F452471

General Info

Members Datasets Scaffolds Average Seq Length
481 229 962 335

Family's Representative Sequence

Representative Sequence 3300044656|Ga0466969_0031340|Ga0466969_0031340_421_1440
Length 339
Sequence VKVLVTGAAGFIGMHVAQRLLARGDEVVGIDNLNGYYDPALKAARLDVLAREPQAARFQFERLDVADGPALHALFAREGFDRVVHLAAQAGVRYSIENPQAYGEANLAGFLHLLEACRRHPVGHLVYASSSSVYGGNEKRPFSEADSVDHPVSLYAATKKANELMAHTYSHLYGLPTTGLRFFTVYGPWGRPDMAYFSFTRDILAGRPIAVFNEGRMLRDFTYVDDIVDGVVAVLDKPATPDPAFAPLAPNPGTSRAPYRVFNIGNQDPVALGDFIATLERVLGVPAVKDYRPMQPGDVVATHADVSALKAWTGVSPRTPLADGLARFVEWYRRYFDRA

Samples

Sample ID Description Type Environment
1 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
2 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
3 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
4 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
5 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
6 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
7 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
8 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
9 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
10 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
11 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
12 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
18 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
19 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
20 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
21 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
22 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
23 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
24 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
25 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
26 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
27 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
28 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
29 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
30 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
31 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
32 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
33 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
34 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
35 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
36 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
37 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
38 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
39 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
40 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
41 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
42 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
43 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
44 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
45 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
46 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
47 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
48 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
49 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
71 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
72 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
73 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
74 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
75 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
76 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
77 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
78 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
79 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
80 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
81 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
82 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
83 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
84 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
85 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
86 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
87 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
88 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
89 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
90 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
91 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
92 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
93 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
94 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
95 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
96 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
97 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
98 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
99 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
100 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
101 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
102 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
103 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
104 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
105 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
106 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
107 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
108 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
109 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
110 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
111 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
112 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
113 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
114 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
115 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
116 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
117 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
118 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
119 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
120 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
121 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
122 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
123 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
124 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
125 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
126 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
127 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
128 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
129 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
130 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
131 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
132 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
133 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
134 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
135 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
136 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
137 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
138 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
139 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
140 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
141 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
142 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
143 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
144 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
145 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
146 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
147 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
148 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
149 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
150 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
151 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
152 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
153 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
154 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
155 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
156 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
157 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
158 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
159 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
160 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
161 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
162 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
163 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
164 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
165 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
166 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
167 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
168 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
169 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
170 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
171 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
172 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
173 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
174 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
175 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
176 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
177 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
178 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
179 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
180 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
181 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
182 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
183 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
184 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
185 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
186 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
187 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
188 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
189 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
190 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
191 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
192 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
193 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
194 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
195 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
196 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
197 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
198 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
199 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
200 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
201 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
202 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
203 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
204 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
205 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
206 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
207 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
208 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
209 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
210 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
211 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
212 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
213 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
214 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
215 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
216 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
217 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
218 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
219 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
220 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
221 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
222 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
223 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
224 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
225 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
226 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
227 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
228 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
229 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.1
Metatranscriptomes 0
Isolates 7.9

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.07
Nodule 0.83
Rhizoplane 6.24
Rhizosphere 80.25
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466969_0031340 3300044656 Bacteria 2706
2 JGI25156J39149_1000381 3300002705 Bacteria 28024
3 JGI25156J39149_1016262 3300002705 Bacteria 1452
4 JGI25154J39366_1000589 3300002738 Bacteria 17556
5 JGI25157J39369_1000230 3300002741 Bacteria 43900
6 Ga0055539_1000559 3300003752 Bacteria 10776
7 Ga0055539_1001436 3300003752 Bacteria 4454
8 Ga0055533_1000043 3300003756 Bacteria 229262
9 Ga0055525_1000713 3300003759 Bacteria 11803
10 Ga0055535_1000079 3300003761 Bacteria 109482
11 Ga0055529_1000311 3300003763 Bacteria 56033
12 Ga0055530_10000011 3300003791 Bacteria 170218
13 Ga0055540_1000034 3300003792 Bacteria 170218
14 Ga0065714_10002392 3300005288 Bacteria 32693
15 Ga0070676_10087138 3300005328 Bacteria 1905
16 Ga0070668_100162764 3300005347 Bacteria 1811
17 Ga0070678_100171074 3300005456 Bacteria 1769
18 Ga0070684_100034348 3300005535 Bacteria 4336
19 Ga0068857_100001390 3300005577 Bacteria 19084
20 Ga0068854_100031101 3300005578 Bacteria 3708
21 Ga0068856_100003306 3300005614 Bacteria 16388
22 Ga0068870_10068224 3300005840 Bacteria 1931
23 Ga0075370_10079052 3300006353 Bacteria 1889
24 Ga0079104_1000064 3300006946 Bacteria 159242
25 Ga0099826_10018874 3300006948 Bacteria 5192
26 Ga0105251_10000078 3300009011 Bacteria 93496
27 Ga0105244_10008712 3300009036 Bacteria 6314
28 Ga0105250_10002102 3300009092 Bacteria 10226
29 Ga0105243_10105199 3300009148 Bacteria 2350
30 Ga0105238_10011420 3300009551 Bacteria 8945
31 Ga0105239_10010156 3300010375 Bacteria 10550
32 Ga0105246_10038404 3300011119 Bacteria 3219
33 Ga0105246_10333044 3300011119 Bacteria 1238
34 Ga0157373_10001643 3300013100 Bacteria 17075
35 Ga0157373_10006461 3300013100 Bacteria 8750
36 Ga0157371_10040106 3300013102 Bacteria 3346
37 Ga0163162_10006368 3300013306 Bacteria 11429
38 Ga0163162_10016481 3300013306 Bacteria 7219
39 Ga0157375_10013665 3300013308 Bacteria 7237
40 Ga0182006_1021202 3300015261 Bacteria 2712
41 Ga0182005_1014238 3300015265 Bacteria 2227
42 Ga0163161_10000974 3300017792 Bacteria 21894
43 Ga0209674_100067 3300025226 Bacteria 253824
44 Ga0209563_100068 3300025230 Bacteria 254802
45 Ga0207427_100400 3300025231 Bacteria 25445
46 Ga0209258_100129 3300025242 Bacteria 176515
47 Ga0209258_100512 3300025242 Bacteria 37354
48 Ga0209646_1000198 3300025246 Bacteria 72654
49 Ga0209026_1000004 3300025250 Bacteria 949012
50 Ga0209677_100049 3300025253 Bacteria 180721
51 Ga0209677_100079 3300025253 Bacteria 121137
52 Ga0209677_101510 3300025253 Bacteria 9968
53 Ga0209148_1007985 3300025254 Bacteria 2156
54 Ga0209759_1000003 3300025256 Bacteria 792130
55 Ga0209759_1000958 3300025256 Bacteria 20481
56 Ga0209759_1009549 3300025256 Bacteria 2924
57 Ga0209759_1014121 3300025256 Bacteria 2128
58 Ga0209455_1000083 3300025272 Bacteria 255660
59 Ga0209676_1002106 3300025292 Bacteria 15320
60 Ga0209050_1000013 3300025298 Bacteria 811408
61 Ga0209051_1000007 3300025303 Bacteria 811408
62 Ga0209257_1014855 3300025304 Bacteria 3300
63 Ga0207655_1001373 3300025728 Bacteria 22803
64 Ga0207655_1010937 3300025728 Bacteria 5456
65 Ga0207713_1000930 3300025735 Bacteria 26267
66 Ga0207645_10025479 3300025907 Bacteria 3826
67 Ga0207643_10052626 3300025908 Bacteria 2313
68 Ga0207705_10045094 3300025909 Bacteria 3169
69 Ga0207654_10063909 3300025911 Bacteria 2162
70 Ga0207695_10013814 3300025913 Bacteria 9605
71 Ga0207671_10077636 3300025914 Bacteria 2486
72 Ga0207694_10010723 3300025924 Bacteria 6921
73 Ga0207650_10044591 3300025925 Bacteria 3260
74 Ga0207659_10099887 3300025926 Bacteria 2186
75 Ga0207667_10154163 3300025949 Bacteria 2364
76 Ga0207668_10172739 3300025972 Bacteria 1696
77 Ga0207640_10006115 3300025981 Bacteria 6582
78 Ga0207702_10001004 3300026078 Bacteria 28955
79 Ga0207674_10039410 3300026116 Bacteria 4897
80 Ga0207683_10254527 3300026121 Bacteria 1603
81 Ga0207698_10469375 3300026142 Bacteria 1218
82 Ga0209281_1000009 3300027111 Bacteria 771717
83 Ga0209282_1118384 3300027666 Bacteria 1329
84 Ga0265336_10000011 3300028666 Bacteria 275816
85 Ga0265324_10003789 3300029957 Bacteria 7065
86 Ga0307509_10158791 3300031507 Bacteria 2163
87 Ga0307408_100000145 3300031548 Bacteria 79041
88 Ga0307408_100014611 3300031548 Bacteria 5217
89 Ga0307516_10000461 3300031730 Bacteria 53797
90 Ga0307405_10024177 3300031731 Bacteria 3466
91 Ga0307412_10000393 3300031911 Bacteria 26995
92 Ga0307412_10000636 3300031911 Bacteria 20459
93 Ga0307414_10223199 3300032004 Bacteria 1548
94 Ga0307411_10074531 3300032005 Bacteria 2313
95 Ga0373934_0027743 3300035086 Bacteria 2202
96 Ga0395899_0000086 3300037312 Bacteria 157725
97 Ga0395899_0165543 3300037312 Bacteria 1560
98 Ga0395900_0027412 3300037418 Bacteria 5835
99 Ga0395900_0251228 3300037418 Bacteria 1770
100 Ga0395905_0129594 3300037471 Bacteria 2372
101 Ga0395901_0007003 3300038443 Bacteria 11397
102 Ga0395901_0119623 3300038443 Bacteria 2768
103 Ga0439451_008001 3300042009 Bacteria 2145
104 Ga0439456_012076 3300042013 Bacteria 1790
105 Ga0439463_010755 3300042016 Bacteria 2249
106 Ga0439463_017283 3300042016 Bacteria 1788
107 Ga0450906_011698 3300042145 Bacteria 1638
108 Ga0466966_0006043 3300044684 Bacteria 7995
109 Ga0466961_0039517 3300044693 Bacteria 3024
110 Ga0466971_0002560 3300044719 Bacteria 7686
111 Ga0466968_0013608 3300044735 Bacteria 3200
112 Ga0466957_0058451 3300044842 Bacteria 2362
113 Ga0466967_0017496 3300045976 Bacteria 5694
114 Ga0466967_0051262 3300045976 Bacteria 3616
115 Ga0466967_0375120 3300045976 Bacteria 1380
116 Ga0495617_000063 3300046452 Bacteria 95793
117 Ga0495617_025852 3300046452 Bacteria 1978
118 Ga0495627_000323 3300046453 Bacteria 46699
119 Ga0495627_003505 3300046453 Bacteria 6881
120 Ga0495603_0011873 3300046455 Bacteria 5270
121 Ga0495603_0056179 3300046455 Bacteria 2331
122 Ga0495603_0074133 3300046455 Bacteria 1998
123 Ga0495590_0000008 3300046457 Bacteria 330520
124 Ga0495590_0012860 3300046457 Bacteria 3090
125 Ga0495591_000051 3300046458 Bacteria 137457
126 Ga0495591_000323 3300046458 Bacteria 43207
127 Ga0495591_001200 3300046458 Bacteria 16876
128 Ga0495591_001635 3300046458 Bacteria 13524
129 Ga0495629_0061718 3300046459 Bacteria 2619
130 Ga0495650_0007956 3300046471 Bacteria 6278
131 Ga0495650_0037781 3300046471 Bacteria 2098
132 Ga0495580_0068272 3300046472 Bacteria 2486
133 Ga0495582_0002152 3300046473 Bacteria 11017
134 Ga0495605_0000049 3300046474 Bacteria 166669
135 Ga0495605_0000185 3300046474 Bacteria 77613
136 Ga0495605_0004734 3300046474 Bacteria 7956
137 Ga0495605_0007020 3300046474 Bacteria 6427
138 Ga0495605_0007431 3300046474 Bacteria 6218
139 Ga0495605_0011862 3300046474 Bacteria 4847
140 Ga0495605_0018379 3300046474 Bacteria 3748
141 Ga0495584_0000024 3300046491 Bacteria 117259
142 Ga0495584_0007555 3300046491 Bacteria 5666
143 Ga0495584_0008400 3300046491 Bacteria 5347
144 Ga0495584_0021955 3300046491 Bacteria 3240
145 Ga0495584_0023710 3300046491 Bacteria 3111
146 Ga0495584_0029212 3300046491 Bacteria 2794
147 Ga0495584_0090763 3300046491 Bacteria 1541
148 Ga0495585_0000040 3300046492 Bacteria 130615
149 Ga0495585_0000233 3300046492 Bacteria 57350
150 Ga0495585_0000385 3300046492 Bacteria 42521
151 Ga0495585_0005897 3300046492 Bacteria 7668
152 Ga0495585_0025322 3300046492 Bacteria 3400
153 Ga0495585_0037680 3300046492 Bacteria 2722
154 Ga0495585_0038807 3300046492 Bacteria 2679
155 Ga0495585_0049348 3300046492 Bacteria 2337
156 Ga0495585_0060519 3300046492 Bacteria 2083
157 Ga0495585_0158316 3300046492 Bacteria 1176
158 Ga0495594_0001143 3300046499 Bacteria 13853
159 Ga0495594_0038257 3300046499 Bacteria 2619
160 Ga0495594_0074894 3300046499 Bacteria 1886
161 Ga0495596_0000106 3300046500 Bacteria 59325
162 Ga0495596_0001319 3300046500 Bacteria 14292
163 Ga0495596_0001825 3300046500 Bacteria 11815
164 Ga0495596_0012704 3300046500 Bacteria 3594
165 Ga0495596_0016148 3300046500 Bacteria 3107
166 Ga0495596_0089202 3300046500 Bacteria 1196
167 Ga0495607_0000210 3300046501 Bacteria 62298
168 Ga0495607_0002038 3300046501 Bacteria 16919
169 Ga0495607_0003153 3300046501 Bacteria 12777
170 Ga0495607_0009285 3300046501 Bacteria 6671
171 Ga0495607_0016175 3300046501 Bacteria 4817
172 Ga0495607_0016989 3300046501 Bacteria 4684
173 Ga0495607_0027110 3300046501 Bacteria 3548
174 Ga0495583_0000738 3300046506 Bacteria 41545
175 Ga0495583_0000798 3300046506 Bacteria 38957
176 Ga0495583_0001347 3300046506 Bacteria 25452
177 Ga0495583_0005813 3300046506 Bacteria 8238
178 Ga0495583_0008477 3300046506 Bacteria 6276
179 Ga0495583_0022652 3300046506 Bacteria 3198
180 Ga0495583_0033549 3300046506 Bacteria 2468
181 Ga0495583_0070749 3300046506 Bacteria 1533
182 Ga0495606_0000098 3300046507 Bacteria 151131
183 Ga0495606_0000157 3300046507 Bacteria 118620
184 Ga0495606_0001131 3300046507 Bacteria 38024
185 Ga0495606_0008977 3300046507 Bacteria 8552
186 Ga0495606_0030541 3300046507 Bacteria 3764
187 Ga0495606_0074129 3300046507 Bacteria 2133
188 Ga0495606_0078564 3300046507 Bacteria 2058
189 Ga0495606_0128342 3300046507 Bacteria 1510
190 Ga0495610_0000849 3300046512 Bacteria 28464
191 Ga0495610_0056104 3300046512 Bacteria 1896
192 Ga0495616_0000902 3300046513 Bacteria 21420
193 Ga0495616_0014955 3300046513 Bacteria 4327
194 Ga0495616_0016036 3300046513 Bacteria 4153
195 Ga0495616_0017239 3300046513 Bacteria 3984
196 Ga0495616_0030839 3300046513 Bacteria 2812
197 Ga0495616_0037855 3300046513 Bacteria 2478
198 Ga0495616_0064758 3300046513 Bacteria 1783
199 Ga0495620_0003064 3300046515 Bacteria 9596
200 Ga0495631_0003210 3300046518 Bacteria 9004
201 Ga0495631_0005808 3300046518 Bacteria 6435
202 Ga0495631_0007084 3300046518 Bacteria 5733
203 Ga0495631_0007808 3300046518 Bacteria 5424
204 Ga0495631_0011376 3300046518 Bacteria 4377
205 Ga0495631_0017141 3300046518 Bacteria 3432
206 Ga0495631_0027748 3300046518 Bacteria 2587
207 Ga0495631_0027775 3300046518 Bacteria 2585
208 Ga0495631_0032215 3300046518 Bacteria 2364
209 Ga0495631_0054365 3300046518 Bacteria 1746
210 Ga0495632_0000057 3300046519 Bacteria 123635
211 Ga0495632_0000201 3300046519 Bacteria 60697
212 Ga0495632_0042780 3300046519 Bacteria 2268
213 Ga0495632_0074921 3300046519 Bacteria 1620
214 Ga0495637_0000009 3300046520 Bacteria 402028
215 Ga0495637_0000181 3300046520 Bacteria 48899
216 Ga0495643_0028039 3300046522 Bacteria 3160
217 Ga0495643_0031815 3300046522 Bacteria 2933
218 Ga0495644_0003278 3300046523 Bacteria 6400
219 Ga0495644_0003686 3300046523 Bacteria 6028
220 Ga0495644_0007939 3300046523 Bacteria 4085
221 Ga0495644_0008129 3300046523 Bacteria 4036
222 Ga0495644_0015942 3300046523 Bacteria 2879
223 Ga0495644_0017824 3300046523 Bacteria 2712
224 Ga0495648_0000883 3300046524 Bacteria 31505
225 Ga0495648_0002639 3300046524 Bacteria 16286
226 Ga0495648_0016587 3300046524 Bacteria 5305
227 Ga0495648_0041743 3300046524 Bacteria 2893
228 Ga0495648_0118798 3300046524 Bacteria 1425
229 Ga0495663_0004872 3300046525 Bacteria 3751
230 Ga0495666_0000267 3300046526 Bacteria 22575
231 Ga0495666_0011516 3300046526 Bacteria 4410
232 Ga0495666_0016293 3300046526 Bacteria 3701
233 Ga0495642_0000012 3300046528 Bacteria 127229
234 Ga0495642_0001871 3300046528 Bacteria 8987
235 Ga0495642_0005427 3300046528 Bacteria 4898
236 Ga0495642_0006774 3300046528 Bacteria 4392
237 Ga0495642_0016155 3300046528 Bacteria 2908
238 Ga0495642_0024915 3300046528 Bacteria 2368
239 Ga0495642_0047315 3300046528 Bacteria 1761
240 Ga0495652_0298835 3300046529 Bacteria 1171
241 Ga0495654_0000367 3300046530 Bacteria 39116
242 Ga0495654_0049438 3300046530 Bacteria 2060
243 Ga0495654_0063678 3300046530 Bacteria 1765
244 Ga0495665_0006202 3300046531 Bacteria 6455
245 Ga0495640_0068112 3300046533 Bacteria 2396
246 Ga0495640_0105124 3300046533 Bacteria 1850
247 Ga0495586_0011048 3300046535 Bacteria 4796
248 Ga0495609_0000035 3300046538 Bacteria 196269
249 Ga0495609_0001427 3300046538 Bacteria 15913
250 Ga0495609_0016448 3300046538 Bacteria 3446
251 Ga0495609_0038534 3300046538 Bacteria 2154
252 Ga0495597_0000009 3300046542 Bacteria 227319
253 Ga0495597_0000335 3300046542 Bacteria 42105
254 Ga0495597_0002626 3300046542 Bacteria 11180
255 Ga0495597_0011888 3300046542 Bacteria 4211
256 Ga0495597_0012610 3300046542 Bacteria 4072
257 Ga0495597_0017760 3300046542 Bacteria 3342
258 Ga0495597_0093214 3300046542 Bacteria 1276
259 Ga0495597_0118229 3300046542 Bacteria 1106
260 Ga0495622_0001765 3300046557 Bacteria 10673
261 Ga0495622_0004134 3300046557 Bacteria 6768
262 Ga0495622_0015117 3300046557 Bacteria 3588
263 Ga0495622_0031397 3300046557 Bacteria 2482
264 Ga0495622_0068174 3300046557 Bacteria 1643
265 Ga0495622_0120587 3300046557 Bacteria 1197
266 Ga0495633_0000549 3300046558 Bacteria 37046
267 Ga0495633_0001135 3300046558 Bacteria 21402
268 Ga0495633_0006859 3300046558 Bacteria 6669
269 Ga0495656_0004163 3300046615 Bacteria 4933
270 Ga0495656_0006342 3300046615 Bacteria 4146
271 Ga0495656_0071876 3300046615 Bacteria 1539
272 Ga0495668_0000180 3300046616 Bacteria 94157
273 Ga0495668_0000429 3300046616 Bacteria 54505
274 Ga0495668_0004145 3300046616 Bacteria 10474
275 Ga0495668_0008512 3300046616 Bacteria 6392
276 Ga0495668_0049870 3300046616 Bacteria 2321
277 Ga0495668_0053731 3300046616 Bacteria 2226
278 Ga0495668_0057024 3300046616 Bacteria 2155
279 Ga0495668_0078091 3300046616 Bacteria 1817
280 Ga0495668_0079859 3300046616 Bacteria 1795
281 Ga0495611_0000013 3300046648 Bacteria 130500
282 Ga0495611_0000437 3300046648 Bacteria 25695
283 Ga0495611_0001498 3300046648 Bacteria 11585
284 Ga0495611_0023298 3300046648 Bacteria 2685
285 Ga0495611_0034354 3300046648 Bacteria 2241
286 Ga0495611_0064052 3300046648 Bacteria 1673
287 Ga0495625_0000004 3300046660 Bacteria 611314
288 Ga0495625_0009670 3300046660 Bacteria 8036
289 Ga0495625_0035308 3300046660 Bacteria 3686
290 Ga0495625_0079760 3300046660 Bacteria 2281
291 Ga0495625_0093201 3300046660 Bacteria 2080
292 Ga0495625_0196226 3300046660 Bacteria 1334
293 Ga0495635_0041134 3300046663 Bacteria 3193
294 Ga0495659_0047685 3300046664 Bacteria 1550
295 Ga0495661_0000041 3300046665 Bacteria 151138
296 Ga0495661_0000148 3300046665 Bacteria 81610
297 Ga0495661_0002006 3300046665 Bacteria 16048
298 Ga0495661_0006697 3300046665 Bacteria 8090
299 Ga0495661_0018004 3300046665 Bacteria 4653
300 Ga0495661_0019213 3300046665 Bacteria 4482
301 Ga0495661_0020695 3300046665 Bacteria 4292
302 Ga0495661_0028950 3300046665 Bacteria 3539
303 Ga0495661_0032467 3300046665 Bacteria 3300
304 Ga0495661_0073645 3300046665 Bacteria 1989
305 Ga0495661_0080036 3300046665 Bacteria 1886
306 Ga0495588_0002737 3300046674 Bacteria 7562
307 Ga0495588_0019759 3300046674 Bacteria 3304
308 Ga0495588_0061470 3300046674 Bacteria 1945
309 Ga0495588_0068328 3300046674 Bacteria 1845
310 Ga0495588_0132807 3300046674 Bacteria 1313
311 Ga0495669_0000017 3300046684 Bacteria 131447
312 Ga0495669_0002031 3300046684 Bacteria 8296
313 Ga0495669_0005964 3300046684 Bacteria 5081
314 Ga0495669_0010468 3300046684 Bacteria 3920
315 Ga0495669_0030295 3300046684 Bacteria 2375
316 Ga0495613_0120587 3300046689 Bacteria 1883
317 Ga0495624_0006051 3300046690 Bacteria 8629
318 Ga0495670_0000122 3300046691 Bacteria 33678
319 Ga0495670_0005151 3300046691 Bacteria 6429
320 Ga0495670_0011675 3300046691 Bacteria 4323
321 Ga0495670_0013354 3300046691 Bacteria 4040
322 Ga0495670_0024933 3300046691 Bacteria 2957
323 Ga0495670_0042386 3300046691 Bacteria 2270
324 Ga0495670_0042825 3300046691 Bacteria 2259
325 Ga0495670_0174426 3300046691 Bacteria 1133
326 Ga0495670_0180205 3300046691 Bacteria 1115
327 Ga0495671_0000140 3300046692 Bacteria 63602
328 Ga0495671_0003694 3300046692 Bacteria 9312
329 Ga0495671_0016513 3300046692 Bacteria 3940
330 Ga0495671_0075335 3300046692 Bacteria 1655
331 Ga0495649_0000062 3300046694 Bacteria 96596
332 Ga0495649_0014752 3300046694 Bacteria 4467
333 Ga0495589_0000102 3300046794 Bacteria 82380
334 Ga0495589_0001543 3300046794 Bacteria 13280
335 Ga0495589_0005590 3300046794 Bacteria 6629
336 Ga0495589_0019227 3300046794 Bacteria 3504
337 Ga0495589_0073988 3300046794 Bacteria 1662
338 Ga0495589_0077161 3300046794 Bacteria 1623
339 Ga0495660_0008513 3300046810 Bacteria 6006
340 Ga0495660_0034527 3300046810 Bacteria 2830
341 Ga0495581_0027407 3300047315 Bacteria 3304
342 Ga0495581_0050828 3300047315 Bacteria 2394
343 Ga0495604_0018357 3300047317 Bacteria 5602
344 Ga0495604_0048901 3300047317 Bacteria 3288
345 Ga0495604_0153973 3300047317 Bacteria 1630
346 Ga0495636_0004365 3300047318 Bacteria 5548
347 Ga0495636_0053786 3300047318 Bacteria 1691
348 Ga0495636_0066086 3300047318 Bacteria 1537
349 Ga0495674_0002798 3300047319 Bacteria 16935
350 Ga0495674_0049277 3300047319 Bacteria 3723
351 Ga0495672_0000231 3300047320 Bacteria 79748
352 Ga0495672_0066071 3300047320 Bacteria 2065
353 Ga0495672_0108588 3300047320 Bacteria 1492
354 Ga0495676_0000017 3300047321 Bacteria 181815
355 Ga0495676_0000023 3300047321 Bacteria 156478
356 Ga0495676_0020318 3300047321 Bacteria 5830
357 Ga0495676_0027485 3300047321 Bacteria 4876
358 Ga0495680_0006458 3300047322 Bacteria 10889
359 Ga0495683_0000222 3300047323 Bacteria 53417
360 Ga0495683_0016333 3300047323 Bacteria 3856
361 Ga0495683_0019608 3300047323 Bacteria 3490
362 Ga0495683_0100417 3300047323 Bacteria 1391
363 Ga0495687_002491 3300047443 Bacteria 14686
364 Ga0495675_0021917 3300047444 Bacteria 4070
365 Ga0495675_0051644 3300047444 Bacteria 2610
366 Ga0495675_0096046 3300047444 Bacteria 1858
367 Ga0495677_0000829 3300047445 Bacteria 12482
368 Ga0495677_0002275 3300047445 Bacteria 7579
369 Ga0495677_0012842 3300047445 Bacteria 3051
370 Ga0495677_0019784 3300047445 Bacteria 2440
371 Ga0495677_0019825 3300047445 Bacteria 2438
372 Ga0495677_0020682 3300047445 Bacteria 2385
373 Ga0495677_0031318 3300047445 Bacteria 1936
374 Ga0495679_000256 3300047446 Bacteria 44090
375 Ga0495679_006780 3300047446 Bacteria 4874
376 Ga0495679_016019 3300047446 Bacteria 2723
377 Ga0495685_007648 3300047447 Bacteria 3572
378 Ga0495673_0001644 3300047469 Bacteria 17248
379 Ga0495673_0007740 3300047469 Bacteria 6134
380 Ga0495673_0048566 3300047469 Bacteria 1870
381 Ga0495681_0000018 3300047470 Bacteria 177306
382 Ga0495681_0010880 3300047470 Bacteria 5471
383 Ga0495681_0014216 3300047470 Bacteria 4577
384 Ga0495681_0014970 3300047470 Bacteria 4414
385 Ga0495681_0030836 3300047470 Bacteria 2724
386 Ga0495681_0048977 3300047470 Bacteria 2000
387 Ga0495681_0054143 3300047470 Bacteria 1876
388 Ga0495686_0018207 3300047472 Bacteria 4718
389 Ga0495686_0028464 3300047472 Bacteria 3639
390 Ga0495686_0028571 3300047472 Bacteria 3631
391 Ga0495593_0020371 3300047673 Bacteria 3714
392 Ga0495593_0024110 3300047673 Bacteria 3375
393 Ga0495602_0040984 3300048088 Bacteria 4235
394 Ga0495614_0005411 3300048089 Bacteria 5758
395 Ga0495614_0008067 3300048089 Bacteria 4679
396 Ga0495626_0000213 3300048091 Bacteria 69180
397 Ga0495626_0004278 3300048091 Bacteria 8812
398 Ga0495626_0010046 3300048091 Bacteria 5078
399 Ga0495626_0015265 3300048091 Bacteria 3937
400 Ga0495626_0015299 3300048091 Bacteria 3933
401 Ga0495626_0033017 3300048091 Bacteria 2481
402 Ga0495626_0033975 3300048091 Bacteria 2441
403 Ga0495626_0084308 3300048091 Bacteria 1406
404 Ga0496102_0000151 3300048905 Bacteria 94403
405 Ga0496102_0347913 3300048905 Bacteria 1396
406 Ga0496103_0030283 3300048906 Bacteria 3293
407 Ga0496110_0021580 3300048913 Bacteria 5456
408 Ga0496115_0064571 3300048918 Bacteria 2955
409 Ga0496115_0160260 3300048918 Bacteria 1859
410 Ga0496115_0384405 3300048918 Bacteria 1141
411 Ga0496118_0032116 3300048921 Bacteria 4335
412 Ga0496121_0000715 3300048924 Bacteria 61599
413 Ga0496121_0005373 3300048924 Bacteria 16466
414 Ga0496121_0150830 3300048924 Bacteria 1711
415 Ga0496122_0002634 3300048925 Bacteria 25082
416 Ga0496122_0009730 3300048925 Bacteria 10048
417 Ga0496123_0000170 3300048926 Bacteria 130815
418 Ga0496124_0002162 3300048927 Bacteria 26364
419 Ga0496124_0023336 3300048927 Bacteria 5649
420 Ga0496124_0041032 3300048927 Bacteria 3998
421 Ga0496124_0134842 3300048927 Bacteria 1956
422 Ga0496126_0044838 3300048929 Bacteria 4069
423 Ga0495678_000092 3300049459 Bacteria 114501
424 Ga0495678_000100 3300049459 Bacteria 106118
425 Ga0495678_000286 3300049459 Bacteria 55456
426 Ga0495678_000705 3300049459 Bacteria 30390
427 Ga0495678_053545 3300049459 Bacteria 1548
428 Ga0495682_0000066 3300049460 Bacteria 97829
429 Ga0495682_0000560 3300049460 Bacteria 25464
430 Ga0495682_0026317 3300049460 Bacteria 2160
431 Ga0501269_002576 3300049766 Bacteria 2226
432 Ga0501226_003963 3300049853 Bacteria 1732
433 nmdc:mga07m45_988_c1 3300050496 Bacteria 12534
434 Ga0500635_0000065 3300053080 Bacteria 69362
435 Ga0500635_0023528 3300053080 Bacteria 1923
436 Ga0500566_0012048 3300053094 Bacteria 5093
437 Ga0500595_000321 3300053119 Bacteria 31508
438 Ga0500595_005993 3300053119 Bacteria 5227
439 Ga0500559_0044771 3300053136 Bacteria 1937
440 Ga0500603_000825 3300053150 Bacteria 7413
441 Ga0500603_010420 3300053150 Bacteria 2099
442 Ga0500638_000125 3300053162 Bacteria 14917
443 Ga0500661_000258 3300055283 Bacteria 9566
444 2511824832 2511231156 Bacteria 6845832
445 2599612426 2599185212 Bacteria 6765997
446 2599885208 2599185289 Bacteria 6778765
447 2599898875 2599185291 Bacteria 6775623
448 2599959861 2599185305 Bacteria 6748700
449 2599967030 2599185306 Bacteria 6637356
450 2599973128 2599185307 Bacteria 6194719
451 2599978375 2599185308 Bacteria 6621546
452 2599993594 2599185311 Bacteria 6354990
453 2600006239 2599185313 Bacteria 6658188
454 2600012542 2599185314 Bacteria 6621749
455 2600016369 2599185315 Bacteria 6771107
456 2600024576 2599185316 Bacteria 6320029
457 2600032397 2599185317 Bacteria 6435722
458 2600035038 2599185318 Bacteria 6961590
459 2600040682 2599185319 Bacteria 6637840
460 2600051575 2599185321 Bacteria 6764560
461 2600059293 2599185322 Bacteria 6763055
462 2600063019 2599185323 Bacteria 6688755
463 2600072645 2599185324 Bacteria 6590677
464 2600079271 2599185325 Bacteria 6324919
465 2600361959 2600254930 Bacteria 6431253
466 2644284388 2643221650 Bacteria 7029547
467 2652543610 2651869719 Bacteria 6047974
468 2671091695 2667528170 Bacteria 6786960
469 2671126562 2667528176 Bacteria 6724917
470 2808857931 2808606361 Bacteria 6136259
471 2808922451 2808606376 Bacteria 6248667
472 2808938122 2808606378 Bacteria 6177535
473 2808948480 2808606380 Bacteria 6248705
474 2808966374 2808606383 Bacteria 6138645
475 2808996869 2808606389 Bacteria 6138126
476 2825651684 2825651385 Bacteria 6715909
477 2842858256 2842854478 Bacteria 6143501
478 2913039735 2913036834 Bacteria 6704877
479 2988728922 2988728565 Bacteria 6124362
480 3007620102 3007619802 Bacteria 6411688
481 8056146102 8056143049 Bacteria 6307666
482 Ga0466969_0031340
483 JGI25156J39149_1000381
484 JGI25156J39149_1016262
485 JGI25154J39366_1000589
486 JGI25157J39369_1000230
487 Ga0055539_1000559
488 Ga0055539_1001436
489 Ga0055533_1000043
490 Ga0055525_1000713
491 Ga0055535_1000079
492 Ga0055529_1000311
493 Ga0055530_10000011
494 Ga0055540_1000034
495 Ga0065714_10002392
496 Ga0070676_10087138
497 Ga0070668_100162764
498 Ga0070678_100171074
499 Ga0070684_100034348
500 Ga0068857_100001390
501 Ga0068854_100031101
502 Ga0068856_100003306
503 Ga0068870_10068224
504 Ga0075370_10079052
505 Ga0079104_1000064
506 Ga0099826_10018874
507 Ga0105251_10000078
508 Ga0105244_10008712
509 Ga0105250_10002102
510 Ga0105243_10105199
511 Ga0105238_10011420
512 Ga0105239_10010156
513 Ga0105246_10038404
514 Ga0105246_10333044
515 Ga0157373_10001643
516 Ga0157373_10006461
517 Ga0157371_10040106
518 Ga0163162_10006368
519 Ga0163162_10016481
520 Ga0157375_10013665
521 Ga0182006_1021202
522 Ga0182005_1014238
523 Ga0163161_10000974
524 Ga0209674_100067
525 Ga0209563_100068
526 Ga0207427_100400
527 Ga0209258_100129
528 Ga0209258_100512
529 Ga0209646_1000198
530 Ga0209026_1000004
531 Ga0209677_100049
532 Ga0209677_100079
533 Ga0209677_101510
534 Ga0209148_1007985
535 Ga0209759_1000003
536 Ga0209759_1000958
537 Ga0209759_1009549
538 Ga0209759_1014121
539 Ga0209455_1000083
540 Ga0209676_1002106
541 Ga0209050_1000013
542 Ga0209051_1000007
543 Ga0209257_1014855
544 Ga0207655_1001373
545 Ga0207655_1010937
546 Ga0207713_1000930
547 Ga0207645_10025479
548 Ga0207643_10052626
549 Ga0207705_10045094
550 Ga0207654_10063909
551 Ga0207695_10013814
552 Ga0207671_10077636
553 Ga0207694_10010723
554 Ga0207650_10044591
555 Ga0207659_10099887
556 Ga0207667_10154163
557 Ga0207668_10172739
558 Ga0207640_10006115
559 Ga0207702_10001004
560 Ga0207674_10039410
561 Ga0207683_10254527
562 Ga0207698_10469375
563 Ga0209281_1000009
564 Ga0209282_1118384
565 Ga0265336_10000011
566 Ga0265324_10003789
567 Ga0307509_10158791
568 Ga0307408_100000145
569 Ga0307408_100014611
570 Ga0307516_10000461
571 Ga0307405_10024177
572 Ga0307412_10000393
573 Ga0307412_10000636
574 Ga0307414_10223199
575 Ga0307411_10074531
576 Ga0373934_0027743
577 Ga0395899_0000086
578 Ga0395899_0165543
579 Ga0395900_0027412
580 Ga0395900_0251228
581 Ga0395905_0129594
582 Ga0395901_0007003
583 Ga0395901_0119623
584 Ga0439451_008001
585 Ga0439456_012076
586 Ga0439463_010755
587 Ga0439463_017283
588 Ga0450906_011698
589 Ga0466966_0006043
590 Ga0466961_0039517
591 Ga0466971_0002560
592 Ga0466968_0013608
593 Ga0466957_0058451
594 Ga0466967_0017496
595 Ga0466967_0051262
596 Ga0466967_0375120
597 Ga0495617_000063
598 Ga0495617_025852
599 Ga0495627_000323
600 Ga0495627_003505
601 Ga0495603_0011873
602 Ga0495603_0056179
603 Ga0495603_0074133
604 Ga0495590_0000008
605 Ga0495590_0012860
606 Ga0495591_000051
607 Ga0495591_000323
608 Ga0495591_001200
609 Ga0495591_001635
610 Ga0495629_0061718
611 Ga0495650_0007956
612 Ga0495650_0037781
613 Ga0495580_0068272
614 Ga0495582_0002152
615 Ga0495605_0000049
616 Ga0495605_0000185
617 Ga0495605_0004734
618 Ga0495605_0007020
619 Ga0495605_0007431
620 Ga0495605_0011862
621 Ga0495605_0018379
622 Ga0495584_0000024
623 Ga0495584_0007555
624 Ga0495584_0008400
625 Ga0495584_0021955
626 Ga0495584_0023710
627 Ga0495584_0029212
628 Ga0495584_0090763
629 Ga0495585_0000040
630 Ga0495585_0000233
631 Ga0495585_0000385
632 Ga0495585_0005897
633 Ga0495585_0025322
634 Ga0495585_0037680
635 Ga0495585_0038807
636 Ga0495585_0049348
637 Ga0495585_0060519
638 Ga0495585_0158316
639 Ga0495594_0001143
640 Ga0495594_0038257
641 Ga0495594_0074894
642 Ga0495596_0000106
643 Ga0495596_0001319
644 Ga0495596_0001825
645 Ga0495596_0012704
646 Ga0495596_0016148
647 Ga0495596_0089202
648 Ga0495607_0000210
649 Ga0495607_0002038
650 Ga0495607_0003153
651 Ga0495607_0009285
652 Ga0495607_0016175
653 Ga0495607_0016989
654 Ga0495607_0027110
655 Ga0495583_0000738
656 Ga0495583_0000798
657 Ga0495583_0001347
658 Ga0495583_0005813
659 Ga0495583_0008477
660 Ga0495583_0022652
661 Ga0495583_0033549
662 Ga0495583_0070749
663 Ga0495606_0000098
664 Ga0495606_0000157
665 Ga0495606_0001131
666 Ga0495606_0008977
667 Ga0495606_0030541
668 Ga0495606_0074129
669 Ga0495606_0078564
670 Ga0495606_0128342
671 Ga0495610_0000849
672 Ga0495610_0056104
673 Ga0495616_0000902
674 Ga0495616_0014955
675 Ga0495616_0016036
676 Ga0495616_0017239
677 Ga0495616_0030839
678 Ga0495616_0037855
679 Ga0495616_0064758
680 Ga0495620_0003064
681 Ga0495631_0003210
682 Ga0495631_0005808
683 Ga0495631_0007084
684 Ga0495631_0007808
685 Ga0495631_0011376
686 Ga0495631_0017141
687 Ga0495631_0027748
688 Ga0495631_0027775
689 Ga0495631_0032215
690 Ga0495631_0054365
691 Ga0495632_0000057
692 Ga0495632_0000201
693 Ga0495632_0042780
694 Ga0495632_0074921
695 Ga0495637_0000009
696 Ga0495637_0000181
697 Ga0495643_0028039
698 Ga0495643_0031815
699 Ga0495644_0003278
700 Ga0495644_0003686
701 Ga0495644_0007939
702 Ga0495644_0008129
703 Ga0495644_0015942
704 Ga0495644_0017824
705 Ga0495648_0000883
706 Ga0495648_0002639
707 Ga0495648_0016587
708 Ga0495648_0041743
709 Ga0495648_0118798
710 Ga0495663_0004872
711 Ga0495666_0000267
712 Ga0495666_0011516
713 Ga0495666_0016293
714 Ga0495642_0000012
715 Ga0495642_0001871
716 Ga0495642_0005427
717 Ga0495642_0006774
718 Ga0495642_0016155
719 Ga0495642_0024915
720 Ga0495642_0047315
721 Ga0495652_0298835
722 Ga0495654_0000367
723 Ga0495654_0049438
724 Ga0495654_0063678
725 Ga0495665_0006202
726 Ga0495640_0068112
727 Ga0495640_0105124
728 Ga0495586_0011048
729 Ga0495609_0000035
730 Ga0495609_0001427
731 Ga0495609_0016448
732 Ga0495609_0038534
733 Ga0495597_0000009
734 Ga0495597_0000335
735 Ga0495597_0002626
736 Ga0495597_0011888
737 Ga0495597_0012610
738 Ga0495597_0017760
739 Ga0495597_0093214
740 Ga0495597_0118229
741 Ga0495622_0001765
742 Ga0495622_0004134
743 Ga0495622_0015117
744 Ga0495622_0031397
745 Ga0495622_0068174
746 Ga0495622_0120587
747 Ga0495633_0000549
748 Ga0495633_0001135
749 Ga0495633_0006859
750 Ga0495656_0004163
751 Ga0495656_0006342
752 Ga0495656_0071876
753 Ga0495668_0000180
754 Ga0495668_0000429
755 Ga0495668_0004145
756 Ga0495668_0008512
757 Ga0495668_0049870
758 Ga0495668_0053731
759 Ga0495668_0057024
760 Ga0495668_0078091
761 Ga0495668_0079859
762 Ga0495611_0000013
763 Ga0495611_0000437
764 Ga0495611_0001498
765 Ga0495611_0023298
766 Ga0495611_0034354
767 Ga0495611_0064052
768 Ga0495625_0000004
769 Ga0495625_0009670
770 Ga0495625_0035308
771 Ga0495625_0079760
772 Ga0495625_0093201
773 Ga0495625_0196226
774 Ga0495635_0041134
775 Ga0495659_0047685
776 Ga0495661_0000041
777 Ga0495661_0000148
778 Ga0495661_0002006
779 Ga0495661_0006697
780 Ga0495661_0018004
781 Ga0495661_0019213
782 Ga0495661_0020695
783 Ga0495661_0028950
784 Ga0495661_0032467
785 Ga0495661_0073645
786 Ga0495661_0080036
787 Ga0495588_0002737
788 Ga0495588_0019759
789 Ga0495588_0061470
790 Ga0495588_0068328
791 Ga0495588_0132807
792 Ga0495669_0000017
793 Ga0495669_0002031
794 Ga0495669_0005964
795 Ga0495669_0010468
796 Ga0495669_0030295
797 Ga0495613_0120587
798 Ga0495624_0006051
799 Ga0495670_0000122
800 Ga0495670_0005151
801 Ga0495670_0011675
802 Ga0495670_0013354
803 Ga0495670_0024933
804 Ga0495670_0042386
805 Ga0495670_0042825
806 Ga0495670_0174426
807 Ga0495670_0180205
808 Ga0495671_0000140
809 Ga0495671_0003694
810 Ga0495671_0016513
811 Ga0495671_0075335
812 Ga0495649_0000062
813 Ga0495649_0014752
814 Ga0495589_0000102
815 Ga0495589_0001543
816 Ga0495589_0005590
817 Ga0495589_0019227
818 Ga0495589_0073988
819 Ga0495589_0077161
820 Ga0495660_0008513
821 Ga0495660_0034527
822 Ga0495581_0027407
823 Ga0495581_0050828
824 Ga0495604_0018357
825 Ga0495604_0048901
826 Ga0495604_0153973
827 Ga0495636_0004365
828 Ga0495636_0053786
829 Ga0495636_0066086
830 Ga0495674_0002798
831 Ga0495674_0049277
832 Ga0495672_0000231
833 Ga0495672_0066071
834 Ga0495672_0108588
835 Ga0495676_0000017
836 Ga0495676_0000023
837 Ga0495676_0020318
838 Ga0495676_0027485
839 Ga0495680_0006458
840 Ga0495683_0000222
841 Ga0495683_0016333
842 Ga0495683_0019608
843 Ga0495683_0100417
844 Ga0495687_002491
845 Ga0495675_0021917
846 Ga0495675_0051644
847 Ga0495675_0096046
848 Ga0495677_0000829
849 Ga0495677_0002275
850 Ga0495677_0012842
851 Ga0495677_0019784
852 Ga0495677_0019825
853 Ga0495677_0020682
854 Ga0495677_0031318
855 Ga0495679_000256
856 Ga0495679_006780
857 Ga0495679_016019
858 Ga0495685_007648
859 Ga0495673_0001644
860 Ga0495673_0007740
861 Ga0495673_0048566
862 Ga0495681_0000018
863 Ga0495681_0010880
864 Ga0495681_0014216
865 Ga0495681_0014970
866 Ga0495681_0030836
867 Ga0495681_0048977
868 Ga0495681_0054143
869 Ga0495686_0018207
870 Ga0495686_0028464
871 Ga0495686_0028571
872 Ga0495593_0020371
873 Ga0495593_0024110
874 Ga0495602_0040984
875 Ga0495614_0005411
876 Ga0495614_0008067
877 Ga0495626_0000213
878 Ga0495626_0004278
879 Ga0495626_0010046
880 Ga0495626_0015265
881 Ga0495626_0015299
882 Ga0495626_0033017
883 Ga0495626_0033975
884 Ga0495626_0084308
885 Ga0496102_0000151
886 Ga0496102_0347913
887 Ga0496103_0030283
888 Ga0496110_0021580
889 Ga0496115_0064571
890 Ga0496115_0160260
891 Ga0496115_0384405
892 Ga0496118_0032116
893 Ga0496121_0000715
894 Ga0496121_0005373
895 Ga0496121_0150830
896 Ga0496122_0002634
897 Ga0496122_0009730
898 Ga0496123_0000170
899 Ga0496124_0002162
900 Ga0496124_0023336
901 Ga0496124_0041032
902 Ga0496124_0134842
903 Ga0496126_0044838
904 Ga0495678_000092
905 Ga0495678_000100
906 Ga0495678_000286
907 Ga0495678_000705
908 Ga0495678_053545
909 Ga0495682_0000066
910 Ga0495682_0000560
911 Ga0495682_0026317
912 Ga0501269_002576
913 Ga0501226_003963
914 nmdc:mga07m45_988_c1
915 Ga0500635_0000065
916 Ga0500635_0023528
917 Ga0500566_0012048
918 Ga0500595_000321
919 Ga0500595_005993
920 Ga0500559_0044771
921 Ga0500603_000825
922 Ga0500603_010420
923 Ga0500638_000125
924 Ga0500661_000258
925 2511824832
926 2599612426
927 2599885208
928 2599898875
929 2599959861
930 2599967030
931 2599973128
932 2599978375
933 2599993594
934 2600006239
935 2600012542
936 2600016369
937 2600024576
938 2600032397
939 2600035038
940 2600040682
941 2600051575
942 2600059293
943 2600063019
944 2600072645
945 2600079271
946 2600361959
947 2644284388
948 2652543610
949 2671091695
950 2671126562
951 2808857931
952 2808922451
953 2808938122
954 2808948480
955 2808966374
956 2808996869
957 2825651684
958 2842858256
959 2913039735
960 2988728922
961 3007620102
962 8056146102

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

3

265

0.95

PF04321

RmlD_sub_bind

RmlD substrate binding domain

1

246

0.87

PF16363

GDP_Man_Dehyd

GDP-mannose 4,6 dehydratase

4

328

0.8

PF01073

3Beta_HSD

3-beta hydroxysteroid dehydrogenase/isomerase family

4

292

0.76

PF02719

Polysacc_synt_2

Polysaccharide biosynthesis protein

3

238

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
5u4q-assembly1.cif.gz_B 1.5 angstrom resolution crystal structure of nad-dependent epimerase from klebsiella pneumoniae in complex with nad. 0.9701 1 333
5u4q-assembly1.cif.gz_B 1.5 angstrom resolution crystal structure of nad-dependent epimerase from klebsiella pneumoniae in complex with nad. 0.9607 1 333
5u4q-assembly1.cif.gz_A 1.5 angstrom resolution crystal structure of nad-dependent epimerase from klebsiella pneumoniae in complex with nad. 0.9581 1 334
5u4q-assembly1.cif.gz_A 1.5 angstrom resolution crystal structure of nad-dependent epimerase from klebsiella pneumoniae in complex with nad. 0.9494 1 334
7ys8-assembly1.cif.gz_B crystal structure of udp-glucose 4-epimerase (rv3634c) from mycobacterium tuberculosis 0.9407 1 332
ID Description Score Start End Superfamily
5u4qA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9553 1 334 3.40.50.720
5u4qA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9493 1 334 3.40.50.720
4lisA02 Alpha Beta;Alpha-Beta Complex;UDP-galactose 4-epimerase; domain 1;UDP-galactose 4-epimerase, domain 1 0.944 263 330 3.90.25.10
4zrnB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9406 1 262 3.40.50.720
4zrnB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.936 1 262 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A382S169-F1-model_v4 NAD-dependent epimerase/dehydratase domain-containing protein 0.9905 81 228
AF-A0A3D6C3I5-F1-model_v4 Capsular biosynthesis protein CpsI 0.9863 1 334
AF-V7FNM4-F1-model_v4 NAD dependent epimerase/dehydratase 0.9828 2 335
AF-A0A7C7MZJ3-F1-model_v4 NAD-dependent epimerase 0.9826 1 334
AF-A0A383CCT4-F1-model_v4 NAD-dependent epimerase/dehydratase domain-containing protein 0.9813 18 274

Map