F452486

General Info

Members Datasets Scaffolds Average Seq Length
481 235 962 180

Family's Representative Sequence

Representative Sequence 3300048903|Ga0496100_0006576|Ga0496100_0006576_2802_3404
Length 200
Sequence MTFVLCGAHVVWIRVATPGAKIDAMEHSALAAEVDATCRLSGEFELRSGGRSTEYFDKYLFESNPTLLRHVCQAMVPFIPTNTDLLGGLELGGVPIATVLGQITSLPTVFVRKQAKTYGTCRLAEGADVAGRTVTLIEDVITTGGAVRSAALALRGDGANVSTVVCAIDRRTERGVLDDASIAVFAALTKGDLDDARRRR

Samples

Sample ID Description Type Environment
1 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
21 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
36 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
37 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
38 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
39 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
40 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
41 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
42 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
43 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
44 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
45 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
49 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
50 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
51 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
54 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
57 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
58 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
59 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
60 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
61 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
62 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
63 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
64 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
95 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
96 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
99 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
100 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
101 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
102 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
103 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
104 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
105 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
106 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
107 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
108 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
109 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
110 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
111 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
112 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
113 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
114 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
115 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
116 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
117 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
118 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
119 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
120 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
121 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
122 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
123 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
124 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
125 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
126 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
127 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
128 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
129 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
130 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
131 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
132 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
133 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
134 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
135 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
136 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
137 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
138 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
139 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
140 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
141 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
142 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
143 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
144 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
145 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
146 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
147 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
148 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
149 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
150 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
151 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
152 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
153 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
154 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
155 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
156 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
157 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
158 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
159 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
160 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
161 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
162 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
163 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
164 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
165 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
166 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
167 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
168 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
169 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
170 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
171 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
186 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
187 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
188 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
189 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
190 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
191 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
192 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
193 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
194 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
195 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
196 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
197 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
198 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
199 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
200 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
203 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
204 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
205 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
206 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
207 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
208 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
209 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
210 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
211 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
212 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
213 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
214 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
215 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
216 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
217 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
218 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
219 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
220 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
221 2643221561 Nocardioides sp. Root151 Isolate Unclassified
222 2643221576 Nocardioides sp. Root614 Isolate Unclassified
223 2643221590 Nocardioides sp. Root682 Isolate Unclassified
224 2643221604 Nocardioides sp. Root190 Isolate Unclassified
225 2643221615 Nocardioides sp. Root224 Isolate Unclassified
226 2643221641 Nocardioides sp. Root122 Isolate Unclassified
227 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
228 2643221696 Nocardioides sp. Root140 Isolate Unclassified
229 2738541305 Nocardioides sp. CF167 Isolate Unclassified
230 2739367898 Nocardioides sp. CF479 Isolate Unclassified
231 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
232 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
233 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
234 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
235 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.47
Metatranscriptomes 0.42
Isolates 3.12

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.6
Nodule 0
Rhizoplane 10.19
Rhizosphere 72.14
Stem 0
Stem Tuber 0
Unclassified 2.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496100_0006576 3300048903 Bacteria 6350
2 LJQas_1001054 3300000549 Bacteria 4203
3 JGI24740J21852_10022189 3300001979 Bacteria 2190
4 JGI24739J22299_10068542 3300001989 Bacteria 1107
5 Ga0006562J51391_1018315 3300003578 Bacteria 1932
6 Ga0070658_10028093 3300005327 Bacteria 4516
7 Ga0070683_100105815 3300005329 Bacteria 2652
8 Ga0070683_100313051 3300005329 Bacteria 1494
9 Ga0070683_100651823 3300005329 Bacteria 1008
10 Ga0070683_101504612 3300005329 Bacteria 647
11 Ga0070670_101594512 3300005331 Bacteria 600
12 Ga0070680_100123303 3300005336 Bacteria 2164
13 Ga0070682_100198452 3300005337 Bacteria 1414
14 Ga0070668_100207170 3300005347 Bacteria 1612
15 Ga0070675_101135097 3300005354 Bacteria 719
16 Ga0070674_100342619 3300005356 Bacteria 1205
17 Ga0070659_100570578 3300005366 Bacteria 970
18 Ga0070667_100000308 3300005367 Bacteria 54638
19 Ga0070708_100535191 3300005445 Bacteria 1105
20 Ga0070663_100756690 3300005455 Bacteria 830
21 Ga0070663_101021163 3300005455 Bacteria 720
22 Ga0070681_10114005 3300005458 Bacteria 2642
23 Ga0070679_100082168 3300005530 Bacteria 3212
24 Ga0070672_100163961 3300005543 Bacteria 1846
25 Ga0070686_100240748 3300005544 Bacteria 1317
26 Ga0070686_100343868 3300005544 Bacteria 1119
27 Ga0070665_100178775 3300005548 Bacteria 2123
28 Ga0068855_100934759 3300005563 Bacteria 914
29 Ga0070664_100185124 3300005564 Bacteria 1853
30 Ga0068857_100187355 3300005577 Bacteria 1884
31 Ga0068854_100014462 3300005578 Bacteria 5204
32 Ga0068856_100037126 3300005614 Bacteria 4780
33 Ga0068852_100235633 3300005616 Bacteria 1747
34 Ga0068859_100017785 3300005617 Bacteria 7146
35 Ga0068859_101019888 3300005617 Bacteria 909
36 Ga0068864_100451434 3300005618 Unclassified 1229
37 Ga0068861_100075221 3300005719 Bacteria 2628
38 Ga0068863_100000626 3300005841 Bacteria 35805
39 Ga0068858_100113803 3300005842 Unclassified 2527
40 Ga0068860_100000155 3300005843 Bacteria 111737
41 Ga0081539_10231281 3300005985 Bacteria 834
42 Ga0075365_10001978 3300006038 Bacteria 9687
43 Ga0075365_10020036 3300006038 Bacteria 4139
44 Ga0075365_10080035 3300006038 Bacteria 2211
45 Ga0075365_10104542 3300006038 Bacteria 1942
46 Ga0075365_10116423 3300006038 Bacteria 1840
47 Ga0075365_10203880 3300006038 Bacteria 1386
48 Ga0075365_10266241 3300006038 Bacteria 1205
49 Ga0075365_10354443 3300006038 Bacteria 1034
50 Ga0075365_10583298 3300006038 Bacteria 791
51 Ga0075365_10636411 3300006038 Bacteria 754
52 Ga0075368_10003200 3300006042 Bacteria 5438
53 Ga0075363_100022579 3300006048 Bacteria 3182
54 Ga0075364_10162038 3300006051 Bacteria 1510
55 Ga0075364_10376434 3300006051 Bacteria 968
56 Ga0075364_10427283 3300006051 Bacteria 905
57 Ga0075364_10481180 3300006051 Bacteria 849
58 Ga0075432_10046485 3300006058 Bacteria 1524
59 Ga0075367_10588920 3300006178 Bacteria 707
60 Ga0075369_10060589 3300006186 Bacteria 1651
61 Ga0075370_10006196 3300006353 Bacteria 6002
62 Ga0075370_10092769 3300006353 Bacteria 1743
63 Ga0075370_10110653 3300006353 Bacteria 1595
64 Ga0075370_10511901 3300006353 Bacteria 725
65 Ga0068865_100052204 3300006881 Bacteria 2833
66 Ga0097620_100017784 3300006931 Bacteria 7146
67 Ga0097620_101019954 3300006931 Bacteria 909
68 Ga0111539_10068998 3300009094 Bacteria 4174
69 Ga0111539_11128363 3300009094 Bacteria 911
70 Ga0105245_10003081 3300009098 Bacteria 14922
71 Ga0105245_10448825 3300009098 Bacteria 1298
72 Ga0105245_10571919 3300009098 Bacteria 1154
73 Ga0105245_10716648 3300009098 Bacteria 1034
74 Ga0105245_10974504 3300009098 Bacteria 892
75 Ga0105247_10000040 3300009101 Bacteria 158975
76 Ga0105247_11056047 3300009101 Bacteria 638
77 Ga0105243_10118333 3300009148 Bacteria 2229
78 Ga0105243_10124853 3300009148 Bacteria 2176
79 Ga0105243_10299595 3300009148 Bacteria 1457
80 Ga0105243_10674962 3300009148 Bacteria 1004
81 Ga0105241_11317699 3300009174 Bacteria 688
82 Ga0105242_11075930 3300009176 Bacteria 817
83 Ga0105248_10005695 3300009177 Bacteria 13689
84 Ga0105248_10711767 3300009177 Bacteria 1133
85 Ga0105248_10862218 3300009177 Bacteria 1022
86 Ga0105249_10000069 3300009553 Bacteria 148118
87 Ga0105246_10066734 3300011119 Bacteria 2519
88 Ga0163162_10681348 3300013306 Bacteria 1150
89 Ga0157372_10236523 3300013307 Bacteria 2119
90 Ga0157375_10086241 3300013308 Bacteria 3190
91 Ga0157375_10124219 3300013308 Bacteria 2694
92 Ga0157375_10320097 3300013308 Bacteria 1716
93 Ga0157375_10433564 3300013308 Bacteria 1480
94 Ga0157375_10789774 3300013308 Bacteria 1099
95 Ga0163163_10033002 3300014325 Bacteria 5004
96 Ga0163163_10092971 3300014325 Bacteria 3032
97 Ga0157380_10105327 3300014326 Bacteria 2357
98 Ga0157380_11517995 3300014326 Bacteria 723
99 Ga0157379_10076191 3300014968 Unclassified 3003
100 Ga0157376_10296690 3300014969 Bacteria 1528
101 Ga0163161_10144502 3300017792 Unclassified 1803
102 Ga0163161_10186078 3300017792 Bacteria 1594
103 Ga0163161_10507507 3300017792 Bacteria 983
104 Ga0154015_1277498 3300020610 Bacteria 945
105 Ga0207666_1023925 3300025271 Bacteria 911
106 Ga0207710_10000050 3300025900 Bacteria 186453
107 Ga0207688_10009541 3300025901 Bacteria 5282
108 Ga0207647_10006965 3300025904 Bacteria 8192
109 Ga0207647_10008947 3300025904 Bacteria 7136
110 Ga0207643_10002779 3300025908 Bacteria 9449
111 Ga0207705_10053722 3300025909 Bacteria 2903
112 Ga0207707_10063626 3300025912 Bacteria 3211
113 Ga0207660_10164601 3300025917 Bacteria 1713
114 Ga0207652_10053373 3300025921 Bacteria 3472
115 Ga0207681_10019789 3300025923 Bacteria 4259
116 Ga0207659_10643216 3300025926 Bacteria 906
117 Ga0207687_10494497 3300025927 Bacteria 1020
118 Ga0207709_10135673 3300025935 Bacteria 1684
119 Ga0207709_10347580 3300025935 Bacteria 1118
120 Ga0207704_10049691 3300025938 Bacteria 2525
121 Ga0207691_10281005 3300025940 Bacteria 1432
122 Ga0207711_10000082 3300025941 Bacteria 102386
123 Ga0207661_10028566 3300025944 Bacteria 4273
124 Ga0207661_10074093 3300025944 Bacteria 2790
125 Ga0207661_10297144 3300025944 Bacteria 1447
126 Ga0207661_10433795 3300025944 Bacteria 1195
127 Ga0207679_10183564 3300025945 Bacteria 1733
128 Ga0207667_10682504 3300025949 Bacteria 1030
129 Ga0207712_10000084 3300025961 Bacteria 107789
130 Ga0207712_10235488 3300025961 Bacteria 1472
131 Ga0207668_10780137 3300025972 Bacteria 845
132 Ga0207658_10000868 3300025986 Bacteria 25220
133 Ga0207658_10072974 3300025986 Bacteria 2604
134 Ga0207703_10105056 3300026035 Unclassified 2400
135 Ga0207678_10181318 3300026067 Bacteria 1798
136 Ga0207678_10237205 3300026067 Bacteria 1562
137 Ga0207708_10000622 3300026075 Bacteria 27260
138 Ga0207708_10023252 3300026075 Bacteria 4682
139 Ga0207702_10157601 3300026078 Bacteria 2071
140 Ga0207702_10507601 3300026078 Bacteria 1176
141 Ga0207702_11650345 3300026078 Bacteria 634
142 Ga0207641_10001121 3300026088 Bacteria 26928
143 Ga0207641_11067091 3300026088 Bacteria 806
144 Ga0207676_10432949 3300026095 Unclassified 1236
145 Ga0207674_10065596 3300026116 Bacteria 3658
146 Ga0207683_10416950 3300026121 Bacteria 1236
147 Ga0209813_10006630 3300027866 Bacteria 2866
148 Ga0207428_10080150 3300027907 Bacteria 2551
149 Ga0268266_10097296 3300028379 Unclassified 2588
150 Ga0268264_10000219 3300028381 Bacteria 111751
151 Ga0307408_100440230 3300031548 Bacteria 1128
152 Ga0307408_101477471 3300031548 Bacteria 642
153 Ga0307405_10082830 3300031731 Bacteria 2101
154 Ga0307405_10637956 3300031731 Bacteria 874
155 Ga0307413_10154418 3300031824 Bacteria 1604
156 Ga0307413_10240929 3300031824 Bacteria 1335
157 Ga0307518_10039981 3300031838 Bacteria 3410
158 Ga0307518_10104267 3300031838 Bacteria 2027
159 Ga0307410_10056329 3300031852 Bacteria 2673
160 Ga0307410_11113991 3300031852 Bacteria 685
161 Ga0307406_10162199 3300031901 Bacteria 1608
162 Ga0307407_10020592 3300031903 Bacteria 3384
163 Ga0307407_10043190 3300031903 Bacteria 2533
164 Ga0307407_10115698 3300031903 Bacteria 1691
165 Ga0307409_100054882 3300031995 Bacteria 3072
166 Ga0307409_100161783 3300031995 Bacteria 1959
167 Ga0307409_100222093 3300031995 Bacteria 1706
168 Ga0307409_100331983 3300031995 Bacteria 1427
169 Ga0307416_100034099 3300032002 Bacteria 3869
170 Ga0307416_100052398 3300032002 Bacteria 3267
171 Ga0307416_100359100 3300032002 Bacteria 1478
172 Ga0307416_100549315 3300032002 Bacteria 1228
173 Ga0307416_100858122 3300032002 Bacteria 1006
174 Ga0307416_101702924 3300032002 Bacteria 735
175 Ga0307414_10656155 3300032004 Bacteria 946
176 Ga0307414_10737747 3300032004 Bacteria 894
177 Ga0307411_10433581 3300032005 Bacteria 1095
178 Ga0307415_100274041 3300032126 Bacteria 1384
179 Ga0307415_100449914 3300032126 Bacteria 1113
180 Ga0307415_100722678 3300032126 Bacteria 901
181 Ga0307510_10143204 3300033180 Bacteria 2029
182 Ga0373931_0287863 3300035691 Bacteria 1011
183 Ga0395905_0154422 3300037471 Bacteria 2159
184 Ga0395901_0325312 3300038443 Bacteria 1590
185 Ga0451807_1611573 3300041486 Bacteria 1091
186 Ga0439432_039555 3300042006 Bacteria 1499
187 Ga0450906_044040 3300042145 Bacteria 788
188 Ga0450907_003945 3300042146 Bacteria 2587
189 Ga0439446_0022354 3300042156 Bacteria 1792
190 Ga0466972_0037655 3300044658 Bacteria 2365
191 Ga0466972_0094959 3300044658 Bacteria 1413
192 Ga0466965_0010636 3300044683 Bacteria 4299
193 Ga0466965_0020389 3300044683 Bacteria 3186
194 Ga0466965_0054835 3300044683 Bacteria 1983
195 Ga0466965_0483362 3300044683 Bacteria 693
196 Ga0466966_0061298 3300044684 Bacteria 2373
197 Ga0466961_0042858 3300044693 Bacteria 2900
198 Ga0466961_0054535 3300044693 Bacteria 2549
199 Ga0466961_0129409 3300044693 Bacteria 1582
200 Ga0466961_0134844 3300044693 Bacteria 1547
201 Ga0466963_0012599 3300044694 Bacteria 5180
202 Ga0466963_0063929 3300044694 Bacteria 2464
203 Ga0466963_0065008 3300044694 Bacteria 2445
204 Ga0466963_0284515 3300044694 Bacteria 1162
205 Ga0466964_0007558 3300044706 Bacteria 4066
206 Ga0466964_0205195 3300044706 Bacteria 948
207 Ga0466971_0048648 3300044719 Bacteria 1906
208 Ga0466968_0005187 3300044735 Bacteria 4875
209 Ga0466968_0022232 3300044735 Bacteria 2577
210 Ga0466970_0004233 3300044765 Bacteria 7059
211 Ga0466970_0014851 3300044765 Bacteria 4002
212 Ga0466970_0020683 3300044765 Bacteria 3422
213 Ga0466970_0039149 3300044765 Bacteria 2516
214 Ga0466970_0042684 3300044765 Bacteria 2412
215 Ga0466970_0315767 3300044765 Bacteria 883
216 Ga0466957_0017817 3300044842 Bacteria 4166
217 Ga0466957_0026927 3300044842 Bacteria 3413
218 Ga0466957_0148681 3300044842 Bacteria 1513
219 Ga0466957_0475976 3300044842 Bacteria 863
220 Ga0466960_0000259 3300044901 Bacteria 18187
221 Ga0466960_0076124 3300044901 Bacteria 1680
222 Ga0466960_0112009 3300044901 Bacteria 1419
223 Ga0466960_0227103 3300044901 Bacteria 1029
224 Ga0466960_0475092 3300044901 Bacteria 729
225 Ga0466958_0142686 3300045836 Bacteria 1508
226 Ga0466958_0251133 3300045836 Bacteria 1131
227 Ga0466958_0445298 3300045836 Bacteria 838
228 Ga0466967_0000424 3300045976 Bacteria 20077
229 Ga0466967_0029437 3300045976 Bacteria 4596
230 Ga0466967_0031925 3300045976 Bacteria 4440
231 Ga0466967_0049815 3300045976 Bacteria 3665
232 Ga0466967_0058974 3300045976 Bacteria 3395
233 Ga0466967_0144005 3300045976 Bacteria 2222
234 Ga0495627_007451 3300046453 Bacteria 4189
235 Ga0495603_0027963 3300046455 Bacteria 3401
236 Ga0495590_0293678 3300046457 Bacteria 610
237 Ga0495629_0005735 3300046459 Bacteria 9267
238 Ga0495651_0322318 3300046462 Bacteria 1030
239 Ga0495594_0000231 3300046499 Bacteria 27076
240 Ga0495620_0276672 3300046515 Bacteria 639
241 Ga0495628_0179006 3300046516 Bacteria 1604
242 Ga0495587_0515409 3300046536 Bacteria 661
243 Ga0495622_0089747 3300046557 Bacteria 1412
244 Ga0495667_0500739 3300046559 Bacteria 761
245 Ga0495635_0185385 3300046663 Bacteria 1414
246 Ga0495658_0145765 3300046683 Bacteria 1451
247 Ga0495613_0002157 3300046689 Bacteria 14919
248 Ga0495676_0013770 3300047321 Bacteria 7251
249 Ga0495676_0482729 3300047321 Bacteria 815
250 Ga0496100_0080530 3300048903 Unclassified 2198
251 Ga0496100_0319653 3300048903 Bacteria 1166
252 Ga0496101_0000026 3300048904 Bacteria 199963
253 Ga0496101_0034862 3300048904 Bacteria 3557
254 Ga0496101_0137440 3300048904 Bacteria 1861
255 Ga0496101_0573457 3300048904 Bacteria 892
256 Ga0496101_1127548 3300048904 Bacteria 615
257 Ga0496102_0000716 3300048905 Bacteria 32822
258 Ga0496102_0035410 3300048905 Bacteria 4493
259 Ga0496102_0446296 3300048905 Bacteria 1214
260 Ga0496102_1103451 3300048905 Bacteria 713
261 Ga0496103_0000767 3300048906 Bacteria 23698
262 Ga0496103_0027302 3300048906 Bacteria 3458
263 Ga0496104_0016279 3300048907 Bacteria 6750
264 Ga0496104_0076075 3300048907 Bacteria 3197
265 Ga0496104_1286041 3300048907 Bacteria 635
266 Ga0496105_0173803 3300048908 Bacteria 1765
267 Ga0496105_0283059 3300048908 Bacteria 1336
268 Ga0496105_0432842 3300048908 Bacteria 1040
269 Ga0496106_0041419 3300048909 Bacteria 3451
270 Ga0496106_0587005 3300048909 Bacteria 893
271 Ga0496107_0096712 3300048910 Unclassified 2161
272 Ga0496107_0408352 3300048910 Bacteria 1010
273 Ga0496107_0686805 3300048910 Bacteria 753
274 Ga0496108_0141980 3300048911 Bacteria 2069
275 Ga0496108_0258667 3300048911 Bacteria 1515
276 Ga0496109_0106262 3300048912 Bacteria 2607
277 Ga0496109_0193281 3300048912 Bacteria 1912
278 Ga0496109_0205449 3300048912 Bacteria 1852
279 Ga0496109_0420457 3300048912 Bacteria 1263
280 Ga0496109_1513704 3300048912 Bacteria 606
281 Ga0496110_0073097 3300048913 Bacteria 3043
282 Ga0496110_0279496 3300048913 Bacteria 1520
283 Ga0496110_0547003 3300048913 Bacteria 1052
284 Ga0496110_1220432 3300048913 Bacteria 661
285 Ga0496111_0606056 3300048914 Bacteria 801
286 Ga0496112_0333795 3300048915 Bacteria 1460
287 Ga0496112_1268334 3300048915 Bacteria 653
288 Ga0496113_0078221 3300048916 Bacteria 2531
289 Ga0496113_0315537 3300048916 Bacteria 1253
290 Ga0496113_0443858 3300048916 Bacteria 1042
291 Ga0496114_0003939 3300048917 Bacteria 11447
292 Ga0496114_0006400 3300048917 Bacteria 9276
293 Ga0496114_0041754 3300048917 Bacteria 3802
294 Ga0496114_0077384 3300048917 Bacteria 2805
295 Ga0496114_1051962 3300048917 Bacteria 698
296 Ga0496115_0068297 3300048918 Bacteria 2877
297 Ga0496116_0033405 3300048919 Unclassified 3651
298 Ga0496117_0005894 3300048920 Bacteria 12660
299 Ga0496118_0003018 3300048921 Bacteria 21736
300 Ga0496119_0009557 3300048922 Bacteria 8296
301 Ga0496119_0048449 3300048922 Bacteria 2634
302 Ga0496120_0026057 3300048923 Unclassified 3618
303 Ga0496120_0046081 3300048923 Bacteria 2521
304 Ga0496121_0000056 3300048924 Bacteria 296250
305 Ga0496121_0006255 3300048924 Bacteria 14905
306 Ga0496124_0021498 3300048927 Bacteria 5944
307 Ga0496125_0034747 3300048928 Unclassified 4437
308 Ga0496126_0000089 3300048929 Bacteria 211348
309 Ga0496126_0007060 3300048929 Bacteria 12375
310 Ga0496126_0038610 3300048929 Bacteria 4440
311 Ga0496126_0360389 3300048929 Bacteria 1188
312 Ga0501032_0000686 3300049569 Bacteria 27531
313 Ga0501032_0104231 3300049569 Bacteria 1879
314 Ga0501032_0182529 3300049569 Bacteria 1373
315 Ga0501032_0363338 3300049569 Bacteria 932
316 Ga0501033_0010692 3300049570 Bacteria 7033
317 Ga0501033_0124170 3300049570 Bacteria 1872
318 Ga0501034_0004679 3300049571 Bacteria 15151
319 Ga0501034_0048190 3300049571 Bacteria 4301
320 Ga0501034_0364430 3300049571 Bacteria 1372
321 Ga0501034_0701763 3300049571 Bacteria 910
322 Ga0501036_0002091 3300049572 Bacteria 15569
323 Ga0501036_0020006 3300049572 Bacteria 5619
324 Ga0501036_0065341 3300049572 Bacteria 3080
325 Ga0501036_1249301 3300049572 Bacteria 604
326 Ga0501037_0339310 3300049573 Bacteria 1038
327 Ga0501037_0749115 3300049573 Bacteria 647
328 Ga0501038_0000498 3300049574 Bacteria 34537
329 Ga0501038_0374007 3300049574 Bacteria 1106
330 Ga0501039_0013260 3300049575 Bacteria 6302
331 Ga0501039_0035145 3300049575 Bacteria 3867
332 Ga0501039_0038815 3300049575 Bacteria 3677
333 Ga0501039_0209093 3300049575 Bacteria 1534
334 Ga0501040_0001045 3300049576 Bacteria 17510
335 Ga0501040_0058076 3300049576 Bacteria 2657
336 Ga0501040_0362305 3300049576 Bacteria 1039
337 Ga0501041_0046408 3300049577 Bacteria 2642
338 Ga0501041_0497014 3300049577 Bacteria 776
339 Ga0501041_0647480 3300049577 Bacteria 675
340 Ga0501042_0002602 3300049578 Bacteria 11093
341 Ga0501042_0006911 3300049578 Bacteria 7405
342 Ga0501042_0013340 3300049578 Bacteria 5589
343 Ga0501042_0222562 3300049578 Bacteria 1361
344 Ga0501043_0145438 3300049579 Bacteria 1856
345 Ga0501043_0276463 3300049579 Bacteria 1288
346 Ga0501043_0907396 3300049579 Bacteria 631
347 Ga0501046_0025899 3300049580 Bacteria 4794
348 Ga0501046_0170491 3300049580 Bacteria 1634
349 Ga0501046_0467713 3300049580 Bacteria 905
350 Ga0501047_0000544 3300049581 Bacteria 40681
351 Ga0501047_0022312 3300049581 Bacteria 6080
352 Ga0501047_0082573 3300049581 Bacteria 3088
353 Ga0501047_0086461 3300049581 Bacteria 3013
354 Ga0501048_0002842 3300049582 Bacteria 13220
355 Ga0501048_0011592 3300049582 Bacteria 6573
356 Ga0501048_0255602 3300049582 Bacteria 1244
357 Ga0501048_0307703 3300049582 Bacteria 1128
358 Ga0501067_0000687 3300049583 Bacteria 18200
359 Ga0501067_0001531 3300049583 Bacteria 12597
360 Ga0501067_0001784 3300049583 Bacteria 11826
361 Ga0501067_0045901 3300049583 Bacteria 2425
362 Ga0501067_0107318 3300049583 Bacteria 1552
363 Ga0501067_0499702 3300049583 Bacteria 680
364 Ga0501068_0004886 3300049584 Bacteria 7299
365 Ga0501068_0008042 3300049584 Bacteria 5848
366 Ga0501069_0046467 3300049585 Bacteria 2408
367 Ga0501069_0051106 3300049585 Bacteria 2300
368 Ga0501069_0055151 3300049585 Bacteria 2214
369 Ga0501069_0105051 3300049585 Bacteria 1605
370 Ga0501069_0211307 3300049585 Bacteria 1126
371 Ga0501070_0004128 3300049586 Bacteria 12497
372 Ga0501070_0007413 3300049586 Bacteria 9317
373 Ga0501070_0008589 3300049586 Bacteria 8636
374 Ga0501070_0017588 3300049586 Bacteria 6001
375 Ga0501070_0102006 3300049586 Bacteria 2373
376 Ga0501070_0391731 3300049586 Bacteria 1124
377 Ga0501070_0488076 3300049586 Bacteria 990
378 Ga0501070_1110807 3300049586 Bacteria 609
379 Ga0501071_0018741 3300049587 Bacteria 4798
380 Ga0501071_0037147 3300049587 Bacteria 3477
381 Ga0501071_0084949 3300049587 Bacteria 2320
382 Ga0501072_0050360 3300049588 Bacteria 3279
383 Ga0501072_0058415 3300049588 Bacteria 3040
384 Ga0501072_0213425 3300049588 Bacteria 1538
385 Ga0501073_0001762 3300049589 Bacteria 16086
386 Ga0501073_0095751 3300049589 Bacteria 2061
387 Ga0501074_0000164 3300049590 Bacteria 35412
388 Ga0501074_0002273 3300049590 Bacteria 13362
389 Ga0501074_0002789 3300049590 Bacteria 12223
390 Ga0501074_0024583 3300049590 Bacteria 4378
391 Ga0501074_0134908 3300049590 Bacteria 1766
392 Ga0501074_0262704 3300049590 Bacteria 1227
393 Ga0501075_0614818 3300049591 Bacteria 829
394 Ga0501075_0621850 3300049591 Bacteria 824
395 Ga0501076_0140378 3300049592 Bacteria 1962
396 Ga0501076_0326875 3300049592 Bacteria 1258
397 Ga0501076_0362997 3300049592 Bacteria 1190
398 Ga0501077_0004375 3300049593 Bacteria 8566
399 Ga0501079_0009280 3300049741 Bacteria 7454
400 Ga0501079_0063411 3300049741 Bacteria 2851
401 Ga0501079_0100164 3300049741 Bacteria 2246
402 Ga0501079_0194517 3300049741 Bacteria 1583
403 Ga0501079_0307226 3300049741 Bacteria 1241
404 Ga0501080_0018470 3300049742 Bacteria 6453
405 Ga0501080_0053528 3300049742 Bacteria 3758
406 Ga0501080_0060348 3300049742 Bacteria 3530
407 Ga0501080_0410411 3300049742 Bacteria 1218
408 Ga0501080_0666476 3300049742 Bacteria 920
409 Ga0501081_0128331 3300049743 Bacteria 1810
410 Ga0501081_0678580 3300049743 Bacteria 773
411 Ga0501083_0145547 3300049744 Bacteria 1551
412 Ga0501083_0145573 3300049744 Bacteria 1551
413 Ga0501083_0293928 3300049744 Bacteria 1057
414 Ga0501035_0000870 3300049822 Bacteria 32141
415 Ga0501035_0009824 3300049822 Bacteria 8889
416 Ga0501035_0071540 3300049822 Bacteria 3070
417 Ga0501035_0178077 3300049822 Bacteria 1833
418 Ga0501035_0392391 3300049822 Bacteria 1156
419 Ga0501035_1108213 3300049822 Bacteria 618
420 Ga0501044_0049316 3300049823 Bacteria 4346
421 Ga0501044_0568741 3300049823 Bacteria 1029
422 Ga0501045_0042166 3300049824 Bacteria 3322
423 Ga0501045_0094762 3300049824 Bacteria 2208
424 Ga0501045_0293272 3300049824 Bacteria 1210
425 Ga0501045_0302050 3300049824 Bacteria 1191
426 nmdc:mga03683_19725_c1 3300050489 Bacteria 2577
427 nmdc:mga03n38_167752_c1 3300050490 Bacteria 1116
428 nmdc:mga03n38_175127_c1 3300050490 Bacteria 1095
429 nmdc:mga03n38_21766_c1 3300050490 Bacteria 2585
430 nmdc:mga00v17_275582_c1 3300050491 Bacteria 1092
431 nmdc:mga00v17_414226_c1 3300050491 Bacteria 875
432 nmdc:mga00v17_5313_c1 3300050491 Bacteria 6784
433 nmdc:mga0yw44_104929_c1 3300050492 Bacteria 1805
434 nmdc:mga0yw44_18584_c1 3300050492 Bacteria 3812
435 nmdc:mga0yw44_195468_c1 3300050492 Bacteria 1335
436 nmdc:mga0yw44_266559_c1 3300050492 Bacteria 1142
437 nmdc:mga0yw44_341351_c1 3300050492 Bacteria 1007
438 nmdc:mga0yw44_377050_c1 3300050492 Bacteria 957
439 nmdc:mga0yw44_414707_c1 3300050492 Bacteria 911
440 nmdc:mga0yw44_4678_c1 3300050492 Bacteria 6327
441 nmdc:mga0yw44_487338_c1 3300050492 Bacteria 836
442 nmdc:mga0yw44_567452_c1 3300050492 Bacteria 771
443 nmdc:mga0yw44_817751_c1 3300050492 Bacteria 633
444 nmdc:mga06z11_315657_c1 3300050494 Bacteria 932
445 nmdc:mga06z11_367805_c1 3300050494 Bacteria 862
446 nmdc:mga04h51_54130_c1 3300050495 Bacteria 1356
447 nmdc:mga07m45_13900_c1 3300050496 Bacteria 4279
448 nmdc:mga08y16_176909_c1 3300050511 Bacteria 2216
449 Ga0495595_0019395 3300053084 Bacteria 2950
450 Ga0495595_0156042 3300053084 Bacteria 1125
451 Ga0495595_0377642 3300053084 Bacteria 717
452 Ga0495619_0266847 3300053085 Bacteria 1186
453 Ga0500644_0000201 3300053088 Bacteria 36319
454 Ga0500556_0000514 3300053104 Bacteria 26445
455 Ga0500593_000621 3300053117 Bacteria 13657
456 Ga0500568_0021165 3300053139 Bacteria 2801
457 Ga0500568_0082306 3300053139 Bacteria 1221
458 Ga0500573_0001246 3300053140 Bacteria 12009
459 Ga0501084_0021976 3300054114 Bacteria 5322
460 Ga0501084_0032379 3300054114 Bacteria 4373
461 Ga0501084_0740235 3300054114 Bacteria 828
462 Ga0501082_0014113 3300060353 Bacteria 6874
463 Ga0501082_0408898 3300060353 Bacteria 1184
464 Ga0530510_0181495 3300061734 Bacteria 1561
465 Ga0530510_0186748 3300061734 Bacteria 1538
466 Ga0530510_0244726 3300061734 Bacteria 1336
467 2643825352 2643221561 Bacteria 4984412
468 2643890528 2643221576 Bacteria 5214352
469 2643959584 2643221590 Bacteria 5214697
470 2644032964 2643221604 Bacteria 5014917
471 2644092924 2643221615 Bacteria 5487866
472 2644228337 2643221641 Bacteria 4490190
473 2644322537 2643221657 Bacteria 5490246
474 2644531345 2643221696 Bacteria 5431823
475 2738869429 2738541305 Bacteria 4910150
476 2740165849 2739367898 Bacteria 4367674
477 2774396072 2773857762 Bacteria 5971770
478 2809197712 2808606439 Bacteria 5952208
479 2812347800 2811994878 Bacteria 5992952
480 2855388796 2855386786 Bacteria 4752232
481 2891968791 2891968417 Bacteria 5821697
482 Ga0496100_0006576
483 LJQas_1001054
484 JGI24740J21852_10022189
485 JGI24739J22299_10068542
486 Ga0006562J51391_1018315
487 Ga0070658_10028093
488 Ga0070683_100105815
489 Ga0070683_100313051
490 Ga0070683_100651823
491 Ga0070683_101504612
492 Ga0070670_101594512
493 Ga0070680_100123303
494 Ga0070682_100198452
495 Ga0070668_100207170
496 Ga0070675_101135097
497 Ga0070674_100342619
498 Ga0070659_100570578
499 Ga0070667_100000308
500 Ga0070708_100535191
501 Ga0070663_100756690
502 Ga0070663_101021163
503 Ga0070681_10114005
504 Ga0070679_100082168
505 Ga0070672_100163961
506 Ga0070686_100240748
507 Ga0070686_100343868
508 Ga0070665_100178775
509 Ga0068855_100934759
510 Ga0070664_100185124
511 Ga0068857_100187355
512 Ga0068854_100014462
513 Ga0068856_100037126
514 Ga0068852_100235633
515 Ga0068859_100017785
516 Ga0068859_101019888
517 Ga0068864_100451434
518 Ga0068861_100075221
519 Ga0068863_100000626
520 Ga0068858_100113803
521 Ga0068860_100000155
522 Ga0081539_10231281
523 Ga0075365_10001978
524 Ga0075365_10020036
525 Ga0075365_10080035
526 Ga0075365_10104542
527 Ga0075365_10116423
528 Ga0075365_10203880
529 Ga0075365_10266241
530 Ga0075365_10354443
531 Ga0075365_10583298
532 Ga0075365_10636411
533 Ga0075368_10003200
534 Ga0075363_100022579
535 Ga0075364_10162038
536 Ga0075364_10376434
537 Ga0075364_10427283
538 Ga0075364_10481180
539 Ga0075432_10046485
540 Ga0075367_10588920
541 Ga0075369_10060589
542 Ga0075370_10006196
543 Ga0075370_10092769
544 Ga0075370_10110653
545 Ga0075370_10511901
546 Ga0068865_100052204
547 Ga0097620_100017784
548 Ga0097620_101019954
549 Ga0111539_10068998
550 Ga0111539_11128363
551 Ga0105245_10003081
552 Ga0105245_10448825
553 Ga0105245_10571919
554 Ga0105245_10716648
555 Ga0105245_10974504
556 Ga0105247_10000040
557 Ga0105247_11056047
558 Ga0105243_10118333
559 Ga0105243_10124853
560 Ga0105243_10299595
561 Ga0105243_10674962
562 Ga0105241_11317699
563 Ga0105242_11075930
564 Ga0105248_10005695
565 Ga0105248_10711767
566 Ga0105248_10862218
567 Ga0105249_10000069
568 Ga0105246_10066734
569 Ga0163162_10681348
570 Ga0157372_10236523
571 Ga0157375_10086241
572 Ga0157375_10124219
573 Ga0157375_10320097
574 Ga0157375_10433564
575 Ga0157375_10789774
576 Ga0163163_10033002
577 Ga0163163_10092971
578 Ga0157380_10105327
579 Ga0157380_11517995
580 Ga0157379_10076191
581 Ga0157376_10296690
582 Ga0163161_10144502
583 Ga0163161_10186078
584 Ga0163161_10507507
585 Ga0154015_1277498
586 Ga0207666_1023925
587 Ga0207710_10000050
588 Ga0207688_10009541
589 Ga0207647_10006965
590 Ga0207647_10008947
591 Ga0207643_10002779
592 Ga0207705_10053722
593 Ga0207707_10063626
594 Ga0207660_10164601
595 Ga0207652_10053373
596 Ga0207681_10019789
597 Ga0207659_10643216
598 Ga0207687_10494497
599 Ga0207709_10135673
600 Ga0207709_10347580
601 Ga0207704_10049691
602 Ga0207691_10281005
603 Ga0207711_10000082
604 Ga0207661_10028566
605 Ga0207661_10074093
606 Ga0207661_10297144
607 Ga0207661_10433795
608 Ga0207679_10183564
609 Ga0207667_10682504
610 Ga0207712_10000084
611 Ga0207712_10235488
612 Ga0207668_10780137
613 Ga0207658_10000868
614 Ga0207658_10072974
615 Ga0207703_10105056
616 Ga0207678_10181318
617 Ga0207678_10237205
618 Ga0207708_10000622
619 Ga0207708_10023252
620 Ga0207702_10157601
621 Ga0207702_10507601
622 Ga0207702_11650345
623 Ga0207641_10001121
624 Ga0207641_11067091
625 Ga0207676_10432949
626 Ga0207674_10065596
627 Ga0207683_10416950
628 Ga0209813_10006630
629 Ga0207428_10080150
630 Ga0268266_10097296
631 Ga0268264_10000219
632 Ga0307408_100440230
633 Ga0307408_101477471
634 Ga0307405_10082830
635 Ga0307405_10637956
636 Ga0307413_10154418
637 Ga0307413_10240929
638 Ga0307518_10039981
639 Ga0307518_10104267
640 Ga0307410_10056329
641 Ga0307410_11113991
642 Ga0307406_10162199
643 Ga0307407_10020592
644 Ga0307407_10043190
645 Ga0307407_10115698
646 Ga0307409_100054882
647 Ga0307409_100161783
648 Ga0307409_100222093
649 Ga0307409_100331983
650 Ga0307416_100034099
651 Ga0307416_100052398
652 Ga0307416_100359100
653 Ga0307416_100549315
654 Ga0307416_100858122
655 Ga0307416_101702924
656 Ga0307414_10656155
657 Ga0307414_10737747
658 Ga0307411_10433581
659 Ga0307415_100274041
660 Ga0307415_100449914
661 Ga0307415_100722678
662 Ga0307510_10143204
663 Ga0373931_0287863
664 Ga0395905_0154422
665 Ga0395901_0325312
666 Ga0451807_1611573
667 Ga0439432_039555
668 Ga0450906_044040
669 Ga0450907_003945
670 Ga0439446_0022354
671 Ga0466972_0037655
672 Ga0466972_0094959
673 Ga0466965_0010636
674 Ga0466965_0020389
675 Ga0466965_0054835
676 Ga0466965_0483362
677 Ga0466966_0061298
678 Ga0466961_0042858
679 Ga0466961_0054535
680 Ga0466961_0129409
681 Ga0466961_0134844
682 Ga0466963_0012599
683 Ga0466963_0063929
684 Ga0466963_0065008
685 Ga0466963_0284515
686 Ga0466964_0007558
687 Ga0466964_0205195
688 Ga0466971_0048648
689 Ga0466968_0005187
690 Ga0466968_0022232
691 Ga0466970_0004233
692 Ga0466970_0014851
693 Ga0466970_0020683
694 Ga0466970_0039149
695 Ga0466970_0042684
696 Ga0466970_0315767
697 Ga0466957_0017817
698 Ga0466957_0026927
699 Ga0466957_0148681
700 Ga0466957_0475976
701 Ga0466960_0000259
702 Ga0466960_0076124
703 Ga0466960_0112009
704 Ga0466960_0227103
705 Ga0466960_0475092
706 Ga0466958_0142686
707 Ga0466958_0251133
708 Ga0466958_0445298
709 Ga0466967_0000424
710 Ga0466967_0029437
711 Ga0466967_0031925
712 Ga0466967_0049815
713 Ga0466967_0058974
714 Ga0466967_0144005
715 Ga0495627_007451
716 Ga0495603_0027963
717 Ga0495590_0293678
718 Ga0495629_0005735
719 Ga0495651_0322318
720 Ga0495594_0000231
721 Ga0495620_0276672
722 Ga0495628_0179006
723 Ga0495587_0515409
724 Ga0495622_0089747
725 Ga0495667_0500739
726 Ga0495635_0185385
727 Ga0495658_0145765
728 Ga0495613_0002157
729 Ga0495676_0013770
730 Ga0495676_0482729
731 Ga0496100_0080530
732 Ga0496100_0319653
733 Ga0496101_0000026
734 Ga0496101_0034862
735 Ga0496101_0137440
736 Ga0496101_0573457
737 Ga0496101_1127548
738 Ga0496102_0000716
739 Ga0496102_0035410
740 Ga0496102_0446296
741 Ga0496102_1103451
742 Ga0496103_0000767
743 Ga0496103_0027302
744 Ga0496104_0016279
745 Ga0496104_0076075
746 Ga0496104_1286041
747 Ga0496105_0173803
748 Ga0496105_0283059
749 Ga0496105_0432842
750 Ga0496106_0041419
751 Ga0496106_0587005
752 Ga0496107_0096712
753 Ga0496107_0408352
754 Ga0496107_0686805
755 Ga0496108_0141980
756 Ga0496108_0258667
757 Ga0496109_0106262
758 Ga0496109_0193281
759 Ga0496109_0205449
760 Ga0496109_0420457
761 Ga0496109_1513704
762 Ga0496110_0073097
763 Ga0496110_0279496
764 Ga0496110_0547003
765 Ga0496110_1220432
766 Ga0496111_0606056
767 Ga0496112_0333795
768 Ga0496112_1268334
769 Ga0496113_0078221
770 Ga0496113_0315537
771 Ga0496113_0443858
772 Ga0496114_0003939
773 Ga0496114_0006400
774 Ga0496114_0041754
775 Ga0496114_0077384
776 Ga0496114_1051962
777 Ga0496115_0068297
778 Ga0496116_0033405
779 Ga0496117_0005894
780 Ga0496118_0003018
781 Ga0496119_0009557
782 Ga0496119_0048449
783 Ga0496120_0026057
784 Ga0496120_0046081
785 Ga0496121_0000056
786 Ga0496121_0006255
787 Ga0496124_0021498
788 Ga0496125_0034747
789 Ga0496126_0000089
790 Ga0496126_0007060
791 Ga0496126_0038610
792 Ga0496126_0360389
793 Ga0501032_0000686
794 Ga0501032_0104231
795 Ga0501032_0182529
796 Ga0501032_0363338
797 Ga0501033_0010692
798 Ga0501033_0124170
799 Ga0501034_0004679
800 Ga0501034_0048190
801 Ga0501034_0364430
802 Ga0501034_0701763
803 Ga0501036_0002091
804 Ga0501036_0020006
805 Ga0501036_0065341
806 Ga0501036_1249301
807 Ga0501037_0339310
808 Ga0501037_0749115
809 Ga0501038_0000498
810 Ga0501038_0374007
811 Ga0501039_0013260
812 Ga0501039_0035145
813 Ga0501039_0038815
814 Ga0501039_0209093
815 Ga0501040_0001045
816 Ga0501040_0058076
817 Ga0501040_0362305
818 Ga0501041_0046408
819 Ga0501041_0497014
820 Ga0501041_0647480
821 Ga0501042_0002602
822 Ga0501042_0006911
823 Ga0501042_0013340
824 Ga0501042_0222562
825 Ga0501043_0145438
826 Ga0501043_0276463
827 Ga0501043_0907396
828 Ga0501046_0025899
829 Ga0501046_0170491
830 Ga0501046_0467713
831 Ga0501047_0000544
832 Ga0501047_0022312
833 Ga0501047_0082573
834 Ga0501047_0086461
835 Ga0501048_0002842
836 Ga0501048_0011592
837 Ga0501048_0255602
838 Ga0501048_0307703
839 Ga0501067_0000687
840 Ga0501067_0001531
841 Ga0501067_0001784
842 Ga0501067_0045901
843 Ga0501067_0107318
844 Ga0501067_0499702
845 Ga0501068_0004886
846 Ga0501068_0008042
847 Ga0501069_0046467
848 Ga0501069_0051106
849 Ga0501069_0055151
850 Ga0501069_0105051
851 Ga0501069_0211307
852 Ga0501070_0004128
853 Ga0501070_0007413
854 Ga0501070_0008589
855 Ga0501070_0017588
856 Ga0501070_0102006
857 Ga0501070_0391731
858 Ga0501070_0488076
859 Ga0501070_1110807
860 Ga0501071_0018741
861 Ga0501071_0037147
862 Ga0501071_0084949
863 Ga0501072_0050360
864 Ga0501072_0058415
865 Ga0501072_0213425
866 Ga0501073_0001762
867 Ga0501073_0095751
868 Ga0501074_0000164
869 Ga0501074_0002273
870 Ga0501074_0002789
871 Ga0501074_0024583
872 Ga0501074_0134908
873 Ga0501074_0262704
874 Ga0501075_0614818
875 Ga0501075_0621850
876 Ga0501076_0140378
877 Ga0501076_0326875
878 Ga0501076_0362997
879 Ga0501077_0004375
880 Ga0501079_0009280
881 Ga0501079_0063411
882 Ga0501079_0100164
883 Ga0501079_0194517
884 Ga0501079_0307226
885 Ga0501080_0018470
886 Ga0501080_0053528
887 Ga0501080_0060348
888 Ga0501080_0410411
889 Ga0501080_0666476
890 Ga0501081_0128331
891 Ga0501081_0678580
892 Ga0501083_0145547
893 Ga0501083_0145573
894 Ga0501083_0293928
895 Ga0501035_0000870
896 Ga0501035_0009824
897 Ga0501035_0071540
898 Ga0501035_0178077
899 Ga0501035_0392391
900 Ga0501035_1108213
901 Ga0501044_0049316
902 Ga0501044_0568741
903 Ga0501045_0042166
904 Ga0501045_0094762
905 Ga0501045_0293272
906 Ga0501045_0302050
907 nmdc:mga03683_19725_c1
908 nmdc:mga03n38_167752_c1
909 nmdc:mga03n38_175127_c1
910 nmdc:mga03n38_21766_c1
911 nmdc:mga00v17_275582_c1
912 nmdc:mga00v17_414226_c1
913 nmdc:mga00v17_5313_c1
914 nmdc:mga0yw44_104929_c1
915 nmdc:mga0yw44_18584_c1
916 nmdc:mga0yw44_195468_c1
917 nmdc:mga0yw44_266559_c1
918 nmdc:mga0yw44_341351_c1
919 nmdc:mga0yw44_377050_c1
920 nmdc:mga0yw44_414707_c1
921 nmdc:mga0yw44_4678_c1
922 nmdc:mga0yw44_487338_c1
923 nmdc:mga0yw44_567452_c1
924 nmdc:mga0yw44_817751_c1
925 nmdc:mga06z11_315657_c1
926 nmdc:mga06z11_367805_c1
927 nmdc:mga04h51_54130_c1
928 nmdc:mga07m45_13900_c1
929 nmdc:mga08y16_176909_c1
930 Ga0495595_0019395
931 Ga0495595_0156042
932 Ga0495595_0377642
933 Ga0495619_0266847
934 Ga0500644_0000201
935 Ga0500556_0000514
936 Ga0500593_000621
937 Ga0500568_0021165
938 Ga0500568_0082306
939 Ga0500573_0001246
940 Ga0501084_0021976
941 Ga0501084_0032379
942 Ga0501084_0740235
943 Ga0501082_0014113
944 Ga0501082_0408898
945 Ga0530510_0181495
946 Ga0530510_0186748
947 Ga0530510_0244726
948 2643825352
949 2643890528
950 2643959584
951 2644032964
952 2644092924
953 2644228337
954 2644322537
955 2644531345
956 2738869429
957 2740165849
958 2774396072
959 2809197712
960 2812347800
961 2855388796
962 2891968791

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00156

Pribosyltran

Phosphoribosyl transferase domain

64

189

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
5hkl-assembly1.cif.gz_A crystal structure of mycobacterium tuberculosis h37rv orotate phosphoribosyltransferase in complex with inorganic phosphate 0.8896 11 178
5hki-assembly2.cif.gz_D crystal structure of mycobacterium tuberculosis h37rv orotate phosphoribosyltransferase in complex with fe(iii) dicitrate 0.8822 8 177
5hki-assembly2.cif.gz_C crystal structure of mycobacterium tuberculosis h37rv orotate phosphoribosyltransferase in complex with fe(iii) dicitrate 0.8752 8 177
5hkf-assembly1.cif.gz_A crystal structure of mycobacterium tuberculosis h37rv orotate phosphoribosyltransferase in complex with 5-phospho-alpha-d-ribosyl 1-diphosphate (prpp) 0.8696 8 178
5hki-assembly2.cif.gz_C crystal structure of mycobacterium tuberculosis h37rv orotate phosphoribosyltransferase in complex with fe(iii) dicitrate 0.8608 8 177
ID Description Score Start End Superfamily
af_P09556_2_207_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8808 11 180 3.40.50.2020
5hkiC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8752 8 177 3.40.50.2020
af_A0A1D6N1D3_3_204_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8648 11 180 3.40.50.2020
af_Q58509_1_175_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8637 13 177 3.40.50.2020
5hkiC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8608 8 177 3.40.50.2020
ID Description Score Start End GO Terms
AF-A0A0Q9LRZ6-F1-model_v4 Orotate phosphoribosyltransferase (OPRT) (OPRTase) (EC 2.4.2.10) 0.9886 11 182 GO:0000287
GO:0004588
GO:0019856
GO:0044205
AF-A0A7Y5T589-F1-model_v4 Orotate phosphoribosyltransferase (OPRT) (OPRTase) (EC 2.4.2.10) 0.9881 8 180 GO:0000287
GO:0004588
GO:0019856
GO:0044205
AF-A0A0Q9KFJ5-F1-model_v4 Orotate phosphoribosyltransferase (OPRT) (OPRTase) (EC 2.4.2.10) 0.9864 11 182 GO:0000287
GO:0004588
GO:0019856
GO:0044205
AF-A0A161QWZ0-F1-model_v4 Orotate phosphoribosyltransferase 0.9794 60 156 GO:0004588
GO:0006222
GO:0019856
AF-A0A7Z0SVF8-F1-model_v4 Orotate phosphoribosyltransferase (OPRT) (OPRTase) (EC 2.4.2.10) 0.9761 13 181 GO:0000287
GO:0004588
GO:0019856
GO:0044205

Map