0157371_10011001 3300013102 Bacteria 7010
180 Ga0157371_10013665 3300013102 Bacteria 6159
181 Ga0157371_10016059 3300013102 Bacteria 5597
182 Ga0157371_10016343 3300013102 Bacteria 5542
183 Ga0157371_10027424 3300013102 Unclassified 4132
184 Ga0157371_10035230 3300013102 Bacteria 3587
185 Ga0157371_10043001 3300013102 Bacteria 3219
186 Ga0157371_10046863 3300013102 Bacteria 3073
187 Ga0157371_10049156 3300013102 Bacteria 2996
188 Ga0157371_10063526 3300013102 Bacteria 2617
189 Ga0157371_10079689 3300013102 Bacteria 2319
190 Ga0157370_10000926 3300013104 Bacteria 37246
191 Ga0157370_10001022 3300013104 Bacteria 35238
192 Ga0157370_10007713 3300013104 Bacteria 11670
193 Ga0157370_10078590 3300013104 Bacteria 3107
194 Ga0157369_10004228 3300013105 Bacteria 17006
195 Ga0157369_10047861 3300013105 Bacteria 4641
196 Ga0157369_10059731 3300013105 Bacteria 4112
197 Ga0157369_10327447 3300013105 Bacteria 1592
198 Ga0157374_10006773 3300013296 Bacteria 9742
199 Ga0157374_10329931 3300013296 Unclassified 1513
200 Ga0157378_10001265 3300013297 Bacteria 22756
201 Ga0157378_10001438 3300013297 Bacteria 21454
202 Ga0157378_10009369 3300013297 Bacteria 8531
203 Ga0157378_10013225 3300013297 Bacteria 7216
204 Ga0157378_10030927 3300013297 Bacteria 4726
205 Ga0157378_10058936 3300013297 Unclassified 3425
206 Ga0157378_10072264 3300013297 Bacteria 3100
207 Ga0157378_10157485 3300013297 Bacteria 2121
208 Ga0163162_10003046 3300013306 Bacteria 16013
209 Ga0163162_10004768 3300013306 Bacteria 13086
210 Ga0163162_10005314 3300013306 Bacteria 12433
211 Ga0163162_10084256 3300013306 Bacteria 3254
212 Ga0157372_10006556 3300013307 Bacteria 12386
213 Ga0157372_10008424 3300013307 Bacteria 10946
214 Ga0157372_10011232 3300013307 Bacteria 9525
215 Ga0157372_10015170 3300013307 Bacteria 8247
216 Ga0157372_10025328 3300013307 Bacteria 6448
217 Ga0157372_10029752 3300013307 Bacteria 5968
218 Ga0157372_10030780 3300013307 Bacteria 5872
219 Ga0157372_10032350 3300013307 Bacteria 5735
220 Ga0157372_10033583 3300013307 Bacteria 5637
221 Ga0157372_10056493 3300013307 Bacteria 4386
222 Ga0157372_10164748 3300013307 Bacteria 2563
223 Ga0157372_10212760 3300013307 Unclassified 2240
224 Ga0157372_10383408 3300013307 Bacteria 1638
225 Ga0157375_10017855 3300013308 Bacteria 6417
226 Ga0157375_10062426 3300013308 Unclassified 3703
227 Ga0157375_10088193 3300013308 Bacteria 3156
228 Ga0157375_10148451 3300013308 Bacteria 2478
229 Ga0163163_10018090 3300014325 Bacteria 6586
230 Ga0163163_10233531 3300014325 Bacteria 1888
231 Ga0157380_10006635 3300014326 Bacteria 8164
232 Ga0157379_10069408 3300014968 Bacteria 3152
233 Ga0157376_10123108 3300014969 Bacteria 2302
234 Ga0157376_10158690 3300014969 Bacteria 2048
235 Ga0182006_1001324 3300015261 Bacteria 15184
236 Ga0163161_10207893 3300017792 Bacteria 1511
237 Ga0213876_10007954 3300021384 Bacteria 5751
238 Ga0213876_10062348 3300021384 Unclassified 1968
239 Ga0207426_1000019 3300025302 Bacteria 558579
240 Ga0207656_10013578 3300025321 Bacteria 3117
241 Ga0207656_10033516 3300025321 Bacteria 2140
242 Ga0207682_10003812 3300025893 Bacteria 6469
243 Ga0207688_10128871 3300025901 Bacteria 1482
244 Ga0207680_10002758 3300025903 Bacteria 8216
245 Ga0207680_10016836 3300025903 Unclassified 3849
246 Ga0207647_10002349 3300025904 Bacteria 14385
247 Ga0207645_10002409 3300025907 Bacteria 14721
248 Ga0207645_10003154 3300025907 Bacteria 12623
249 Ga0207645_10026076 3300025907 Bacteria 3779
250 Ga0207643_10009735 3300025908 Bacteria 5158
251 Ga0207705_10004284 3300025909 Bacteria 10799
252 Ga0207705_10013817 3300025909 Bacteria 5823
253 Ga0207705_10021609 3300025909 Bacteria 4592
254 Ga0207705_10065939 3300025909 Unclassified 2618
255 Ga0207705_10129775 3300025909 Unclassified 1875
256 Ga0207705_10168231 3300025909 Bacteria 1649
257 Ga0207654_10117836 3300025911 Bacteria 1662
258 Ga0207707_10054841 3300025912 Bacteria 3469
259 Ga0207707_10126207 3300025912 Bacteria 2238
260 Ga0207707_10135897 3300025912 Bacteria 2150
261 Ga0207695_10004145 3300025913 Bacteria 19901
262 Ga0207695_10013059 3300025913 Bacteria 9917
263 Ga0207671_10000030 3300025914 Bacteria 248197
264 Ga0207671_10001737 3300025914 Bacteria 24547
265 Ga0207671_10011854 3300025914 Bacteria 7054
266 Ga0207660_10009261 3300025917 Bacteria 6373
267 Ga0207660_10174397 3300025917 Bacteria 1666
268 Ga0207662_10030383 3300025918 Bacteria 3135
269 Ga0207657_10006305 3300025919 Bacteria 12325
270 Ga0207657_10015899 3300025919 Bacteria 7269
271 Ga0207657_10037079 3300025919 Bacteria 4359
272 Ga0207657_10070149 3300025919 Bacteria 2971
273 Ga0207657_10086087 3300025919 Unclassified 2631
274 Ga0207649_10007091 3300025920 Bacteria 6089
275 Ga0207652_10000011 3300025921 Bacteria 246742
276 Ga0207652_10001022 3300025921 Bacteria 25679
277 Ga0207652_10001938 3300025921 Bacteria 17900
278 Ga0207652_10047038 3300025921 Bacteria 3685
279 Ga0207650_10017571 3300025925 Bacteria 5009
280 Ga0207650_10183575 3300025925 Bacteria 1668
281 Ga0207650_10192348 3300025925 Bacteria 1631
282 Ga0207644_10046203 3300025931 Bacteria 3101
283 Ga0207644_10062163 3300025931 Unclassified 2707
284 Ga0207690_10015768 3300025932 Bacteria 4586
285 Ga0207690_10021834 3300025932 Unclassified 3976
286 Ga0207690_10033251 3300025932 Bacteria 3315
287 Ga0207690_10043829 3300025932 Bacteria 2946
288 Ga0207706_10005428 3300025933 Bacteria 11881
289 Ga0207706_10010698 3300025933 Bacteria 8380
290 Ga0207706_10041914 3300025933 Bacteria 4057
291 Ga0207706_10082860 3300025933 Bacteria 2819
292 Ga0207686_10001882 3300025934 Bacteria 11632
293 Ga0207669_10054135 3300025937 Bacteria 2422
294 Ga0207669_10154203 3300025937 Unclassified 1613
295 Ga0207691_10001190 3300025940 Bacteria 25881
296 Ga0207691_10030545 3300025940 Bacteria 5034
297 Ga0207691_10188250 3300025940 Bacteria 1801
298 Ga0207689_10002113 3300025942 Bacteria 18676
299 Ga0207689_10006219 3300025942 Bacteria 10573
300 Ga0207689_10015884 3300025942 Bacteria 6377
301 Ga0207689_10015935 3300025942 Bacteria 6363
302 Ga0207689_10100502 3300025942 Bacteria 2376
303 Ga0207689_10132883 3300025942 Bacteria 2048
304 Ga0207661_10079764 3300025944 Bacteria 2699
305 Ga0207661_10134306 3300025944 Bacteria 2124
306 Ga0207661_10260174 3300025944 Bacteria 1545
307 Ga0207667_10031638 3300025949 Bacteria 5710
308 Ga0207667_10038002 3300025949 Bacteria 5144
309 Ga0207667_10061754 3300025949 Unclassified 3920
310 Ga0207667_10184185 3300025949 Bacteria 2144
311 Ga0207667_10201658 3300025949 Bacteria 2041
312 Ga0207667_10275391 3300025949 Bacteria 1720
313 Ga0207712_10004159 3300025961 Bacteria 9138
314 Ga0207712_10068531 3300025961 Bacteria 2543
315 Ga0207668_10002118 3300025972 Bacteria 11582
316 Ga0207640_10006764 3300025981 Bacteria 6308
317 Ga0207640_10187498 3300025981 Bacteria 1556
318 Ga0207658_10003810 3300025986 Bacteria 10617
319 Ga0207677_10005219 3300026023 Bacteria 7028
320 Ga0207677_10038904 3300026023 Unclassified 3122
321 Ga0207677_10213624 3300026023 Bacteria 1542
322 Ga0207703_10000878 3300026035 Bacteria 29522
323 Ga0207703_10002291 3300026035 Bacteria 16697
324 Ga0207703_10243051 3300026035 Bacteria 1619
325 Ga0207639_10084390 3300026041 Bacteria 2523
326 Ga0207639_10093160 3300026041 Bacteria 2415
327 Ga0207639_10199462 3300026041 Bacteria 1715
328 Ga0207639_10232013 3300026041 Bacteria 1600
329 Ga0207678_10041265 3300026067 Bacteria 4001
330 Ga0207702_10099997 3300026078 Bacteria 2558
331 Ga0207702_10180398 3300026078 Bacteria 1944
332 Ga0207702_10237366 3300026078 Bacteria 1706
333 Ga0207641_10000121 3300026088 Bacteria 114943
334 Ga0207641_10001127 3300026088 Bacteria 26849
335 Ga0207641_10023380 3300026088 Bacteria 5092
336 Ga0207648_10002892 3300026089 Bacteria 18178
337 Ga0207648_10008275 3300026089 Bacteria 10099
338 Ga0207648_10111408 3300026089 Bacteria 2403
339 Ga0207648_10174998 3300026089 Unclassified 1898
340 Ga0207648_10181736 3300026089 Bacteria 1862
341 Ga0207676_10005703 3300026095 Bacteria 8812
342 Ga0207676_10006139 3300026095 Bacteria 8481
343 Ga0207676_10078780 3300026095 Bacteria 2670
344 Ga0207674_10013815 3300026116 Bacteria 8933
345 Ga0207674_10241158 3300026116 Bacteria 1754
346 Ga0207675_100022291 3300026118 Bacteria 5897
347 Ga0207683_10003508 3300026121 Bacteria 13678
348 Ga0207683_10060605 3300026121 Bacteria 3327
349 Ga0207698_10068358 3300026142 Bacteria 2805
350 Ga0207698_10071001 3300026142 Bacteria 2761
351 Ga0207698_10280265 3300026142 Bacteria 1541
352 Ga0268266_10000038 3300028379 Bacteria 325729
353 Ga0268266_10029950 3300028379 Bacteria 4625
354 Ga0268264_10000167 3300028381 Bacteria 146190
355 Ga0268264_10002971 3300028381 Bacteria 14730
356 Ga0268264_10020319 3300028381 Bacteria 5427
357 Ga0268264_10069445 3300028381 Bacteria 2979
358 Ga0307515_10000001 3300028794 Bacteria 4259510
359 Ga0307515_10000009 3300028794 Bacteria 653206
360 Ga0307515_10000469 3300028794 Bacteria 96345
361 Ga0307515_10031785 3300028794 Bacteria 8775
362 Ga0265338_10078557 3300028800 Bacteria 2783
363 Ga0265324_10013433 3300029957 Bacteria 3056
364 Ga0265324_10033791 3300029957 Bacteria 1783
365 Ga0307511_10003942 3300030521 Bacteria 15161
366 Ga0265327_10000159 3300031251 Bacteria 145537
367 Ga0265327_10000259 3300031251 Bacteria 104677
368 Ga0265327_10000368 3300031251 Bacteria 85604
369 Ga0265327_10000939 3300031251 Bacteria 42679
370 Ga0265327_10031333 3300031251 Bacteria 2989
371 Ga0307513_10047126 3300031456 Bacteria 4691
372 Ga0307513_10101732 3300031456 Unclassified 2894
373 Ga0307509_10006991 3300031507 Bacteria 14957
374 Ga0307509_10056827 3300031507 Bacteria 4152
375 Ga0307509_10068909 3300031507 Bacteria 3700
376 Ga0307405_10016358 3300031731 Bacteria 4045
377 Ga0307405_10149182 3300031731 Bacteria 1642
378 Ga0307413_10002282 3300031824 Bacteria 7753
379 Ga0307413_10125350 3300031824 Bacteria 1748
380 Ga0307410_10020668 3300031852 Bacteria 4033
381 Ga0307407_10017021 3300031903 Bacteria 3635
382 Ga0307409_100015491 3300031995 Bacteria 5006
383 Ga0307409_100162971 3300031995 Bacteria 1953
384 Ga0307414_10013350 3300032004 Bacteria 4888
385 Ga0307414_10056139 3300032004 Bacteria 2761
386 Ga0307411_10029620 3300032005 Bacteria 3346
387 Ga0307415_100100042 3300032126 Bacteria 2124
388 Ga0373956_0098257 3300035119 Bacteria 1356
389 Ga0373955_0016592 3300035172 Bacteria 3629
390 Ga0395899_0039905 3300037312 Unclassified 3512
391 Ga0395899_0133564 3300037312 Bacteria 1770
392 Ga0395900_0007428 3300037418 Bacteria 11325
393 Ga0395900_0044179 3300037418 Bacteria 4592
394 Ga0395900_0123000 3300037418 Bacteria 2661
395 Ga0395900_0251031 3300037418 Bacteria 1770
396 Ga0395898_0002001 3300037466 Bacteria 25583
397 Ga0395898_0003839 3300037466 Bacteria 16653
398 Ga0395898_0052304 3300037466 Bacteria 3990
399 Ga0395898_0083045 3300037466 Bacteria 3087
400 Ga0395905_0157210 3300037471 Bacteria 2138
401 Ga0395901_0004458 3300038443 Bacteria 14124
402 Ga0395901_0277438 3300038443 Bacteria 1742
403 Ga0395901_0370648 3300038443 Bacteria 1475
404 Ga0436365_0090962 3300039437 Unclassified 1490
405 Ga0436365_1207044 3300039437 Bacteria 3509
406 Ga0436365_1637134 3300039437 Bacteria 28226
407 Ga0436365_1727881 3300039437 Bacteria 6302
408 Ga0439436_0001857 3300041404 Bacteria 6238
409 Ga0439457_002255 3300042014 Bacteria 5577
410 Ga0439462_0002412 3300042015 Bacteria 4340
411 Ga0450923_004203 3300042125 Bacteria 2246
412 Ga0451577_0100440 3300042876 Bacteria 2584
413 Ga0466972_0000003 3300044658 Bacteria 391452
414 Ga0466972_0000013 3300044658 Bacteria 229345
415 Ga0466964_0030828 3300044706 Bacteria 2124
416 Ga0453684_0003241 3300044712 Bacteria 37219
417 Ga0453684_0202584 3300044712 Bacteria 2312
418 Ga0453684_0309396 3300044712 Unclassified 1793
419 Ga0453684_0331731 3300044712 Unclassified 1720
420 Ga0466970_0000607 3300044765 Bacteria 17574
421 Ga0466957_0000578 3300044842 Bacteria 18516
422 Ga0466957_0007652 3300044842 Bacteria 6110
423 Ga0466959_0000017 3300045049 Bacteria 143170
424 Ga0451576_0001313 3300045051 Bacteria 43025
425 Ga0466967_0131161 3300045976 Bacteria 2327
426 Ga0495628_0138045 3300046516 Bacteria 1862
427 Ga0495630_0286595 3300046517 Bacteria 1258
428 Ga0495598_0031956 3300046537 Bacteria 1484
429 Ga0495645_0039736 3300046543 Bacteria 3431
430 Ga0495668_0000459 3300046616 Bacteria 52226
431 Ga0495668_0005253 3300046616 Bacteria 8868
432 Ga0495600_0226755 3300046809 Unclassified 1194
433 Ga0495636_0000037 3300047318 Bacteria 56866
434 Ga0495636_0001728 3300047318 Bacteria 8339
435 Ga0495674_0106602 3300047319 Unclassified 2380
436 Ga0495672_0029609 3300047320 Bacteria 3446
437 Ga0495672_0041454 3300047320 Bacteria 2784
438 Ga0495687_000001 3300047443 Bacteria 1215582
439 Ga0495684_0042041 3300047471 Bacteria 3502
440 Ga0496106_0047444 3300048909 Bacteria 3233
441 Ga0496115_0015611 3300048918 Bacteria 5766
442 Ga0496115_0084940 3300048918 Unclassified 2581
443 Ga0496124_0110042 3300048927 Bacteria 2219
444 Ga0501031_0074119 3300049568 Bacteria 2216
445 Ga0501033_0198329 3300049570 Bacteria 1434
446 Ga0501034_0023649 3300049571 Bacteria 6258
447 Ga0501034_0025793 3300049571 Bacteria 5986
448 Ga0501034_0026193 3300049571 Bacteria 5938
449 Ga0501034_0127703 3300049571 Bacteria 2527
450 Ga0501039_0061222 3300049575 Bacteria 2915
451 Ga0501043_0010910 3300049579 Bacteria 7116
452 Ga0501043_0061753 3300049579 Bacteria 2942
453 Ga0501047_0089981 3300049581 Bacteria 2946
454 Ga0501047_0249305 3300049581 Bacteria 1624
455 Ga0501070_0040813 3300049586 Bacteria 3869
456 Ga0501219_001225 3300049703 Bacteria 2744
457 Ga0501225_0001574 3300049705 Bacteria 7148
458 Ga0501035_0037595 3300049822 Bacteria 4383
459 Ga0501035_0048342 3300049822 Bacteria 3815
460 Ga0501044_0004256 3300049823 Bacteria 16057
461 Ga0501044_0028978 3300049823 Bacteria 5840
462 Ga0501044_0140311 3300049823 Bacteria 2406
463 Ga0501284_00055 3300050005 Bacteria 41764
464 nmdc:mga0k408_55793_c1 3300050493 Bacteria 2291
465 nmdc:mga05p37_36468_c1 3300050507 Bacteria 6032
466 nmdc:mga08y16_438127_c1 3300050511 Bacteria 1334
467 nmdc:mga0n895_99301_c1 3300050512 Bacteria 2919
468 Ga0500578_0000628 3300053086 Bacteria 42830
469 Ga0500578_0025149 3300053086 Bacteria 3820
470 Ga0500644_0013802 3300053088 Unclassified 2265
471 Ga0500583_0000127 3300053092 Bacteria 35082
472 Ga0500583_0000546 3300053092 Bacteria 11466
473 Ga0500562_000077 3300053108 Bacteria 45189
474 Ga0500622_0003322 3300053156 Bacteria 10864
475 Ga0500636_0113753 3300053177 Bacteria 1526
476 Ga0500636_0161493 3300053177 Bacteria 1221
477 Ga0500587_008802 3300053739 Bacteria 1296

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046809 Ga0495600_0226755 Ga0495600_0226755_134_1156 323
2 3300053088 Ga0500644_0013802 Ga0500644_0013802_74_1165 348
3 3300014325 Ga0163163_10018090 Ga0163163_100180908 350
4 3300003320 rootH2_10052413 rootH2_100524132 352
5 3300048927 Ga0496124_0110042 Ga0496124_0110042_223_1323 353
6 3300025981 Ga0207640_10187498 Ga0207640_101874982 356
7 3300039437 Ga0436365_0090962 Ga0436365_0090962_59_1201 356
8 3300009093 Ga0105240_10205259 Ga0105240_102052593 359
9 3300046517 Ga0495630_0286595 Ga0495630_0286595_58_1188 359
10 3300049581 Ga0501047_0249305 Ga0501047_0249305_465_1586 359
11 3300053177 Ga0500636_0161493 Ga0500636_0161493_63_1187 359
12 3300005843 Ga0068860_100006692 Ga0068860_1000066927 366
13 3300028381 Ga0268264_10069445 Ga0268264_100694451 366
14 3300031251 Ga0265327_10000939 Ga0265327_1000093930 374
15 3300006353 Ga0075370_10069434 Ga0075370_100694341 378
16 3300031456 Ga0307513_10047126 Ga0307513_100471264 378
17 3300031507 Ga0307509_10006991 Ga0307509_100069912 378
18 3300005618 Ga0068864_100091925 Ga0068864_1000919253 379
19 3300026095 Ga0207676_10078780 Ga0207676_100787803 379
20 3300009094 Ga0111539_10362089 Ga0111539_103620891 380
21 3300025925 Ga0207650_10183575 Ga0207650_101835751 380
22 3300044712 Ga0453684_0309396 Ga0453684_0309396_22_1248 380
23 3300050511 nmdc:mga08y16_438127_c1 nmdc:mga08y16_438127_c1_20_1264 380
24 3300005327 Ga0070658_10040698 Ga0070658_100406984 381
25 3300005334 Ga0068869_100004443 Ga0068869_1000044432 381
26 3300005335 Ga0070666_10000736 Ga0070666_1000073614 381
27 3300005616 Ga0068852_100026957 Ga0068852_1000269573 381
28 3300005617 Ga0068859_100000037 Ga0068859_100000037105 381
29 3300005842 Ga0068858_100002312 Ga0068858_10000231210 381
30 3300005843 Ga0068860_100030783 Ga0068860_1000307833 381
31 3300006237 Ga0097621_100004955 Ga0097621_1000049556 381
32 3300006358 Ga0068871_100007194 Ga0068871_1000071942 381
33 3300006931 Ga0097620_100000037 Ga0097620_100000037105 381
34 3300009101 Ga0105247_10011542 Ga0105247_100115424 381
35 3300009174 Ga0105241_10006545 Ga0105241_100065459 381
36 3300010375 Ga0105239_10050855 Ga0105239_100508554 381
37 3300013102 Ga0157371_10043001 Ga0157371_100430012 381
38 3300013306 Ga0163162_10004768 Ga0163162_100047688 381
39 3300025903 Ga0207680_10002758 Ga0207680_100027583 381
40 3300025911 Ga0207654_10117836 Ga0207654_101178361 381
41 3300025914 Ga0207671_10001737 Ga0207671_1000173711 381
42 3300025942 Ga0207689_10015884 Ga0207689_100158842 381
43 3300025961 Ga0207712_10068531 Ga0207712_100685311 381
44 3300026035 Ga0207703_10000878 Ga0207703_1000087818 381
45 3300026088 Ga0207641_10000121 Ga0207641_1000012156 381
46 3300026095 Ga0207676_10005703 Ga0207676_100057034 381
47 3300026142 Ga0207698_10068358 Ga0207698_100683582 381
48 3300028381 Ga0268264_10020319 Ga0268264_100203195 381
49 iso_pu_bacteria 2818991444 2819590725 381
50 iso_pu_bacteria 2929154850 2929157745 381
51 3300005356 Ga0070674_100198682 Ga0070674_1001986821 383
52 3300009553 Ga0105249_10009599 Ga0105249_100095991 383
53 3300013306 Ga0163162_10005314 Ga0163162_1000531411 383
54 3300013307 Ga0157372_10056493 Ga0157372_100564933 383
55 3300014326 Ga0157380_10006635 Ga0157380_100066358 383
56 3300014968 Ga0157379_10069408 Ga0157379_100694082 383
57 3300025937 Ga0207669_10154203 Ga0207669_101542031 383
58 3300031507 Ga0307509_10056827 Ga0307509_100568273 383
59 3300009545 Ga0105237_10006110 Ga0105237_1000611011 384
60 3300025914 Ga0207671_10011854 Ga0207671_100118546 384
61 3300044712 Ga0453684_0202584 Ga0453684_0202584_13_1272 384
62 iso_pu_bacteria 2881955468 2881957756 384
63 3300003320 rootH2_10003965 rootH2_100039653 385
64 3300003323 rootH1_10026691 rootH1_100266914 385
65 3300003354 JGI25160J50197_1000482 JGI25160J50197_100048217 385
66 3300005327 Ga0070658_10049549 Ga0070658_100495494 385
67 3300005329 Ga0070683_100007500 Ga0070683_1000075009 385
68 3300005331 Ga0070670_100170578 Ga0070670_1001705781 385
69 3300005337 Ga0070682_100027069 Ga0070682_1000270694 385
70 3300005338 Ga0068868_100052341 Ga0068868_1000523414 385
71 3300005339 Ga0070660_100084604 Ga0070660_1000846041 385
72 3300005344 Ga0070661_100006246 Ga0070661_1000062467 385
73 3300005355 Ga0070671_100035374 Ga0070671_1000353744 385
74 3300005364 Ga0070673_100060347 Ga0070673_1000603472 385
75 3300005365 Ga0070688_100085992 Ga0070688_1000859922 385
76 3300005366 Ga0070659_100006225 Ga0070659_10000622510 385
77 3300005457 Ga0070662_100006256 Ga0070662_1000062567 385
78 3300005530 Ga0070679_100004413 Ga0070679_1000044138 385
79 3300005535 Ga0070684_100021170 Ga0070684_1000211705 385
80 3300005539 Ga0068853_100037636 Ga0068853_1000376362 385
81 3300005563 Ga0068855_100034076 Ga0068855_1000340762 385
82 3300005564 Ga0070664_100007173 Ga0070664_1000071733 385
83 3300005577 Ga0068857_100032455 Ga0068857_1000324554 385
84 3300005577 Ga0068857_100150671 Ga0068857_1001506712 385
85 3300005614 Ga0068856_100053527 Ga0068856_1000535276 385
86 3300005616 Ga0068852_100007382 Ga0068852_1000073828 385
87 3300005985 Ga0081539_10000531 Ga0081539_100005315 385
88 3300006237 Ga0097621_100023231 Ga0097621_1000232315 385
89 3300006358 Ga0068871_100022719 Ga0068871_1000227193 385
90 3300009545 Ga0105237_10090061 Ga0105237_100900613 385
91 3300013100 Ga0157373_10079460 Ga0157373_100794602 385
92 3300013102 Ga0157371_10008995 Ga0157371_100089952 385
93 3300013102 Ga0157371_10063526 Ga0157371_100635262 385
94 3300013102 Ga0157371_10079689 Ga0157371_100796891 385
95 3300013105 Ga0157369_10004228 Ga0157369_100042286 385
96 3300013296 Ga0157374_10006773 Ga0157374_100067735 385
97 3300013297 Ga0157378_10013225 Ga0157378_100132259 385
98 3300013307 Ga0157372_10006556 Ga0157372_100065563 385
99 3300013307 Ga0157372_10029752 Ga0157372_100297523 385
100 3300013307 Ga0157372_10164748 Ga0157372_101647481 385
101 3300013308 Ga0157375_10062426 Ga0157375_100624262 385
102 3300014969 Ga0157376_10158690 Ga0157376_101586902 385
103 3300021384 Ga0213876_10062348 Ga0213876_100623481 385
104 3300025302 Ga0207426_1000019 Ga0207426_100001928 385
105 3300025919 Ga0207657_10006305 Ga0207657_100063059 385
106 3300025920 Ga0207649_10007091 Ga0207649_100070911 385
107 3300025931 Ga0207644_10046203 Ga0207644_100462031 385
108 3300025932 Ga0207690_10043829 Ga0207690_100438292 385
109 3300025933 Ga0207706_10005428 Ga0207706_100054285 385
110 3300025944 Ga0207661_10134306 Ga0207661_101343061 385
111 3300025944 Ga0207661_10260174 Ga0207661_102601741 385
112 3300025949 Ga0207667_10275391 Ga0207667_102753912 385
113 3300026023 Ga0207677_10213624 Ga0207677_102136242 385
114 3300026041 Ga0207639_10199462 Ga0207639_101994622 385
115 3300026078 Ga0207702_10237366 Ga0207702_102373661 385
116 3300026116 Ga0207674_10013815 Ga0207674_100138153 385
117 3300026142 Ga0207698_10280265 Ga0207698_102802652 385
118 3300029957 Ga0265324_10033791 Ga0265324_100337912 385
119 3300031251 Ga0265327_10000368 Ga0265327_1000036827 385
120 3300039437 Ga0436365_1637134 Ga0436365_1637134_4634_5854 385
121 3300039437 Ga0436365_1727881 Ga0436365_1727881_3389_4618 385
122 3300044658 Ga0466972_0000003 Ga0466972_0000003_104946_106133 385
123 3300044765 Ga0466970_0000607 Ga0466970_0000607_1349_2536 385
124 3300045976 Ga0466967_0131161 Ga0466967_0131161_330_1517 385
125 3300046543 Ga0495645_0039736 Ga0495645_0039736_1386_2600 385
126 3300049571 Ga0501034_0025793 Ga0501034_0025793_3471_4700 385
127 3300049571 Ga0501034_0026193 Ga0501034_0026193_1109_2338 385
128 3300049586 Ga0501070_0040813 Ga0501070_0040813_1281_2486 385
129 3300049823 Ga0501044_0140311 Ga0501044_0140311_736_1941 385
130 3300053108 Ga0500562_000077 Ga0500562_000077_8125_9327 385
131 3300053156 Ga0500622_0003322 Ga0500622_0003322_9106_10311 385
132 3300009093 Ga0105240_10042369 Ga0105240_100423696 387
133 3300046616 Ga0495668_0000459 Ga0495668_0000459_49787_51010 387
134 3300047318 Ga0495636_0001728 Ga0495636_0001728_5070_6320 387
135 iso_pu_bacteria 2738541278 2738726229 387
136 3300005327 Ga0070658_10019260 Ga0070658_100192605 388
137 3300005327 Ga0070658_10028155 Ga0070658_100281552 388
138 3300005336 Ga0070680_100027625 Ga0070680_1000276252 388
139 3300005339 Ga0070660_100003861 Ga0070660_1000038617 388
140 3300005458 Ga0070681_10005928 Ga0070681_100059283 388
141 3300005458 Ga0070681_10050534 Ga0070681_100505344 388
142 3300005530 Ga0070679_100000261 Ga0070679_1000002618 388
143 3300005563 Ga0068855_100000943 Ga0068855_10000094343 388
144 3300005563 Ga0068855_100005029 Ga0068855_10000502910 388
145 3300005563 Ga0068855_100069098 Ga0068855_1000690985 388
146 3300005614 Ga0068856_100060011 Ga0068856_1000600112 388
147 3300009093 Ga0105240_10000078 Ga0105240_10000078141 388
148 3300009093 Ga0105240_10240910 Ga0105240_102409103 388
149 3300009093 Ga0105240_10330065 Ga0105240_103300652 388
150 3300009545 Ga0105237_10011935 Ga0105237_1001193510 388
151 3300010375 Ga0105239_10014614 Ga0105239_100146144 388
152 3300013100 Ga0157373_10000166 Ga0157373_1000016618 388
153 3300013100 Ga0157373_10036243 Ga0157373_100362432 388
154 3300013102 Ga0157371_10007233 Ga0157371_100072339 388
155 3300013102 Ga0157371_10007399 Ga0157371_100073993 388
156 3300013102 Ga0157371_10008547 Ga0157371_100085472 388
157 3300013102 Ga0157371_10009339 Ga0157371_100093392 388
158 3300013102 Ga0157371_10013665 Ga0157371_100136653 388
159 3300013102 Ga0157371_10016059 Ga0157371_100160593 388
160 3300013104 Ga0157370_10000926 Ga0157370_1000092637 388
161 3300013104 Ga0157370_10001022 Ga0157370_100010224 388
162 3300013105 Ga0157369_10047861 Ga0157369_100478615 388
163 3300013297 Ga0157378_10009369 Ga0157378_100093694 388
164 3300013307 Ga0157372_10008424 Ga0157372_100084242 388
165 3300013307 Ga0157372_10011232 Ga0157372_100112327 388
166 3300013307 Ga0157372_10025328 Ga0157372_100253283 388
167 3300013307 Ga0157372_10030780 Ga0157372_100307805 388
168 3300013307 Ga0157372_10032350 Ga0157372_100323502 388
169 3300013307 Ga0157372_10212760 Ga0157372_102127602 388
170 3300013307 Ga0157372_10383408 Ga0157372_103834082 388
171 3300025904 Ga0207647_10002349 Ga0207647_100023494 388
172 3300025909 Ga0207705_10004284 Ga0207705_100042848 388
173 3300025909 Ga0207705_10129775 Ga0207705_101297752 388
174 3300025909 Ga0207705_10168231 Ga0207705_101682312 388
175 3300025912 Ga0207707_10054841 Ga0207707_100548412 388
176 3300025913 Ga0207695_10004145 Ga0207695_1000414517 388
177 3300025914 Ga0207671_10000030 Ga0207671_10000030153 388
178 3300025917 Ga0207660_10009261 Ga0207660_100092613 388
179 3300025919 Ga0207657_10015899 Ga0207657_100158992 388
180 3300025919 Ga0207657_10086087 Ga0207657_100860872 388
181 3300025921 Ga0207652_10000011 Ga0207652_10000011122 388
182 3300025921 Ga0207652_10001022 Ga0207652_100010224 388
183 3300025921 Ga0207652_10047038 Ga0207652_100470384 388
184 3300025932 Ga0207690_10021834 Ga0207690_100218344 388
185 3300025944 Ga0207661_10079764 Ga0207661_100797643 388
186 3300025949 Ga0207667_10201658 Ga0207667_102016582 388
187 3300026067 Ga0207678_10041265 Ga0207678_100412652 388
188 3300028800 Ga0265338_10078557 Ga0265338_100785575 388
189 3300029957 Ga0265324_10013433 Ga0265324_100134332 388
190 3300031251 Ga0265327_10000259 Ga0265327_1000025942 388
191 3300037312 Ga0395899_0039905 Ga0395899_0039905_2221_3432 388
192 3300037312 Ga0395899_0133564 Ga0395899_0133564_108_1316 388
193 3300037418 Ga0395900_0007428 Ga0395900_0007428_120_1331 388
194 3300037418 Ga0395900_0044179 Ga0395900_0044179_887_2098 388
195 3300037418 Ga0395900_0123000 Ga0395900_0123000_1313_2524 388
196 3300037418 Ga0395900_0251031 Ga0395900_0251031_108_1316 388
197 3300037466 Ga0395898_0002001 Ga0395898_0002001_12150_13361 388
198 3300037466 Ga0395898_0003839 Ga0395898_0003839_5852_7063 388
199 3300037466 Ga0395898_0052304 Ga0395898_0052304_948_2159 388
200 3300037466 Ga0395898_0083045 Ga0395898_0083045_455_1663 388
201 3300037471 Ga0395905_0157210 Ga0395905_0157210_563_1774 388
202 3300038443 Ga0395901_0004458 Ga0395901_0004458_5718_6929 388
203 3300038443 Ga0395901_0277438 Ga0395901_0277438_455_1663 388
204 3300038443 Ga0395901_0370648 Ga0395901_0370648_25_1236 388
205 3300047318 Ga0495636_0000037 Ga0495636_0000037_5636_6808 388
206 3300048918 Ga0496115_0015611 Ga0496115_0015611_3575_4744 388
207 3300048918 Ga0496115_0084940 Ga0496115_0084940_631_1803 388
208 3300005336 Ga0070680_100009010 Ga0070680_1000090105 389
209 3300005336 Ga0070680_100032477 Ga0070680_1000324773 389
210 3300005458 Ga0070681_10073510 Ga0070681_100735102 389
211 3300005539 Ga0068853_100041737 Ga0068853_1000417374 389
212 3300005539 Ga0068853_100123954 Ga0068853_1001239542 389
213 3300005543 Ga0070672_100303950 Ga0070672_1003039501 389
214 3300005719 Ga0068861_100121323 Ga0068861_1001213232 389
215 3300006871 Ga0075434_100078349 Ga0075434_1000783493 389
216 3300009174 Ga0105241_10025931 Ga0105241_100259313 389
217 3300010375 Ga0105239_10194085 Ga0105239_101940851 389
218 3300013100 Ga0157373_10024026 Ga0157373_100240265 389
219 3300013102 Ga0157371_10011001 Ga0157371_100110015 389
220 3300013102 Ga0157371_10016343 Ga0157371_100163434 389
221 3300013102 Ga0157371_10027424 Ga0157371_100274242 389
222 3300013102 Ga0157371_10035230 Ga0157371_100352303 389
223 3300013102 Ga0157371_10046863 Ga0157371_100468633 389
224 3300013104 Ga0157370_10007713 Ga0157370_1000771314 389
225 3300013105 Ga0157369_10059731 Ga0157369_100597312 389
226 3300013105 Ga0157369_10327447 Ga0157369_103274472 389
227 3300013307 Ga0157372_10015170 Ga0157372_100151704 389
228 3300021384 Ga0213876_10007954 Ga0213876_100079542 389
229 3300025909 Ga0207705_10021609 Ga0207705_100216092 389
230 3300025909 Ga0207705_10065939 Ga0207705_100659392 389
231 3300025912 Ga0207707_10126207 Ga0207707_101262072 389
232 3300025913 Ga0207695_10013059 Ga0207695_100130595 389
233 3300025917 Ga0207660_10174397 Ga0207660_101743972 389
234 3300025919 Ga0207657_10037079 Ga0207657_100370795 389
235 3300025919 Ga0207657_10070149 Ga0207657_100701492 389
236 3300025921 Ga0207652_10001938 Ga0207652_1000193810 389
237 3300025932 Ga0207690_10033251 Ga0207690_100332512 389
238 3300025940 Ga0207691_10188250 Ga0207691_101882502 389
239 3300025942 Ga0207689_10100502 Ga0207689_101005022 389
240 3300025949 Ga0207667_10038002 Ga0207667_100380023 389
241 3300026041 Ga0207639_10084390 Ga0207639_100843901 389
242 3300026041 Ga0207639_10232013 Ga0207639_102320132 389
243 3300026078 Ga0207702_10180398 Ga0207702_101803982 389
244 3300026116 Ga0207674_10241158 Ga0207674_102411582 389
245 3300026142 Ga0207698_10071001 Ga0207698_100710012 389
246 3300049571 Ga0501034_0023649 Ga0501034_0023649_873_2087 389
247 3300049822 Ga0501035_0037595 Ga0501035_0037595_2425_3639 389
248 3300050512 nmdc:mga0n895_99301_c1 nmdc:mga0n895_99301_c1_1325_2551 389
249 3300003320 rootH2_10008746 rootH2_1000874634 390
250 3300003322 rootL2_10125697 rootL2_101256973 390
251 3300005288 Ga0065714_10073563 Ga0065714_100735633 390
252 3300005289 Ga0065704_10127792 Ga0065704_101277921 390
253 3300005290 Ga0065712_10001958 Ga0065712_100019582 390
254 3300005290 Ga0065712_10005944 Ga0065712_100059441 390
255 3300005293 Ga0065715_10113766 Ga0065715_101137661 390
256 3300005328 Ga0070676_10061331 Ga0070676_100613311 390
257 3300005328 Ga0070676_10130215 Ga0070676_101302151 390
258 3300005330 Ga0070690_100178362 Ga0070690_1001783621 390
259 3300005331 Ga0070670_100031691 Ga0070670_1000316912 390
260 3300005331 Ga0070670_100041730 Ga0070670_1000417302 390
261 3300005334 Ga0068869_100023125 Ga0068869_1000231254 390
262 3300005335 Ga0070666_10082580 Ga0070666_100825801 390
263 3300005337 Ga0070682_100000039 Ga0070682_10000003985 390
264 3300005337 Ga0070682_100041851 Ga0070682_1000418512 390
265 3300005338 Ga0068868_100025378 Ga0068868_1000253785 390
266 3300005338 Ga0068868_100159591 Ga0068868_1001595911 390
267 3300005339 Ga0070660_100200131 Ga0070660_1002001312 390
268 3300005341 Ga0070691_10007417 Ga0070691_100074174 390
269 3300005343 Ga0070687_100028851 Ga0070687_1000288513 390
270 3300005347 Ga0070668_100018964 Ga0070668_1000189642 390
271 3300005353 Ga0070669_100053415 Ga0070669_1000534152 390
272 3300005355 Ga0070671_100013386 Ga0070671_1000133869 390
273 3300005355 Ga0070671_100014761 Ga0070671_1000147617 390
274 3300005356 Ga0070674_100053414 Ga0070674_1000534142 390
275 3300005356 Ga0070674_100055903 Ga0070674_1000559031 390
276 3300005364 Ga0070673_100002623 Ga0070673_1000026238 390
277 3300005364 Ga0070673_100056847 Ga0070673_1000568473 390
278 3300005365 Ga0070688_100046682 Ga0070688_1000466822 390
279 3300005459 Ga0068867_100033289 Ga0068867_1000332891 390
280 3300005459 Ga0068867_100142571 Ga0068867_1001425711 390
281 3300005466 Ga0070685_10056827 Ga0070685_100568272 390
282 3300005466 Ga0070685_10065807 Ga0070685_100658071 390
283 3300005471 Ga0070698_100015685 Ga0070698_1000156855 390
284 3300005471 Ga0070698_100025685 Ga0070698_1000256856 390
285 3300005539 Ga0068853_100043902 Ga0068853_1000439021 390
286 3300005543 Ga0070672_100093178 Ga0070672_1000931785 390
287 3300005543 Ga0070672_100105743 Ga0070672_1001057431 390
288 3300005544 Ga0070686_100096417 Ga0070686_1000964172 390
289 3300005548 Ga0070665_100000001 Ga0070665_100000001511 390
290 3300005548 Ga0070665_100372159 Ga0070665_1003721591 390
291 3300005549 Ga0070704_100059486 Ga0070704_1000594863 390
292 3300005615 Ga0070702_100008256 Ga0070702_1000082561 390
293 3300005617 Ga0068859_100005033 Ga0068859_1000050335 390
294 3300005618 Ga0068864_100036781 Ga0068864_1000367812 390
295 3300005618 Ga0068864_100053004 Ga0068864_1000530042 390
296 3300005618 Ga0068864_100134451 Ga0068864_1001344511 390
297 3300005618 Ga0068864_100217379 Ga0068864_1002173792 390
298 3300005719 Ga0068861_100025507 Ga0068861_1000255074 390
299 3300005834 Ga0068851_10013893 Ga0068851_100138932 390
300 3300005840 Ga0068870_10013779 Ga0068870_100137793 390
301 3300005841 Ga0068863_100014271 Ga0068863_1000142712 390
302 3300005841 Ga0068863_100067931 Ga0068863_1000679312 390
303 3300005842 Ga0068858_100173721 Ga0068858_1001737212 390
304 3300005843 Ga0068860_100000097 Ga0068860_10000009786 390
305 3300005843 Ga0068860_100003825 Ga0068860_10000382512 390
306 3300005843 Ga0068860_100221220 Ga0068860_1002212202 390
307 3300005844 Ga0068862_100311235 Ga0068862_1003112352 390
308 3300006237 Ga0097621_100027982 Ga0097621_1000279824 390
309 3300006237 Ga0097621_100114608 Ga0097621_1001146083 390
310 3300006237 Ga0097621_100223512 Ga0097621_1002235122 390
311 3300006358 Ga0068871_100287537 Ga0068871_1002875372 390
312 3300006844 Ga0075428_100032995 Ga0075428_1000329955 390
313 3300006844 Ga0075428_100104574 Ga0075428_1001045743 390
314 3300006931 Ga0097620_100005033 Ga0097620_1000050335 390
315 3300009098 Ga0105245_10104661 Ga0105245_101046612 390
316 3300009553 Ga0105249_10192373 Ga0105249_101923732 390
317 3300011119 Ga0105246_10092279 Ga0105246_100922792 390
318 3300013297 Ga0157378_10001265 Ga0157378_1000126511 390
319 3300013297 Ga0157378_10001438 Ga0157378_100014383 390
320 3300013297 Ga0157378_10030927 Ga0157378_100309274 390
321 3300013297 Ga0157378_10072264 Ga0157378_100722642 390
322 3300013306 Ga0163162_10003046 Ga0163162_1000304617 390
323 3300013306 Ga0163162_10084256 Ga0163162_100842562 390
324 3300013307 Ga0157372_10033583 Ga0157372_100335832 390
325 3300013308 Ga0157375_10017855 Ga0157375_100178556 390
326 3300013308 Ga0157375_10088193 Ga0157375_100881933 390
327 3300013308 Ga0157375_10148451 Ga0157375_101484514 390
328 3300014325 Ga0163163_10233531 Ga0163163_102335312 390
329 3300014969 Ga0157376_10123108 Ga0157376_101231081 390
330 3300017792 Ga0163161_10207893 Ga0163161_102078931 390
331 3300025321 Ga0207656_10033516 Ga0207656_100335162 390
332 3300025893 Ga0207682_10003812 Ga0207682_100038124 390
333 3300025901 Ga0207688_10128871 Ga0207688_101288711 390
334 3300025907 Ga0207645_10003154 Ga0207645_100031549 390
335 3300025907 Ga0207645_10026076 Ga0207645_100260762 390
336 3300025908 Ga0207643_10009735 Ga0207643_100097352 390
337 3300025912 Ga0207707_10135897 Ga0207707_101358972 390
338 3300025918 Ga0207662_10030383 Ga0207662_100303831 390
339 3300025925 Ga0207650_10017571 Ga0207650_100175712 390
340 3300025925 Ga0207650_10192348 Ga0207650_101923482 390
341 3300025931 Ga0207644_10062163 Ga0207644_100621632 390
342 3300025933 Ga0207706_10041914 Ga0207706_100419142 390
343 3300025933 Ga0207706_10082860 Ga0207706_100828601 390
344 3300025934 Ga0207686_10001882 Ga0207686_100018827 390
345 3300025937 Ga0207669_10054135 Ga0207669_100541352 390
346 3300025940 Ga0207691_10030545 Ga0207691_100305454 390
347 3300025942 Ga0207689_10002113 Ga0207689_1000211311 390
348 3300025942 Ga0207689_10006219 Ga0207689_1000621911 390
349 3300025942 Ga0207689_10015935 Ga0207689_100159354 390
350 3300025942 Ga0207689_10132883 Ga0207689_101328833 390
351 3300025961 Ga0207712_10004159 Ga0207712_100041596 390
352 3300025981 Ga0207640_10006764 Ga0207640_100067645 390
353 3300026023 Ga0207677_10005219 Ga0207677_100052192 390
354 3300026023 Ga0207677_10038904 Ga0207677_100389042 390
355 3300026035 Ga0207703_10243051 Ga0207703_102430511 390
356 3300026088 Ga0207641_10001127 Ga0207641_1000112717 390
357 3300026088 Ga0207641_10023380 Ga0207641_100233803 390
358 3300026089 Ga0207648_10008275 Ga0207648_1000827510 390
359 3300026089 Ga0207648_10111408 Ga0207648_101114081 390
360 3300026089 Ga0207648_10174998 Ga0207648_101749981 390
361 3300026089 Ga0207648_10181736 Ga0207648_101817362 390
362 3300026118 Ga0207675_100022291 Ga0207675_1000222915 390
363 3300026121 Ga0207683_10003508 Ga0207683_100035085 390
364 3300026121 Ga0207683_10060605 Ga0207683_100606052 390
365 3300028379 Ga0268266_10000038 Ga0268266_10000038129 390
366 3300028381 Ga0268264_10000167 Ga0268264_1000016745 390
367 3300028381 Ga0268264_10002971 Ga0268264_100029717 390
368 3300028794 Ga0307515_10000469 Ga0307515_1000046959 390
369 3300030521 Ga0307511_10003942 Ga0307511_100039427 390
370 3300031251 Ga0265327_10000159 Ga0265327_1000015945 390
371 3300031731 Ga0307405_10149182 Ga0307405_101491822 390
372 3300031824 Ga0307413_10125350 Ga0307413_101253501 390
373 3300032126 Ga0307415_100100042 Ga0307415_1001000422 390
374 3300035119 Ga0373956_0098257 Ga0373956_0098257_61_1290 390
375 3300035172 Ga0373955_0016592 Ga0373955_0016592_616_1845 390
376 3300039437 Ga0436365_1207044 Ga0436365_1207044_1359_2594 390
377 3300042125 Ga0450923_004203 Ga0450923_004203_516_1862 390
378 3300046516 Ga0495628_0138045 Ga0495628_0138045_65_1294 390
379 3300047319 Ga0495674_0106602 Ga0495674_0106602_1081_2310 390
380 3300047320 Ga0495672_0029609 Ga0495672_0029609_1332_2564 390
381 3300047320 Ga0495672_0041454 Ga0495672_0041454_1323_2561 390
382 3300047443 Ga0495687_000001 Ga0495687_000001_616893_618251 390
383 3300047471 Ga0495684_0042041 Ga0495684_0042041_415_1644 390
384 3300003323 rootH1_10000182 rootH1_100001827 391
385 3300005354 Ga0070675_100028501 Ga0070675_1000285012 391
386 3300005539 Ga0068853_100073763 Ga0068853_1000737632 391
387 3300005539 Ga0068853_100198969 Ga0068853_1001989692 391
388 3300005539 Ga0068853_100245519 Ga0068853_1002455192 391
389 3300005563 Ga0068855_100003486 Ga0068855_10000348622 391
390 3300005563 Ga0068855_100178574 Ga0068855_1001785742 391
391 3300005577 Ga0068857_100021480 Ga0068857_1000214802 391
392 3300005614 Ga0068856_100250628 Ga0068856_1002506282 391
393 3300005617 Ga0068859_100000536 Ga0068859_1000005366 391
394 3300005841 Ga0068863_100220780 Ga0068863_1002207802 391
395 3300006847 Ga0075431_100017389 Ga0075431_1000173896 391
396 3300006880 Ga0075429_100014460 Ga0075429_1000144605 391
397 3300006931 Ga0097620_100000536 Ga0097620_1000005366 391
398 3300009094 Ga0111539_10264083 Ga0111539_102640831 391
399 3300009094 Ga0111539_10297941 Ga0111539_102979412 391
400 3300009147 Ga0114129_10034640 Ga0114129_100346403 391
401 3300009147 Ga0114129_10043562 Ga0114129_100435622 391
402 3300009174 Ga0105241_10113448 Ga0105241_101134481 391
403 3300010375 Ga0105239_10007449 Ga0105239_100074497 391
404 3300013296 Ga0157374_10329931 Ga0157374_103299312 391
405 3300013297 Ga0157378_10058936 Ga0157378_100589362 391
406 3300025321 Ga0207656_10013578 Ga0207656_100135782 391
407 3300025903 Ga0207680_10016836 Ga0207680_100168363 391
408 3300025907 Ga0207645_10002409 Ga0207645_1000240911 391
409 3300025909 Ga0207705_10013817 Ga0207705_100138173 391
410 3300025933 Ga0207706_10010698 Ga0207706_100106985 391
411 3300025940 Ga0207691_10001190 Ga0207691_1000119013 391
412 3300025949 Ga0207667_10031638 Ga0207667_100316384 391
413 3300025949 Ga0207667_10061754 Ga0207667_100617543 391
414 3300025949 Ga0207667_10184185 Ga0207667_101841852 391
415 3300025972 Ga0207668_10002118 Ga0207668_100021189 391
416 3300025986 Ga0207658_10003810 Ga0207658_100038108 391
417 3300026035 Ga0207703_10002291 Ga0207703_1000229113 391
418 3300026041 Ga0207639_10093160 Ga0207639_100931602 391
419 3300026078 Ga0207702_10099997 Ga0207702_100999971 391
420 3300026089 Ga0207648_10002892 Ga0207648_100028927 391
421 3300026095 Ga0207676_10006139 Ga0207676_100061393 391
422 3300028379 Ga0268266_10029950 Ga0268266_100299504 391
423 3300028794 Ga0307515_10000001 Ga0307515_100000011757 391
424 3300031251 Ga0265327_10031333 Ga0265327_100313332 391
425 3300031507 Ga0307509_10068909 Ga0307509_100689092 391
426 3300031731 Ga0307405_10016358 Ga0307405_100163584 391
427 3300031824 Ga0307413_10002282 Ga0307413_100022826 391
428 3300031852 Ga0307410_10020668 Ga0307410_100206684 391
429 3300031903 Ga0307407_10017021 Ga0307407_100170212 391
430 3300031995 Ga0307409_100015491 Ga0307409_1000154911 391
431 3300031995 Ga0307409_100162971 Ga0307409_1001629712 391
432 3300032004 Ga0307414_10056139 Ga0307414_100561392 391
433 3300032005 Ga0307411_10029620 Ga0307411_100296203 391
434 3300041404 Ga0439436_0001857 Ga0439436_0001857_1823_3049 391
435 3300042014 Ga0439457_002255 Ga0439457_002255_3282_4508 391
436 3300042015 Ga0439462_0002412 Ga0439462_0002412_1588_2814 391
437 3300044658 Ga0466972_0000013 Ga0466972_0000013_222144_223442 391
438 3300044706 Ga0466964_0030828 Ga0466964_0030828_803_2026 391
439 3300044842 Ga0466957_0000578 Ga0466957_0000578_8535_9758 391
440 3300044842 Ga0466957_0007652 Ga0466957_0007652_2252_3475 391
441 3300045049 Ga0466959_0000017 Ga0466959_0000017_87012_88235 391
442 3300046616 Ga0495668_0005253 Ga0495668_0005253_1151_2377 391
443 3300048909 Ga0496106_0047444 Ga0496106_0047444_798_2024 391
444 3300049568 Ga0501031_0074119 Ga0501031_0074119_640_1875 391
445 3300049570 Ga0501033_0198329 Ga0501033_0198329_197_1414 391
446 3300049571 Ga0501034_0127703 Ga0501034_0127703_979_2196 391
447 3300049575 Ga0501039_0061222 Ga0501039_0061222_432_1649 391
448 3300049579 Ga0501043_0010910 Ga0501043_0010910_616_1830 391
449 3300049579 Ga0501043_0061753 Ga0501043_0061753_636_1853 391
450 3300049581 Ga0501047_0089981 Ga0501047_0089981_665_1972 391
451 3300049703 Ga0501219_001225 Ga0501219_001225_383_1609 391
452 3300049705 Ga0501225_0001574 Ga0501225_0001574_396_1622 391
453 3300049822 Ga0501035_0048342 Ga0501035_0048342_1767_2984 391
454 3300049823 Ga0501044_0004256 Ga0501044_0004256_14195_15418 391
455 3300049823 Ga0501044_0028978 Ga0501044_0028978_108_1325 391
456 3300050005 Ga0501284_00055 Ga0501284_00055_7142_8368 391
457 3300050493 nmdc:mga0k408_55793_c1 nmdc:mga0k408_55793_c1_626_1849 391
458 3300050507 nmdc:mga05p37_36468_c1 nmdc:mga05p37_36468_c1_463_1686 391
459 3300053086 Ga0500578_0000628 Ga0500578_0000628_6237_7463 391
460 3300053086 Ga0500578_0025149 Ga0500578_0025149_1149_2561 391
461 3300053092 Ga0500583_0000546 Ga0500583_0000546_9748_10974 391
462 3300053177 Ga0500636_0113753 Ga0500636_0113753_242_1477 391
463 3300053739 Ga0500587_008802 Ga0500587_008802_17_1240 391
464 3300005366 Ga0070659_100024971 Ga0070659_1000249714 392
465 3300025932 Ga0207690_10015768 Ga0207690_100157684 392
466 3300028794 Ga0307515_10000009 Ga0307515_10000009404 392
467 3300028794 Ga0307515_10031785 Ga0307515_100317859 392
468 3300031456 Ga0307513_10101732 Ga0307513_101017322 392
469 3300032004 Ga0307414_10013350 Ga0307414_100133504 392
470 3300042876 Ga0451577_0100440 Ga0451577_0100440_560_1747 392
471 3300044712 Ga0453684_0003241 Ga0453684_0003241_16936_18123 392
472 3300045051 Ga0451576_0001313 Ga0451576_0001313_16848_18035 392
473 3300053092 Ga0500583_0000127 Ga0500583_0000127_14776_16149 392
474 3300002773 JGI25152J39213_1000514 JGI25152J39213_100051416 394
475 3300010375 Ga0105239_10062529 Ga0105239_100625292 394
476 3300013102 Ga0157371_10049156 Ga0157371_100491564 394
477 3300013104 Ga0157370_10078590 Ga0157370_100785902 394
478 3300013297 Ga0157378_10157485 Ga0157378_101574851 394
479 3300015261 Ga0182006_1001324 Ga0182006_10013249 394
480 3300044712 Ga0453684_0331731 Ga0453684_0331731_256_1494 394
481 3300046537 Ga0495598_0031956 Ga0495598_0031956_50_1300 394

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01619

Pro_dh

Proline dehydrogenase

132

445

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
4h6r-assembly1.cif.gz_A structure of reduced deinococcus radiodurans proline dehydrogenase 0.8472 67 370
6ufp-assembly1.cif.gz_B structure of proline utilization a with the fad covalently modified by l-thiazolidine-2-carboxylate and three cysteines (cys46, cys470, cys638) modified to s,s-(2-hydroxyethyl)thiocysteine 0.8452 62 381
7mya-assembly1.cif.gz_A structure of proline utilization a with the fad covalently-modified by 1,3-dithiolane 0.8406 59 372
6x9c-assembly3.cif.gz_B structure of proline utilization a with l-proline bound in the l-glutamate-gamma-semialdehyde dehydrogenase active site 0.8378 62 381
5m42-assembly1.cif.gz_A structure of thermus thermophilus l-proline dehydrogenase lacking alpha helices a, b and c 0.8369 75 355
ID Description Score Start End Superfamily
af_Q86H28_181_547_3.20.20.220 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.9535 50 367 3.20.20.220
af_O45228_332_605_3.20.20.220 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.9449 154 393 3.20.20.220
af_F1QCH4_89_479_3.20.20.220 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.9423 56 393 3.20.20.220
af_Q2V057_59_413_3.20.20.220 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.9269 52 355 3.20.20.220
af_A0A1D6K864_78_458_3.20.20.220 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.921 43 367 3.20.20.220
ID Description Score Start End GO Terms
AF-A0A7C7CDP3-F1-model_v4 Proline dehydrogenase 0.9876 10 393 GO:0004657
GO:0010133
GO:0071949
AF-A0A7V4YXT0-F1-model_v4 Proline dehydrogenase 0.9873 10 394 GO:0004657
GO:0010133
GO:0071949
AF-A0A812RG07-F1-model_v4 deleted 0.9871 184 348
AF-A0A7Y3V4M2-F1-model_v4 Proline dehydrogenase 0.9866 8 393 GO:0004657
GO:0010133
GO:0071949
AF-A0A1V5N5F2-F1-model_v4 Proline dehydrogenase 0.986 130 251 GO:0004657
GO:0010133
GO:0071949

Feature Viewer

pLDDT pTM Quality
88.88 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map