F452411

General Info

Members Datasets Scaffolds Average Seq Length
481 277 962 89

Family's Representative Sequence

Representative Sequence 3300021358|Ga0213873_10077371|Ga0213873_100773712
Length 105
Sequence MAADDERTAELDRPKVVALIRGHLAEELEIDSSSIDETTRFREDLDADSLDLYTLVQELEDTYGIRMSDEEAAKIRTVGQAVDFVLATVGPGARPSSTATPGPEE

Samples

Sample ID Description Type Environment
1 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
64 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
69 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
70 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
71 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
72 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
73 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
74 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
75 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
76 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
77 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
78 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
79 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
80 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
85 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
86 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
88 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
89 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
91 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
92 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
93 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
94 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
95 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
96 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
97 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
98 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
99 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
100 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
101 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
102 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
103 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
104 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
105 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
106 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
107 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
108 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
109 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
110 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
111 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
112 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
113 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
114 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
115 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
116 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
117 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
118 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
119 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
120 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
121 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
122 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
158 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
160 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
161 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
162 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
163 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
164 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
165 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
166 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
167 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
168 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
169 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
170 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
171 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
172 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
173 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
174 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
175 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
176 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
177 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
178 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
179 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
180 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
181 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
182 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
183 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
184 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
185 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
186 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
187 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
188 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
189 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
190 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
191 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
192 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
193 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
194 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
195 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
196 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
197 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
198 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
199 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
200 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
201 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
202 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
203 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
204 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
205 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
206 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
207 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
208 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
209 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
210 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
211 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
212 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
213 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
214 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
215 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
216 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
217 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
218 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
219 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
220 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
221 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
222 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
223 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
224 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
225 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
226 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
227 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
228 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
229 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
230 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
231 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
232 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
233 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
234 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
235 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
236 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
237 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
238 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
239 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
240 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
241 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
242 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
243 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
244 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
245 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
246 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
247 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
248 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
249 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
250 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
251 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
252 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
253 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
254 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
255 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
256 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
257 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
258 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
259 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
260 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
261 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
263 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
264 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
265 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
266 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
267 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
268 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
269 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
270 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
271 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
272 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
273 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
274 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
275 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
276 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
277 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.83
Nodule 0
Rhizoplane 3.74
Rhizosphere 92.93
Stem 0
Stem Tuber 0
Unclassified 3.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0213873_10077371 3300021358 Bacteria 926
2 JGI24735J21928_10201146 3300002067 Bacteria 578
3 JGI24745J21846_1013384 3300002073 Bacteria 945
4 JGI24738J21930_10101740 3300002075 Bacteria 614
5 JGI24744J21845_10086792 3300002077 Bacteria 573
6 JGI25406J46586_10192385 3300003203 Bacteria 595
7 JGI25405J52794_10097479 3300003911 Bacteria 654
8 Ga0070658_10420750 3300005327 Bacteria 1149
9 Ga0070683_100159560 3300005329 Bacteria 2139
10 Ga0070683_100183133 3300005329 Bacteria 1988
11 Ga0070683_100187843 3300005329 Bacteria 1962
12 Ga0070683_100206095 3300005329 Bacteria 1868
13 Ga0070690_100911749 3300005330 Bacteria 688
14 Ga0070670_100264175 3300005331 Bacteria 1501
15 Ga0070670_102227329 3300005331 Bacteria 505
16 Ga0068869_100938084 3300005334 Bacteria 751
17 Ga0068869_100946321 3300005334 Bacteria 747
18 Ga0068869_101287163 3300005334 Bacteria 645
19 Ga0070666_10152435 3300005335 Bacteria 1613
20 Ga0070682_100951243 3300005337 Bacteria 709
21 Ga0068868_100157320 3300005338 Bacteria 1875
22 Ga0068868_100202620 3300005338 Bacteria 1655
23 Ga0068868_100280814 3300005338 Bacteria 1409
24 Ga0068868_100905367 3300005338 Bacteria 802
25 Ga0070689_100053080 3300005340 Bacteria 3136
26 Ga0070689_100635847 3300005340 Bacteria 927
27 Ga0070689_101287400 3300005340 Bacteria 658
28 Ga0070691_10207685 3300005341 Bacteria 1032
29 Ga0070691_10418398 3300005341 Bacteria 759
30 Ga0070687_100156314 3300005343 Bacteria 1344
31 Ga0070687_100696662 3300005343 Bacteria 709
32 Ga0070661_100435096 3300005344 Bacteria 1042
33 Ga0070661_100612682 3300005344 Bacteria 881
34 Ga0070661_100647185 3300005344 Bacteria 858
35 Ga0070692_10340439 3300005345 Bacteria 929
36 Ga0070692_10860199 3300005345 Bacteria 624
37 Ga0070668_100472568 3300005347 Bacteria 1081
38 Ga0070668_100748415 3300005347 Bacteria 865
39 Ga0070668_101117839 3300005347 Bacteria 712
40 Ga0070669_100127247 3300005353 Bacteria 1951
41 Ga0070675_100209025 3300005354 Bacteria 1696
42 Ga0070671_100910170 3300005355 Bacteria 769
43 Ga0070674_100520260 3300005356 Bacteria 994
44 Ga0070674_101329966 3300005356 Bacteria 641
45 Ga0070674_101835893 3300005356 Bacteria 550
46 Ga0070673_100694465 3300005364 Bacteria 934
47 Ga0070673_100709934 3300005364 Bacteria 924
48 Ga0070688_100012123 3300005365 Bacteria 4819
49 Ga0070688_100510972 3300005365 Bacteria 908
50 Ga0070659_100149252 3300005366 Bacteria 1906
51 Ga0070659_100372887 3300005366 Bacteria 1201
52 Ga0070659_101077411 3300005366 Bacteria 708
53 Ga0070659_101606386 3300005366 Bacteria 581
54 Ga0070667_100476976 3300005367 Bacteria 1142
55 Ga0070714_100070378 3300005435 Bacteria 3024
56 Ga0070714_100615260 3300005435 Bacteria 1044
57 Ga0070713_100087784 3300005436 Bacteria 2668
58 Ga0070710_10007550 3300005437 Bacteria 5265
59 Ga0070710_10177287 3300005437 Bacteria 1332
60 Ga0070701_10180789 3300005438 Bacteria 1234
61 Ga0070701_10378023 3300005438 Bacteria 892
62 Ga0070701_11004464 3300005438 Unclassified 582
63 Ga0070711_100027916 3300005439 Bacteria 3710
64 Ga0070711_100270414 3300005439 Bacteria 1341
65 Ga0070705_100287582 3300005440 Bacteria 1172
66 Ga0070700_100065795 3300005441 Bacteria 2299
67 Ga0070694_100342155 3300005444 Bacteria 1157
68 Ga0070663_100596214 3300005455 Bacteria 929
69 Ga0070663_101422061 3300005455 Bacteria 615
70 Ga0070678_100466355 3300005456 Bacteria 1109
71 Ga0070678_101343087 3300005456 Bacteria 666
72 Ga0070662_100200067 3300005457 Bacteria 1585
73 Ga0070662_100452607 3300005457 Bacteria 1066
74 Ga0068867_100218823 3300005459 Bacteria 1534
75 Ga0068867_100635681 3300005459 Bacteria 935
76 Ga0070707_100362540 3300005468 Bacteria 1408
77 Ga0070679_100676055 3300005530 Bacteria 975
78 Ga0070684_100056102 3300005535 Bacteria 3436
79 Ga0070684_101069135 3300005535 Bacteria 758
80 Ga0070697_101006272 3300005536 Bacteria 741
81 Ga0068853_100731987 3300005539 Bacteria 945
82 Ga0070672_100265706 3300005543 Bacteria 1448
83 Ga0070695_100309728 3300005545 Bacteria 1170
84 Ga0070696_100149597 3300005546 Bacteria 1713
85 Ga0070665_100349633 3300005548 Bacteria 1483
86 Ga0070704_100850580 3300005549 Bacteria 818
87 Ga0070704_101431105 3300005549 Bacteria 635
88 Ga0068855_100681178 3300005563 Bacteria 1102
89 Ga0068855_101483510 3300005563 Bacteria 697
90 Ga0070664_100057125 3300005564 Bacteria 3316
91 Ga0070664_100701791 3300005564 Bacteria 943
92 Ga0070664_100812088 3300005564 Bacteria 875
93 Ga0070664_100843652 3300005564 Bacteria 858
94 Ga0068857_101543402 3300005577 Bacteria 648
95 Ga0068854_100059618 3300005578 Bacteria 2758
96 Ga0068856_100277535 3300005614 Bacteria 1692
97 Ga0068856_100644804 3300005614 Bacteria 1080
98 Ga0070702_100341955 3300005615 Bacteria 1050
99 Ga0070702_100485485 3300005615 Bacteria 904
100 Ga0068852_100246008 3300005616 Bacteria 1711
101 Ga0068852_101657280 3300005616 Bacteria 662
102 Ga0068852_101761668 3300005616 Bacteria 642
103 Ga0068852_102078741 3300005616 Bacteria 590
104 Ga0068859_102900725 3300005617 Bacteria 525
105 Ga0068864_100313893 3300005618 Bacteria 1470
106 Ga0068864_100443729 3300005618 Bacteria 1240
107 Ga0068866_10092850 3300005718 Bacteria 1647
108 Ga0068866_10275681 3300005718 Bacteria 1040
109 Ga0068866_10620385 3300005718 Bacteria 733
110 Ga0068861_100144987 3300005719 Bacteria 1942
111 Ga0068861_100409386 3300005719 Bacteria 1206
112 Ga0068861_100838203 3300005719 Bacteria 866
113 Ga0068861_100931339 3300005719 Unclassified 825
114 Ga0068851_10316387 3300005834 Bacteria 901
115 Ga0068870_10128124 3300005840 Bacteria 1471
116 Ga0068870_10609902 3300005840 Bacteria 743
117 Ga0068863_100210469 3300005841 Bacteria 1873
118 Ga0068863_100669731 3300005841 Bacteria 1030
119 Ga0068858_100046124 3300005842 Bacteria 4040
120 Ga0068858_101412971 3300005842 Bacteria 686
121 Ga0068858_101940360 3300005842 Bacteria 582
122 Ga0068862_100716492 3300005844 Bacteria 970
123 Ga0081455_10006296 3300005937 Bacteria 12758
124 Ga0081455_10055935 3300005937 Bacteria 3352
125 Ga0081455_10469106 3300005937 Bacteria 855
126 Ga0081540_1000408 3300005983 Bacteria 42368
127 Ga0081540_1031880 3300005983 Bacteria 2887
128 Ga0081539_10015050 3300005985 Bacteria 5665
129 Ga0070717_10084739 3300006028 Bacteria 2666
130 Ga0070717_10132002 3300006028 Bacteria 2148
131 Ga0075365_11024481 3300006038 Bacteria 582
132 Ga0075432_10212761 3300006058 Bacteria 770
133 Ga0070716_100320533 3300006173 Bacteria 1086
134 Ga0070716_101364975 3300006173 Bacteria 575
135 Ga0070716_101667277 3300006173 Bacteria 525
136 Ga0070712_100000002 3300006175 Bacteria 288475
137 Ga0070712_100015250 3300006175 Bacteria 4942
138 Ga0070712_100036374 3300006175 Bacteria 3350
139 Ga0070712_100686777 3300006175 Bacteria 872
140 Ga0075428_100409705 3300006844 Bacteria 1452
141 Ga0075428_100688454 3300006844 Unclassified 1089
142 Ga0075431_100364965 3300006847 Bacteria 1450
143 Ga0075431_100911960 3300006847 Unclassified 848
144 Ga0075433_10363847 3300006852 Bacteria 1278
145 Ga0075434_100882134 3300006871 Bacteria 910
146 Ga0075434_101278654 3300006871 Bacteria 745
147 Ga0075434_102429150 3300006871 Bacteria 526
148 Ga0075429_100160045 3300006880 Bacteria 1972
149 Ga0075429_100846524 3300006880 Bacteria 801
150 Ga0075429_101157630 3300006880 Unclassified 675
151 Ga0068865_100786487 3300006881 Bacteria 820
152 Ga0068865_101291176 3300006881 Bacteria 649
153 Ga0075436_100172165 3300006914 Bacteria 1529
154 Ga0075436_100769481 3300006914 Bacteria 716
155 Ga0097620_102901329 3300006931 Bacteria 525
156 Ga0075435_100423900 3300007076 Bacteria 1146
157 Ga0075435_100513173 3300007076 Bacteria 1037
158 Ga0105251_10221085 3300009011 Bacteria 853
159 Ga0111539_10017939 3300009094 Bacteria 8767
160 Ga0111539_10215073 3300009094 Bacteria 2239
161 Ga0111539_10714202 3300009094 Bacteria 1167
162 Ga0111539_11260326 3300009094 Bacteria 858
163 Ga0111539_11934562 3300009094 Bacteria 684
164 Ga0111539_12180885 3300009094 Bacteria 643
165 Ga0105245_10098282 3300009098 Bacteria 2705
166 Ga0105245_10155902 3300009098 Bacteria 2163
167 Ga0105245_10293279 3300009098 Bacteria 1594
168 Ga0105247_10247403 3300009101 Bacteria 1217
169 Ga0105247_10565276 3300009101 Bacteria 838
170 Ga0105247_11357443 3300009101 Bacteria 573
171 Ga0114129_11918085 3300009147 Bacteria 718
172 Ga0114129_12947229 3300009147 Bacteria 561
173 Ga0114129_12969155 3300009147 Unclassified 559
174 Ga0105243_10062292 3300009148 Bacteria 2986
175 Ga0105243_10452918 3300009148 Bacteria 1204
176 Ga0105243_10615307 3300009148 Bacteria 1048
177 Ga0105243_10860663 3300009148 Bacteria 898
178 Ga0105243_12710459 3300009148 Bacteria 536
179 Ga0105243_12790635 3300009148 Bacteria 529
180 Ga0105241_10732648 3300009174 Bacteria 905
181 Ga0105241_11860717 3300009174 Bacteria 589
182 Ga0105242_11791689 3300009176 Bacteria 652
183 Ga0105242_12685575 3300009176 Bacteria 548
184 Ga0105248_10208562 3300009177 Bacteria 2201
185 Ga0105248_10297308 3300009177 Bacteria 1818
186 Ga0105248_10592948 3300009177 Bacteria 1250
187 Ga0105248_12916345 3300009177 Bacteria 545
188 Ga0105237_11198656 3300009545 Bacteria 766
189 Ga0105238_12383023 3300009551 Bacteria 565
190 Ga0105249_10193820 3300009553 Bacteria 1985
191 Ga0105249_10577475 3300009553 Bacteria 1177
192 Ga0105249_11160639 3300009553 Unclassified 843
193 Ga0105249_11729709 3300009553 Bacteria 698
194 Ga0105239_10353681 3300010375 Bacteria 1659
195 Ga0105239_10498923 3300010375 Bacteria 1384
196 Ga0105239_11024622 3300010375 Bacteria 949
197 Ga0105246_10606686 3300011119 Bacteria 947
198 Ga0105246_12439528 3300011119 Bacteria 514
199 Ga0157341_1031105 3300012494 Bacteria 577
200 Ga0157319_1046538 3300012497 Bacteria 525
201 Ga0157314_1057281 3300012500 Bacteria 514
202 Ga0157316_1048193 3300012510 Bacteria 579
203 Ga0157327_1061863 3300012512 Bacteria 560
204 Ga0157338_1030090 3300012515 Bacteria 687
205 Ga0157371_10679560 3300013102 Bacteria 770
206 Ga0157370_11825791 3300013104 Bacteria 545
207 Ga0157369_11524389 3300013105 Bacteria 680
208 Ga0157374_10174273 3300013296 Bacteria 2099
209 Ga0157374_10753446 3300013296 Bacteria 988
210 Ga0157374_11807879 3300013296 Bacteria 636
211 Ga0157378_11713042 3300013297 Bacteria 676
212 Ga0157378_12166334 3300013297 Bacteria 607
213 Ga0163162_10623844 3300013306 Bacteria 1203
214 Ga0163162_11049037 3300013306 Bacteria 923
215 Ga0163162_11581422 3300013306 Bacteria 748
216 Ga0163162_11717625 3300013306 Bacteria 717
217 Ga0157372_10367443 3300013307 Bacteria 1676
218 Ga0157372_11060595 3300013307 Bacteria 938
219 Ga0157375_10305083 3300013308 Bacteria 1756
220 Ga0157375_10922195 3300013308 Bacteria 1016
221 Ga0163163_10072462 3300014325 Bacteria 3434
222 Ga0163163_11852465 3300014325 Bacteria 663
223 Ga0163163_11936945 3300014325 Bacteria 649
224 Ga0157380_10134239 3300014326 Bacteria 2116
225 Ga0157380_12351466 3300014326 Bacteria 598
226 Ga0182008_10698780 3300014497 Bacteria 579
227 Ga0157377_10462456 3300014745 Bacteria 878
228 Ga0157377_10517582 3300014745 Bacteria 837
229 Ga0157377_10559161 3300014745 Bacteria 809
230 Ga0157377_10565504 3300014745 Bacteria 805
231 Ga0157379_10371436 3300014968 Bacteria 1311
232 Ga0157379_11468627 3300014968 Bacteria 662
233 Ga0157376_10169990 3300014969 Bacteria 1984
234 Ga0157376_11441407 3300014969 Bacteria 721
235 Ga0163161_11175899 3300017792 Unclassified 662
236 Ga0213876_10002023 3300021384 Bacteria 12081
237 Ga0213876_10015439 3300021384 Bacteria 4041
238 Ga0213875_10574468 3300021388 Unclassified 544
239 Ga0207682_10192322 3300025893 Bacteria 935
240 Ga0207692_10249880 3300025898 Bacteria 1062
241 Ga0207642_10110815 3300025899 Bacteria 1397
242 Ga0207688_10015484 3300025901 Bacteria 4136
243 Ga0207699_10039437 3300025906 Bacteria 2714
244 Ga0207643_10054964 3300025908 Bacteria 2264
245 Ga0207643_10415170 3300025908 Bacteria 852
246 Ga0207705_10046835 3300025909 Bacteria 3109
247 Ga0207654_10906639 3300025911 Bacteria 639
248 Ga0207707_11306409 3300025912 Bacteria 583
249 Ga0207693_10000027 3300025915 Bacteria 120643
250 Ga0207693_10003390 3300025915 Bacteria 13617
251 Ga0207693_10006390 3300025915 Bacteria 9766
252 Ga0207663_10156745 3300025916 Bacteria 1603
253 Ga0207662_10556116 3300025918 Bacteria 795
254 Ga0207662_11271368 3300025918 Bacteria 523
255 Ga0207652_10571832 3300025921 Bacteria 1015
256 Ga0207659_10556436 3300025926 Bacteria 975
257 Ga0207700_10066884 3300025928 Bacteria 2748
258 Ga0207664_10046677 3300025929 Bacteria 3401
259 Ga0207664_10051336 3300025929 Bacteria 3256
260 Ga0207664_11499047 3300025929 Bacteria 596
261 Ga0207706_10130999 3300025933 Bacteria 2206
262 Ga0207686_10387336 3300025934 Bacteria 1062
263 Ga0207709_10115041 3300025935 Bacteria 1806
264 Ga0207709_10778749 3300025935 Bacteria 771
265 Ga0207670_10827502 3300025936 Bacteria 772
266 Ga0207670_11017471 3300025936 Bacteria 697
267 Ga0207704_10578390 3300025938 Bacteria 916
268 Ga0207665_10163568 3300025939 Bacteria 1602
269 Ga0207691_10271102 3300025940 Bacteria 1461
270 Ga0207691_10316733 3300025940 Bacteria 1338
271 Ga0207689_10218424 3300025942 Bacteria 1575
272 Ga0207689_10971434 3300025942 Bacteria 717
273 Ga0207661_11322469 3300025944 Bacteria 662
274 Ga0207651_10376157 3300025960 Bacteria 1203
275 Ga0207712_10259359 3300025961 Bacteria 1409
276 Ga0207712_10412308 3300025961 Unclassified 1138
277 Ga0207668_10560487 3300025972 Bacteria 991
278 Ga0207668_11240467 3300025972 Unclassified 670
279 Ga0207677_10114719 3300026023 Bacteria 2014
280 Ga0207639_10301936 3300026041 Bacteria 1415
281 Ga0207678_11874034 3300026067 Bacteria 524
282 Ga0207708_10086462 3300026075 Bacteria 2413
283 Ga0207648_10174749 3300026089 Bacteria 1899
284 Ga0207676_10157184 3300026095 Bacteria 1966
285 Ga0207675_100052149 3300026118 Bacteria 3817
286 Ga0207675_101105387 3300026118 Unclassified 812
287 Ga0207428_10059672 3300027907 Bacteria 3024
288 Ga0268266_11306269 3300028379 Bacteria 701
289 Ga0307408_101222135 3300031548 Bacteria 702
290 Ga0307408_101734409 3300031548 Bacteria 596
291 Ga0307405_10492740 3300031731 Bacteria 981
292 Ga0307405_10745719 3300031731 Bacteria 815
293 Ga0307405_10834711 3300031731 Bacteria 775
294 Ga0307413_10746401 3300031824 Bacteria 818
295 Ga0307413_10945573 3300031824 Bacteria 735
296 Ga0307413_11020364 3300031824 Bacteria 710
297 Ga0307413_11020428 3300031824 Bacteria 710
298 Ga0307410_10844683 3300031852 Bacteria 781
299 Ga0307410_11023586 3300031852 Bacteria 713
300 Ga0326468_10121342 3300031889 Bacteria 509
301 Ga0307406_10212074 3300031901 Bacteria 1433
302 Ga0307406_10361579 3300031901 Bacteria 1138
303 Ga0307406_10386897 3300031901 Bacteria 1104
304 Ga0307407_10076777 3300031903 Bacteria 2007
305 Ga0307407_10605814 3300031903 Bacteria 816
306 Ga0307407_10746160 3300031903 Bacteria 741
307 Ga0307407_11049277 3300031903 Bacteria 632
308 Ga0307409_100109346 3300031995 Bacteria 2314
309 Ga0307409_100685614 3300031995 Bacteria 1022
310 Ga0307409_102533634 3300031995 Bacteria 541
311 Ga0307416_100047156 3300032002 Bacteria 3408
312 Ga0307416_100065412 3300032002 Bacteria 2988
313 Ga0307416_100168583 3300032002 Bacteria 2035
314 Ga0307416_101140273 3300032002 Bacteria 885
315 Ga0307411_10309407 3300032005 Bacteria 1271
316 Ga0307411_10468548 3300032005 Bacteria 1058
317 Ga0307415_100189599 3300032126 Bacteria 1621
318 Ga0307415_100744275 3300032126 Bacteria 889
319 Ga0373951_0226412 3300035091 Bacteria 554
320 Ga0373954_0057944 3300035118 Bacteria 1825
321 Ga0373956_0020213 3300035119 Bacteria 2831
322 Ga0373957_0014720 3300035120 Bacteria 2679
323 Ga0373943_0540171 3300035170 Bacteria 684
324 Ga0373955_0181160 3300035172 Bacteria 1250
325 Ga0373924_0028392 3300035410 Bacteria 2230
326 Ga0373935_0564742 3300035692 Bacteria 830
327 Ga0373927_0324085 3300035695 Bacteria 1015
328 Ga0373933_0088204 3300035724 Bacteria 1911
329 Ga0373947_0361893 3300035725 Bacteria 974
330 Ga0373937_0073779 3300036401 Bacteria 3148
331 Ga0373925_0471854 3300037068 Bacteria 1029
332 Ga0395899_0301762 3300037312 Bacteria 1083
333 Ga0395900_0144700 3300037418 Bacteria 2432
334 Ga0395900_1258456 3300037418 Bacteria 654
335 Ga0436364_0055525 3300037853 Bacteria 4672
336 Ga0436364_0390862 3300037853 Unclassified 544
337 Ga0436364_0820783 3300037853 Unclassified 797
338 Ga0395901_0294002 3300038443 Bacteria 1685
339 Ga0436365_0558135 3300039437 Bacteria 14629
340 Ga0436365_0615584 3300039437 Bacteria 13737
341 Ga0436363_0312950 3300039450 Bacteria 5776
342 Ga0436362_0604013 3300039453 Bacteria 2319
343 Ga0436362_0916040 3300039453 Bacteria 1470
344 Ga0436362_1081075 3300039453 Bacteria 1295
345 Ga0451793_1825372 3300041452 Bacteria 531
346 Ga0451802_0746140 3300041460 Bacteria 514
347 Ga0451833_1246309 3300041491 Bacteria 1355
348 Ga0451837_0785061 3300041494 Bacteria 535
349 Ga0451853_0234531 3300041512 Bacteria 572
350 Ga0439454_001983 3300042011 Bacteria 2077
351 Ga0439463_064807 3300042016 Bacteria 934
352 Ga0450902_068069 3300042137 Bacteria 619
353 Ga0439458_0216335 3300042157 Bacteria 527
354 Ga0439459_0038276 3300042438 Bacteria 1008
355 Ga0439459_0242991 3300042438 Bacteria 506
356 Ga0439440_0013809 3300042993 Bacteria 1737
357 Ga0466969_0017107 3300044656 Bacteria 3789
358 Ga0466965_0040639 3300044683 Bacteria 2290
359 Ga0466965_0278774 3300044683 Bacteria 902
360 Ga0466966_0094769 3300044684 Bacteria 1850
361 Ga0466966_0305099 3300044684 Bacteria 957
362 Ga0466961_0174504 3300044693 Bacteria 1336
363 Ga0466963_0006151 3300044694 Bacteria 7084
364 Ga0466963_0268223 3300044694 Bacteria 1199
365 Ga0466963_0762353 3300044694 Bacteria 683
366 Ga0466963_0915912 3300044694 Bacteria 618
367 Ga0466964_0052289 3300044706 Bacteria 1679
368 Ga0466964_0369655 3300044706 Bacteria 741
369 Ga0466971_0035307 3300044719 Bacteria 2241
370 Ga0466968_0091026 3300044735 Unclassified 1352
371 Ga0466968_0093312 3300044735 Bacteria 1337
372 Ga0466968_0179160 3300044735 Bacteria 985
373 Ga0466970_0118924 3300044765 Bacteria 1446
374 Ga0466970_0515601 3300044765 Bacteria 689
375 Ga0466970_0796307 3300044765 Bacteria 553
376 Ga0466957_0030011 3300044842 Bacteria 3245
377 Ga0466959_0007939 3300045049 Bacteria 7475
378 Ga0466959_0049410 3300045049 Bacteria 3090
379 Ga0466958_0022796 3300045836 Bacteria 3670
380 Ga0466958_0051124 3300045836 Bacteria 2501
381 Ga0466958_0118204 3300045836 Bacteria 1658
382 Ga0466958_0648949 3300045836 Bacteria 687
383 Ga0466967_0037556 3300045976 Bacteria 4146
384 Ga0466967_0089085 3300045976 Bacteria 2801
385 Ga0466967_0443073 3300045976 Bacteria 1268
386 Ga0466967_0617108 3300045976 Bacteria 1071
387 Ga0466967_1377722 3300045976 Bacteria 702
388 Ga0466967_1472510 3300045976 Bacteria 678
389 Ga0495592_0093613 3300046454 Bacteria 2152
390 Ga0495592_0153829 3300046454 Bacteria 1588
391 Ga0495641_0246867 3300046461 Bacteria 802
392 Ga0495651_0014757 3300046462 Bacteria 6042
393 Ga0495653_0050482 3300046463 Bacteria 3199
394 Ga0495653_0626912 3300046463 Bacteria 659
395 Ga0495580_0387741 3300046472 Bacteria 943
396 Ga0495582_0206591 3300046473 Bacteria 1122
397 Ga0495639_0265574 3300046475 Bacteria 851
398 Ga0495662_0353265 3300046476 Bacteria 723
399 Ga0495664_0486500 3300046477 Bacteria 738
400 Ga0495594_0377337 3300046499 Bacteria 807
401 Ga0495608_0283663 3300046511 Bacteria 1027
402 Ga0495608_0572658 3300046511 Bacteria 679
403 Ga0495628_0044911 3300046516 Bacteria 3513
404 Ga0495630_0202039 3300046517 Bacteria 1517
405 Ga0495630_0432315 3300046517 Bacteria 1008
406 Ga0495665_0296856 3300046531 Bacteria 828
407 Ga0495640_0127133 3300046533 Bacteria 1652
408 Ga0495587_0043884 3300046536 Bacteria 2661
409 Ga0495645_0714049 3300046543 Bacteria 608
410 Ga0495667_0023455 3300046559 Bacteria 4157
411 Ga0495634_0023239 3300046642 Bacteria 4360
412 Ga0495634_0121591 3300046642 Bacteria 1671
413 Ga0495635_0011163 3300046663 Bacteria 6298
414 Ga0495635_1032077 3300046663 Bacteria 522
415 Ga0495657_0013426 3300046675 Bacteria 6045
416 Ga0495657_0079085 3300046675 Bacteria 2130
417 Ga0495599_0055387 3300046678 Bacteria 2484
418 Ga0495623_0021296 3300046679 Bacteria 4187
419 Ga0495646_0099826 3300046680 Bacteria 1666
420 Ga0495658_0277510 3300046683 Bacteria 1057
421 Ga0495613_0287669 3300046689 Bacteria 1140
422 Ga0495624_0106822 3300046690 Bacteria 1722
423 Ga0495624_0652791 3300046690 Bacteria 626
424 Ga0495600_0080353 3300046809 Bacteria 2128
425 Ga0495581_0351271 3300047315 Bacteria 861
426 Ga0495604_0003647 3300047317 Bacteria 12274
427 Ga0495674_0020629 3300047319 Bacteria 6101
428 Ga0495674_0593284 3300047319 Bacteria 878
429 Ga0495680_0048397 3300047322 Bacteria 3338
430 Ga0495680_0252371 3300047322 Bacteria 1250
431 Ga0495675_0340691 3300047444 Bacteria 883
432 Ga0495684_0040561 3300047471 Bacteria 3568
433 Ga0495684_1007316 3300047471 Bacteria 529
434 Ga0495593_0407878 3300047673 Bacteria 680
435 Ga0495602_0030310 3300048088 Bacteria 5133
436 Ga0495602_0631798 3300048088 Bacteria 733
437 Ga0495602_0862946 3300048088 Bacteria 604
438 Ga0495614_0225591 3300048089 Bacteria 853
439 Ga0496100_0470301 3300048903 Bacteria 966
440 Ga0496100_0953465 3300048903 Bacteria 674
441 Ga0496101_1158956 3300048904 Bacteria 606
442 Ga0496102_0398136 3300048905 Bacteria 1295
443 Ga0496102_0594066 3300048905 Bacteria 1030
444 Ga0496104_0030165 3300048907 Bacteria 5037
445 Ga0496104_0073897 3300048907 Bacteria 3244
446 Ga0496105_0029796 3300048908 Bacteria 4468
447 Ga0496105_0500024 3300048908 Bacteria 954
448 Ga0496108_0200400 3300048911 Bacteria 1732
449 Ga0496108_1258735 3300048911 Bacteria 624
450 Ga0496111_0421133 3300048914 Bacteria 986
451 Ga0496112_0002724 3300048915 Bacteria 14304
452 Ga0496112_0272329 3300048915 Bacteria 1641
453 Ga0496113_0025927 3300048916 Bacteria 4186
454 Ga0496114_0897493 3300048917 Bacteria 767
455 Ga0501034_0424244 3300049571 Bacteria 1251
456 Ga0501202_117654 3300049652 Bacteria 665
457 Ga0501249_193042 3300049679 Bacteria 531
458 Ga0501259_124308 3300049688 Bacteria 617
459 nmdc:mga0yw44_563612_c1 3300050492 Unclassified 773
460 nmdc:mga0yw44_58251_c1 3300050492 Bacteria 2359
461 nmdc:mga0yw44_955009_c1 3300050492 Bacteria 581
462 nmdc:mga05p37_517005_c1 3300050507 Bacteria 1366
463 nmdc:mga09592_174098_c1 3300050508 Bacteria 1861
464 nmdc:mga09592_658730_c1 3300050508 Bacteria 893
465 nmdc:mga0qj67_407710_c1 3300050509 Bacteria 1096
466 nmdc:mga06r32_1106686_c1 3300050510 Bacteria 741
467 nmdc:mga06r32_826230_c1 3300050510 Unclassified 886
468 nmdc:mga08y16_301130_c1 3300050511 Bacteria 1653
469 nmdc:mga08y16_766775_c1 3300050511 Bacteria 960
470 nmdc:mga08y16_782035_c1 3300050511 Bacteria 948
471 nmdc:mga0rr50_361198_c1 3300050513 Bacteria 1222
472 Ga0495601_0124567 3300053077 Bacteria 1676
473 Ga0495612_0068271 3300053078 Bacteria 1479
474 Ga0495595_0002623 3300053084 Bacteria 7049
475 Ga0495595_0618885 3300053084 Bacteria 554
476 Ga0495619_0015498 3300053085 Bacteria 4822
477 Ga0495619_0078354 3300053085 Bacteria 2221
478 Ga0590075_140623 3300059424 Bacteria 635
479 Ga0590075_179550 3300059424 Bacteria 560
480 Ga0466962_0022038 3300061719 Bacteria 3060
481 Ga0466962_0303443 3300061719 Bacteria 790
482 Ga0213873_10077371
483 JGI24735J21928_10201146
484 JGI24745J21846_1013384
485 JGI24738J21930_10101740
486 JGI24744J21845_10086792
487 JGI25406J46586_10192385
488 JGI25405J52794_10097479
489 Ga0070658_10420750
490 Ga0070683_100159560
491 Ga0070683_100183133
492 Ga0070683_100187843
493 Ga0070683_100206095
494 Ga0070690_100911749
495 Ga0070670_100264175
496 Ga0070670_102227329
497 Ga0068869_100938084
498 Ga0068869_100946321
499 Ga0068869_101287163
500 Ga0070666_10152435
501 Ga0070682_100951243
502 Ga0068868_100157320
503 Ga0068868_100202620
504 Ga0068868_100280814
505 Ga0068868_100905367
506 Ga0070689_100053080
507 Ga0070689_100635847
508 Ga0070689_101287400
509 Ga0070691_10207685
510 Ga0070691_10418398
511 Ga0070687_100156314
512 Ga0070687_100696662
513 Ga0070661_100435096
514 Ga0070661_100612682
515 Ga0070661_100647185
516 Ga0070692_10340439
517 Ga0070692_10860199
518 Ga0070668_100472568
519 Ga0070668_100748415
520 Ga0070668_101117839
521 Ga0070669_100127247
522 Ga0070675_100209025
523 Ga0070671_100910170
524 Ga0070674_100520260
525 Ga0070674_101329966
526 Ga0070674_101835893
527 Ga0070673_100694465
528 Ga0070673_100709934
529 Ga0070688_100012123
530 Ga0070688_100510972
531 Ga0070659_100149252
532 Ga0070659_100372887
533 Ga0070659_101077411
534 Ga0070659_101606386
535 Ga0070667_100476976
536 Ga0070714_100070378
537 Ga0070714_100615260
538 Ga0070713_100087784
539 Ga0070710_10007550
540 Ga0070710_10177287
541 Ga0070701_10180789
542 Ga0070701_10378023
543 Ga0070701_11004464
544 Ga0070711_100027916
545 Ga0070711_100270414
546 Ga0070705_100287582
547 Ga0070700_100065795
548 Ga0070694_100342155
549 Ga0070663_100596214
550 Ga0070663_101422061
551 Ga0070678_100466355
552 Ga0070678_101343087
553 Ga0070662_100200067
554 Ga0070662_100452607
555 Ga0068867_100218823
556 Ga0068867_100635681
557 Ga0070707_100362540
558 Ga0070679_100676055
559 Ga0070684_100056102
560 Ga0070684_101069135
561 Ga0070697_101006272
562 Ga0068853_100731987
563 Ga0070672_100265706
564 Ga0070695_100309728
565 Ga0070696_100149597
566 Ga0070665_100349633
567 Ga0070704_100850580
568 Ga0070704_101431105
569 Ga0068855_100681178
570 Ga0068855_101483510
571 Ga0070664_100057125
572 Ga0070664_100701791
573 Ga0070664_100812088
574 Ga0070664_100843652
575 Ga0068857_101543402
576 Ga0068854_100059618
577 Ga0068856_100277535
578 Ga0068856_100644804
579 Ga0070702_100341955
580 Ga0070702_100485485
581 Ga0068852_100246008
582 Ga0068852_101657280
583 Ga0068852_101761668
584 Ga0068852_102078741
585 Ga0068859_102900725
586 Ga0068864_100313893
587 Ga0068864_100443729
588 Ga0068866_10092850
589 Ga0068866_10275681
590 Ga0068866_10620385
591 Ga0068861_100144987
592 Ga0068861_100409386
593 Ga0068861_100838203
594 Ga0068861_100931339
595 Ga0068851_10316387
596 Ga0068870_10128124
597 Ga0068870_10609902
598 Ga0068863_100210469
599 Ga0068863_100669731
600 Ga0068858_100046124
601 Ga0068858_101412971
602 Ga0068858_101940360
603 Ga0068862_100716492
604 Ga0081455_10006296
605 Ga0081455_10055935
606 Ga0081455_10469106
607 Ga0081540_1000408
608 Ga0081540_1031880
609 Ga0081539_10015050
610 Ga0070717_10084739
611 Ga0070717_10132002
612 Ga0075365_11024481
613 Ga0075432_10212761
614 Ga0070716_100320533
615 Ga0070716_101364975
616 Ga0070716_101667277
617 Ga0070712_100000002
618 Ga0070712_100015250
619 Ga0070712_100036374
620 Ga0070712_100686777
621 Ga0075428_100409705
622 Ga0075428_100688454
623 Ga0075431_100364965
624 Ga0075431_100911960
625 Ga0075433_10363847
626 Ga0075434_100882134
627 Ga0075434_101278654
628 Ga0075434_102429150
629 Ga0075429_100160045
630 Ga0075429_100846524
631 Ga0075429_101157630
632 Ga0068865_100786487
633 Ga0068865_101291176
634 Ga0075436_100172165
635 Ga0075436_100769481
636 Ga0097620_102901329
637 Ga0075435_100423900
638 Ga0075435_100513173
639 Ga0105251_10221085
640 Ga0111539_10017939
641 Ga0111539_10215073
642 Ga0111539_10714202
643 Ga0111539_11260326
644 Ga0111539_11934562
645 Ga0111539_12180885
646 Ga0105245_10098282
647 Ga0105245_10155902
648 Ga0105245_10293279
649 Ga0105247_10247403
650 Ga0105247_10565276
651 Ga0105247_11357443
652 Ga0114129_11918085
653 Ga0114129_12947229
654 Ga0114129_12969155
655 Ga0105243_10062292
656 Ga0105243_10452918
657 Ga0105243_10615307
658 Ga0105243_10860663
659 Ga0105243_12710459
660 Ga0105243_12790635
661 Ga0105241_10732648
662 Ga0105241_11860717
663 Ga0105242_11791689
664 Ga0105242_12685575
665 Ga0105248_10208562
666 Ga0105248_10297308
667 Ga0105248_10592948
668 Ga0105248_12916345
669 Ga0105237_11198656
670 Ga0105238_12383023
671 Ga0105249_10193820
672 Ga0105249_10577475
673 Ga0105249_11160639
674 Ga0105249_11729709
675 Ga0105239_10353681
676 Ga0105239_10498923
677 Ga0105239_11024622
678 Ga0105246_10606686
679 Ga0105246_12439528
680 Ga0157341_1031105
681 Ga0157319_1046538
682 Ga0157314_1057281
683 Ga0157316_1048193
684 Ga0157327_1061863
685 Ga0157338_1030090
686 Ga0157371_10679560
687 Ga0157370_11825791
688 Ga0157369_11524389
689 Ga0157374_10174273
690 Ga0157374_10753446
691 Ga0157374_11807879
692 Ga0157378_11713042
693 Ga0157378_12166334
694 Ga0163162_10623844
695 Ga0163162_11049037
696 Ga0163162_11581422
697 Ga0163162_11717625
698 Ga0157372_10367443
699 Ga0157372_11060595
700 Ga0157375_10305083
701 Ga0157375_10922195
702 Ga0163163_10072462
703 Ga0163163_11852465
704 Ga0163163_11936945
705 Ga0157380_10134239
706 Ga0157380_12351466
707 Ga0182008_10698780
708 Ga0157377_10462456
709 Ga0157377_10517582
710 Ga0157377_10559161
711 Ga0157377_10565504
712 Ga0157379_10371436
713 Ga0157379_11468627
714 Ga0157376_10169990
715 Ga0157376_11441407
716 Ga0163161_11175899
717 Ga0213876_10002023
718 Ga0213876_10015439
719 Ga0213875_10574468
720 Ga0207682_10192322
721 Ga0207692_10249880
722 Ga0207642_10110815
723 Ga0207688_10015484
724 Ga0207699_10039437
725 Ga0207643_10054964
726 Ga0207643_10415170
727 Ga0207705_10046835
728 Ga0207654_10906639
729 Ga0207707_11306409
730 Ga0207693_10000027
731 Ga0207693_10003390
732 Ga0207693_10006390
733 Ga0207663_10156745
734 Ga0207662_10556116
735 Ga0207662_11271368
736 Ga0207652_10571832
737 Ga0207659_10556436
738 Ga0207700_10066884
739 Ga0207664_10046677
740 Ga0207664_10051336
741 Ga0207664_11499047
742 Ga0207706_10130999
743 Ga0207686_10387336
744 Ga0207709_10115041
745 Ga0207709_10778749
746 Ga0207670_10827502
747 Ga0207670_11017471
748 Ga0207704_10578390
749 Ga0207665_10163568
750 Ga0207691_10271102
751 Ga0207691_10316733
752 Ga0207689_10218424
753 Ga0207689_10971434
754 Ga0207661_11322469
755 Ga0207651_10376157
756 Ga0207712_10259359
757 Ga0207712_10412308
758 Ga0207668_10560487
759 Ga0207668_11240467
760 Ga0207677_10114719
761 Ga0207639_10301936
762 Ga0207678_11874034
763 Ga0207708_10086462
764 Ga0207648_10174749
765 Ga0207676_10157184
766 Ga0207675_100052149
767 Ga0207675_101105387
768 Ga0207428_10059672
769 Ga0268266_11306269
770 Ga0307408_101222135
771 Ga0307408_101734409
772 Ga0307405_10492740
773 Ga0307405_10745719
774 Ga0307405_10834711
775 Ga0307413_10746401
776 Ga0307413_10945573
777 Ga0307413_11020364
778 Ga0307413_11020428
779 Ga0307410_10844683
780 Ga0307410_11023586
781 Ga0326468_10121342
782 Ga0307406_10212074
783 Ga0307406_10361579
784 Ga0307406_10386897
785 Ga0307407_10076777
786 Ga0307407_10605814
787 Ga0307407_10746160
788 Ga0307407_11049277
789 Ga0307409_100109346
790 Ga0307409_100685614
791 Ga0307409_102533634
792 Ga0307416_100047156
793 Ga0307416_100065412
794 Ga0307416_100168583
795 Ga0307416_101140273
796 Ga0307411_10309407
797 Ga0307411_10468548
798 Ga0307415_100189599
799 Ga0307415_100744275
800 Ga0373951_0226412
801 Ga0373954_0057944
802 Ga0373956_0020213
803 Ga0373957_0014720
804 Ga0373943_0540171
805 Ga0373955_0181160
806 Ga0373924_0028392
807 Ga0373935_0564742
808 Ga0373927_0324085
809 Ga0373933_0088204
810 Ga0373947_0361893
811 Ga0373937_0073779
812 Ga0373925_0471854
813 Ga0395899_0301762
814 Ga0395900_0144700
815 Ga0395900_1258456
816 Ga0436364_0055525
817 Ga0436364_0390862
818 Ga0436364_0820783
819 Ga0395901_0294002
820 Ga0436365_0558135
821 Ga0436365_0615584
822 Ga0436363_0312950
823 Ga0436362_0604013
824 Ga0436362_0916040
825 Ga0436362_1081075
826 Ga0451793_1825372
827 Ga0451802_0746140
828 Ga0451833_1246309
829 Ga0451837_0785061
830 Ga0451853_0234531
831 Ga0439454_001983
832 Ga0439463_064807
833 Ga0450902_068069
834 Ga0439458_0216335
835 Ga0439459_0038276
836 Ga0439459_0242991
837 Ga0439440_0013809
838 Ga0466969_0017107
839 Ga0466965_0040639
840 Ga0466965_0278774
841 Ga0466966_0094769
842 Ga0466966_0305099
843 Ga0466961_0174504
844 Ga0466963_0006151
845 Ga0466963_0268223
846 Ga0466963_0762353
847 Ga0466963_0915912
848 Ga0466964_0052289
849 Ga0466964_0369655
850 Ga0466971_0035307
851 Ga0466968_0091026
852 Ga0466968_0093312
853 Ga0466968_0179160
854 Ga0466970_0118924
855 Ga0466970_0515601
856 Ga0466970_0796307
857 Ga0466957_0030011
858 Ga0466959_0007939
859 Ga0466959_0049410
860 Ga0466958_0022796
861 Ga0466958_0051124
862 Ga0466958_0118204
863 Ga0466958_0648949
864 Ga0466967_0037556
865 Ga0466967_0089085
866 Ga0466967_0443073
867 Ga0466967_0617108
868 Ga0466967_1377722
869 Ga0466967_1472510
870 Ga0495592_0093613
871 Ga0495592_0153829
872 Ga0495641_0246867
873 Ga0495651_0014757
874 Ga0495653_0050482
875 Ga0495653_0626912
876 Ga0495580_0387741
877 Ga0495582_0206591
878 Ga0495639_0265574
879 Ga0495662_0353265
880 Ga0495664_0486500
881 Ga0495594_0377337
882 Ga0495608_0283663
883 Ga0495608_0572658
884 Ga0495628_0044911
885 Ga0495630_0202039
886 Ga0495630_0432315
887 Ga0495665_0296856
888 Ga0495640_0127133
889 Ga0495587_0043884
890 Ga0495645_0714049
891 Ga0495667_0023455
892 Ga0495634_0023239
893 Ga0495634_0121591
894 Ga0495635_0011163
895 Ga0495635_1032077
896 Ga0495657_0013426
897 Ga0495657_0079085
898 Ga0495599_0055387
899 Ga0495623_0021296
900 Ga0495646_0099826
901 Ga0495658_0277510
902 Ga0495613_0287669
903 Ga0495624_0106822
904 Ga0495624_0652791
905 Ga0495600_0080353
906 Ga0495581_0351271
907 Ga0495604_0003647
908 Ga0495674_0020629
909 Ga0495674_0593284
910 Ga0495680_0048397
911 Ga0495680_0252371
912 Ga0495675_0340691
913 Ga0495684_0040561
914 Ga0495684_1007316
915 Ga0495593_0407878
916 Ga0495602_0030310
917 Ga0495602_0631798
918 Ga0495602_0862946
919 Ga0495614_0225591
920 Ga0496100_0470301
921 Ga0496100_0953465
922 Ga0496101_1158956
923 Ga0496102_0398136
924 Ga0496102_0594066
925 Ga0496104_0030165
926 Ga0496104_0073897
927 Ga0496105_0029796
928 Ga0496105_0500024
929 Ga0496108_0200400
930 Ga0496108_1258735
931 Ga0496111_0421133
932 Ga0496112_0002724
933 Ga0496112_0272329
934 Ga0496113_0025927
935 Ga0496114_0897493
936 Ga0501034_0424244
937 Ga0501202_117654
938 Ga0501249_193042
939 Ga0501259_124308
940 nmdc:mga0yw44_563612_c1
941 nmdc:mga0yw44_58251_c1
942 nmdc:mga0yw44_955009_c1
943 nmdc:mga05p37_517005_c1
944 nmdc:mga09592_174098_c1
945 nmdc:mga09592_658730_c1
946 nmdc:mga0qj67_407710_c1
947 nmdc:mga06r32_1106686_c1
948 nmdc:mga06r32_826230_c1
949 nmdc:mga08y16_301130_c1
950 nmdc:mga08y16_766775_c1
951 nmdc:mga08y16_782035_c1
952 nmdc:mga0rr50_361198_c1
953 Ga0495601_0124567
954 Ga0495612_0068271
955 Ga0495595_0002623
956 Ga0495595_0618885
957 Ga0495619_0015498
958 Ga0495619_0078354
959 Ga0590075_140623
960 Ga0590075_179550
961 Ga0466962_0022038
962 Ga0466962_0303443

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00550

PP-binding

Phosphopantetheine attachment site

18

85

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
6lvu-assembly2.cif.gz_B crystal structure of apo acyl carrier protein from thermotoga maritima 0.9644 2 78
1f80-assembly1.cif.gz_F holo-(acyl carrier protein) synthase in complex with holo-(acyl carrier protein) 0.9572 5 75
1f80-assembly1.cif.gz_E holo-(acyl carrier protein) synthase in complex with holo-(acyl carrier protein) 0.9555 5 76
3gzl-assembly1.cif.gz_A crystal structure of holo pfacp disulfide-linked dimer 0.9513 1 79
2fac-assembly1.cif.gz_A crystal structure of e. coli hexanoyl-acp 0.9478 6 80
ID Description Score Start End Superfamily
af_Q7KWJ1_42_137_1.10.1200.10 Mainly Alpha;Orthogonal Bundle;Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A;ACP-like 0.9663 3 77 1.10.1200.10
3gzmA00 Mainly Alpha;Orthogonal Bundle;Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A;ACP-like 0.9574 2 78 1.10.1200.10
1f80F00 Mainly Alpha;Orthogonal Bundle;Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A;ACP-like 0.9572 5 75 1.10.1200.10
1f80E00 Mainly Alpha;Orthogonal Bundle;Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A;ACP-like 0.9555 5 76 1.10.1200.10
1f80D00 Mainly Alpha;Orthogonal Bundle;Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A;ACP-like 0.9472 4 75 1.10.1200.10
ID Description Score Start End GO Terms
AF-A0A2N2CQP0-F1-model_v4 Acyl carrier protein (ACP) 0.9961 3 79 GO:0000035
GO:0000036
GO:0005829
GO:0009245
GO:0016020
AF-A0A7X6YNG8-F1-model_v4 Acyl carrier protein (ACP) 0.989 1 78 GO:0000035
GO:0000036
GO:0005829
GO:0009245
GO:0016020
AF-A0A329TRS0-F1-model_v4 Acyl carrier protein (ACP) 0.9873 6 77 GO:0000035
GO:0000036
GO:0005829
GO:0009245
GO:0016020
AF-A0A0R1TS68-F1-model_v4 Acyl carrier protein (ACP) 0.9862 1 80 GO:0000035
GO:0000036
GO:0005829
GO:0009245
GO:0016020
AF-R6BGR5-F1-model_v4 Acyl carrier protein (ACP) 0.9857 6 79 GO:0000035
GO:0000036
GO:0005829
GO:0009245
GO:0016020

Map