F452402

General Info

Members Datasets Scaffolds Average Seq Length
481 331 352 141

Family's Representative Sequence

Representative Sequence 3300013104|Ga0157370_11414701|Ga0157370_114147012
Length 160
Sequence MYVKRKNIQYVRKLKRSNEMKSTSYYPVIMTGDVAATAAFYMTHFRFQALFESDWYVHLQSAEDERINLAILDGSHETIPEQARGRVSGLLLNFEVEDVDTIYAACKTAGLPIMRDLRDEDFGQRHFITADPNGVLIDIIKPIPPSAEFAAMYDASALPA

Samples

Sample ID Description Type Environment
1 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
2 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
3 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
4 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
5 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
6 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
7 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
8 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
9 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
10 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
11 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
12 2519899620 Rhizobium sp. Pop5 Isolate Nodule
13 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
14 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
15 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
16 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
17 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
18 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
19 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
20 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
21 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
22 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
23 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
24 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
25 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
26 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
27 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
28 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
29 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
30 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
31 2643221573 Lysobacter sp. Root604 Isolate Unclassified
32 2643221607 Rhizobium sp. Root73 Isolate Unclassified
33 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
34 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
35 2643221683 Variovorax sp. Root473 Isolate Unclassified
36 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
37 2643221688 Rhizobium sp. Root482 Isolate Unclassified
38 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
39 2643221720 Lysobacter sp. Root916 Isolate Unclassified
40 2643221728 Lysobacter sp. Root983 Isolate Unclassified
41 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
42 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
43 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
44 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
45 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
46 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
47 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
48 2791355256 Rhizobium sp. M10 Isolate Nodule
49 2791355261 Rhizobium sp. J15 Isolate Nodule
50 2791355262 Rhizobium sp. M1 Isolate Nodule
51 2791355265 Rhizobium sp. H4 Isolate Nodule
52 2791355266 Rhizobium sp. L43 Isolate Nodule
53 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
54 2802429633 Rhizobium anhuiense J3 Isolate Nodule
55 2802429634 Rhizobium anhuiense S10 Isolate Nodule
56 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
57 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
58 2802429637 Rhizobium anhuiense C15 Isolate Nodule
59 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
60 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
61 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
62 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
63 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
64 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
65 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
66 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
67 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
68 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
69 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
70 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
71 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
72 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
73 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
74 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
75 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
76 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
77 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
78 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
79 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
80 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
81 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
82 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
83 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
84 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
85 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
86 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
87 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
88 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
89 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
90 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
91 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
92 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
93 2928070936 Variovorax gossypii 1167 Isolate Unclassified
94 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
95 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
96 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
97 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
98 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
99 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
100 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
101 2996893221 Rhizobium sp. R635 Isolate Nodule
102 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
103 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
104 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
105 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
106 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
107 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
108 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
109 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
110 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
111 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
112 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
113 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
114 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
115 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
116 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
117 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
118 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
119 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
120 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
121 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
122 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
123 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
124 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
125 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
126 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
127 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
128 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
129 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
130 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
131 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
132 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
133 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
134 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
135 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
136 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
137 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
138 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
139 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
140 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
141 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
142 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
143 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
144 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
145 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
146 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
147 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
148 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
149 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
150 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
151 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
152 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
153 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
154 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
155 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
156 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
157 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
158 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
159 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
160 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
161 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
162 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
163 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
164 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
165 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
166 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
167 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
168 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
169 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
170 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
171 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
172 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
173 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
174 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
175 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
176 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
177 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
185 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
186 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
187 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
189 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
190 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
191 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
192 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
193 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
194 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
195 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
196 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
197 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
198 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
199 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
200 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
201 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
202 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
203 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
204 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
205 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
206 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
207 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
208 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
209 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
210 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
211 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
212 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
213 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
214 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
215 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
216 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
217 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
218 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
219 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
220 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
221 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
222 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
223 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
224 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
225 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
226 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
227 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
228 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
229 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
230 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
231 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
232 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
233 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
234 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
235 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
236 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
237 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
238 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
239 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
240 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
241 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
242 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
243 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
244 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
245 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
246 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
247 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
248 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
249 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
250 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
251 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
252 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
253 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
254 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
255 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
256 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
257 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
258 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
259 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
260 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
261 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
262 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
263 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
264 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
265 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
266 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
267 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
268 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
269 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
270 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
271 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
272 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
273 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
274 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
275 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
276 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
277 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
278 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
279 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
280 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
281 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
282 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
283 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
284 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
285 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
286 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
287 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
288 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
289 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
290 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
291 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
292 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
293 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
294 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
295 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
296 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
297 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
298 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
299 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
300 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
301 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
302 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
303 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
304 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
305 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
306 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
307 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
308 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
309 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere
310 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
311 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
312 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
313 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
314 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
315 8005382845 Rhizobium sp. R634 Isolate Nodule
316 8005395548 Rhizobium sp. R339 Isolate Nodule
317 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
318 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
319 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
320 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
321 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
322 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
323 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
324 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
325 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
326 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
327 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
328 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
329 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
330 8024501048 Rhizobium sp. H4 Isolate Nodule
331 8056382006 Rhizobium croatiense 13T Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 73.18
Metatranscriptomes 0
Isolates 26.82

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 28.69
Nodule 17.67
Rhizoplane 3.33
Rhizosphere 31.39
Stem 0
Stem Tuber 0
Unclassified 18.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25152J39213_1003306 3300002773 Bacteria 5563
2 JGI25152J39213_1016576 3300002773 Bacteria 1417
3 JGI25150J39212_1002023 3300002774 Bacteria 5279
4 JGI25159J45721_1006082 3300002987 Bacteria 3666
5 JGI25159J45721_1028542 3300002987 Bacteria 930
6 JGI25151J46595_10001841 3300003187 Bacteria 13651
7 JGI25151J46595_10003849 3300003187 Bacteria 8119
8 JGI25151J46595_10006423 3300003187 Bacteria 5911
9 JGI25165J46597_1004474 3300003214 Bacteria 2983
10 JGI25153J46596_10002450 3300003215 Bacteria 10699
11 JGI25153J46596_10006473 3300003215 Bacteria 5911
12 rootH1_10070669 3300003316 Bacteria 4665
13 rootH2_10096900 3300003320 Bacteria 1452
14 rootL2_10173186 3300003322 Bacteria 2902
15 JGI25160J50197_1001905 3300003354 Bacteria 9991
16 JGI25160J50197_1009417 3300003354 Bacteria 3624
17 JGI25160J50197_1035407 3300003354 Bacteria 1225
18 JGI25161J50226_1002126 3300003374 Bacteria 5323
19 JGI25161J50226_1003374 3300003374 Bacteria 3681
20 Ga0055539_1005935 3300003752 Bacteria 1573
21 Ga0055526_1000562 3300003771 Bacteria 29362
22 Ga0055526_1006015 3300003771 Bacteria 6733
23 Ga0055526_1012689 3300003771 Bacteria 3645
24 Ga0055526_1015494 3300003771 Bacteria 3058
25 Ga0055537_1005017 3300003773 Bacteria 3630
26 Ga0055524_1001572 3300003775 Bacteria 12837
27 Ga0055524_1006120 3300003775 Bacteria 5264
28 Ga0055524_1010658 3300003775 Bacteria 3645
29 Ga0055524_1043490 3300003775 Bacteria 1104
30 Ga0055536_1000729 3300003781 Bacteria 22105
31 Ga0055534_1002865 3300003784 Bacteria 5736
32 Ga0055528_1000954 3300003790 Bacteria 19173
33 Ga0055528_1007348 3300003790 Bacteria 4880
34 Ga0055528_1011000 3300003790 Bacteria 3630
35 Ga0055528_1020713 3300003790 Bacteria 2122
36 Ga0055540_1000874 3300003792 Bacteria 19972
37 Ga0055540_1031352 3300003792 Bacteria 1222
38 Ga0055531_10110726 3300003794 Bacteria 548
39 Ga0055543_1000650 3300004625 Bacteria 18444
40 Ga0055543_1001944 3300004625 Bacteria 7373
41 Ga0065165_1000072 3300005262 Bacteria 165049
42 Ga0065165_1005274 3300005262 Bacteria 7373
43 Ga0065165_1013893 3300005262 Bacteria 3164
44 Ga0065165_1068144 3300005262 Bacteria 953
45 Ga0070660_100580907 3300005339 Bacteria 936
46 Ga0070669_100288796 3300005353 Bacteria 1316
47 Ga0070667_100020712 3300005367 Bacteria 5461
48 Ga0070663_101206172 3300005455 Bacteria 665
49 Ga0070665_100072449 3300005548 Bacteria 3453
50 Ga0070665_100963470 3300005548 Bacteria 866
51 Ga0068855_100045008 3300005563 Bacteria 5220
52 Ga0068855_100046688 3300005563 Bacteria 5119
53 Ga0068857_100636423 3300005577 Bacteria 1010
54 Ga0068854_100008048 3300005578 Bacteria 6756
55 Ga0068852_100278348 3300005616 Bacteria 1612
56 Ga0075363_100011984 3300006048 Bacteria 4168
57 Ga0075363_100204109 3300006048 Bacteria 1130
58 Ga0075364_10066973 3300006051 Bacteria 2360
59 Ga0075364_11051895 3300006051 Bacteria 553
60 Ga0075367_10002604 3300006178 Bacteria 8287
61 Ga0075367_10430070 3300006178 Bacteria 836
62 Ga0075369_10005260 3300006186 Bacteria 4825
63 Ga0075369_10177077 3300006186 Bacteria 980
64 Ga0075369_10636059 3300006186 Bacteria 512
65 Ga0075366_10003470 3300006195 Bacteria 8323
66 Ga0075366_10095246 3300006195 Bacteria 1785
67 Ga0075370_10034592 3300006353 Bacteria 2832
68 Ga0075370_10494401 3300006353 Bacteria 738
69 Ga0079104_1000063 3300006946 Bacteria 159519
70 Ga0099826_10000039 3300006948 Bacteria 99286
71 Ga0105251_10109610 3300009011 Bacteria 1258
72 Ga0105244_10040463 3300009036 Bacteria 2420
73 Ga0105240_10000012 3300009093 Bacteria 496639
74 Ga0105243_10000875 3300009148 Bacteria 28415
75 Ga0105237_10001271 3300009545 Bacteria 33636
76 Ga0105237_11470249 3300009545 Bacteria 688
77 Ga0105239_10005397 3300010375 Bacteria 15006
78 Ga0105239_10079004 3300010375 Bacteria 3621
79 Ga0157373_10257941 3300013100 Bacteria 1234
80 Ga0157373_11219558 3300013100 Bacteria 567
81 Ga0157370_10001804 3300013104 Bacteria 26400
82 Ga0157370_11168103 3300013104 Bacteria 695
83 Ga0157370_11414701 3300013104 Bacteria 626
84 Ga0157369_10004268 3300013105 Bacteria 16899
85 Ga0157369_11331926 3300013105 Bacteria 732
86 Ga0157372_10794576 3300013307 Bacteria 1100
87 Ga0182008_10017425 3300014497 Bacteria 3726
88 Ga0182007_10009304 3300015262 Bacteria 3971
89 Ga0182005_1003228 3300015265 Bacteria 5573
90 Ga0214544_1000652 3300021320 Bacteria 65892
91 Ga0214542_1000146 3300021321 Bacteria 103035
92 Ga0214543_1000054 3300021327 Bacteria 140288
93 Ga0209436_109717 3300025208 Bacteria 1808
94 Ga0207425_1000180 3300025245 Bacteria 52117
95 Ga0207425_1003975 3300025245 Bacteria 4547
96 Ga0207425_1042258 3300025245 Bacteria 864
97 Ga0209677_100556 3300025253 Bacteria 20628
98 Ga0209129_1000111 3300025258 Bacteria 148853
99 Ga0209129_1000203 3300025258 Bacteria 70739
100 Ga0209129_1000568 3300025258 Bacteria 25490
101 Ga0209129_1031523 3300025258 Bacteria 882
102 Ga0209233_1000161 3300025261 Bacteria 158607
103 Ga0209565_1000110 3300025263 Bacteria 119879
104 Ga0209673_1000037 3300025273 Bacteria 313804
105 Ga0209673_1000426 3300025273 Bacteria 73424
106 Ga0209673_1000670 3300025273 Bacteria 49698
107 Ga0209673_1005902 3300025273 Bacteria 6054
108 Ga0209673_1011858 3300025273 Bacteria 3559
109 Ga0209673_1077315 3300025273 Bacteria 773
110 Ga0209130_1000125 3300025284 Bacteria 124425
111 Ga0209130_1000205 3300025284 Bacteria 79260
112 Ga0209130_1002110 3300025284 Bacteria 10605
113 Ga0209675_1000192 3300025291 Bacteria 66905
114 Ga0209675_1001738 3300025291 Bacteria 11985
115 Ga0209676_1000484 3300025292 Bacteria 65041
116 Ga0209676_1044315 3300025292 Bacteria 1221
117 Ga0209676_1059260 3300025292 Bacteria 962
118 Ga0209025_1000116 3300025294 Bacteria 218293
119 Ga0209025_1000354 3300025294 Bacteria 98665
120 Ga0209025_1000566 3300025294 Bacteria 67702
121 Ga0209025_1031713 3300025294 Bacteria 2492
122 Ga0209025_1052349 3300025294 Bacteria 1612
123 Ga0209025_1073252 3300025294 Bacteria 1203
124 Ga0209564_1000155 3300025295 Bacteria 165859
125 Ga0209564_1000207 3300025295 Bacteria 135313
126 Ga0209564_1000379 3300025295 Bacteria 81420
127 Ga0209758_1000107 3300025297 Bacteria 218293
128 Ga0209758_1000674 3300025297 Bacteria 50969
129 Ga0209758_1004194 3300025297 Bacteria 12234
130 Ga0209758_1017850 3300025297 Bacteria 3508
131 Ga0209758_1068919 3300025297 Bacteria 1124
132 Ga0209256_1000087 3300025299 Bacteria 218290
133 Ga0209256_1000758 3300025299 Bacteria 41985
134 Ga0209256_1001345 3300025299 Bacteria 26077
135 Ga0209256_1001773 3300025299 Bacteria 20488
136 Ga0209256_1006537 3300025299 Bacteria 6118
137 Ga0207426_1000123 3300025302 Bacteria 218290
138 Ga0207426_1000296 3300025302 Bacteria 98032
139 Ga0207426_1000474 3300025302 Bacteria 61569
140 Ga0207426_1010167 3300025302 Bacteria 3672
141 Ga0207426_1064804 3300025302 Bacteria 1038
142 Ga0207426_1110173 3300025302 Bacteria 695
143 Ga0209051_1000636 3300025303 Bacteria 40363
144 Ga0209051_1007062 3300025303 Bacteria 6211
145 Ga0209051_1033281 3300025303 Bacteria 1951
146 Ga0209051_1037257 3300025303 Bacteria 1786
147 Ga0209051_1040409 3300025303 Bacteria 1672
148 Ga0209051_1048253 3300025303 Bacteria 1445
149 Ga0209257_1006616 3300025304 Bacteria 7376
150 Ga0209257_1016240 3300025304 Bacteria 3026
151 Ga0207695_10000097 3300025913 Bacteria 262517
152 Ga0207695_10366754 3300025913 Bacteria 1326
153 Ga0207671_10000289 3300025914 Bacteria 74385
154 Ga0207681_10239778 3300025923 Bacteria 1411
155 Ga0207694_10668560 3300025924 Bacteria 875
156 Ga0207694_11050778 3300025924 Bacteria 689
157 Ga0207709_10000389 3300025935 Bacteria 43589
158 Ga0207667_10082349 3300025949 Bacteria 3334
159 Ga0207658_10036414 3300025986 Bacteria 3528
160 Ga0209281_1000110 3300027111 Bacteria 215631
161 Ga0209282_1000058 3300027666 Bacteria 99152
162 Ga0209813_10026714 3300027866 Bacteria 1671
163 Ga0268266_11182979 3300028379 Bacteria 739
164 Ga0268266_11348678 3300028379 Bacteria 689
165 Ga0265337_1019994 3300028556 Bacteria 2104
166 Ga0265326_10010068 3300028558 Bacteria 2815
167 Ga0265334_10003173 3300028573 Bacteria 7503
168 Ga0265323_10003552 3300028653 Bacteria 6863
169 Ga0265336_10000104 3300028666 Bacteria 64094
170 Ga0307515_10000285 3300028794 Bacteria 124535
171 Ga0307515_10027939 3300028794 Bacteria 9612
172 Ga0307515_10315337 3300028794 Bacteria 1235
173 Ga0265338_10000137 3300028800 Bacteria 135705
174 Ga0307513_10436181 3300031456 Bacteria 1037
175 Ga0307408_100036635 3300031548 Bacteria 3450
176 Ga0307405_10025479 3300031731 Bacteria 3397
177 Ga0307405_10100910 3300031731 Bacteria 1935
178 Ga0307405_11483338 3300031731 Bacteria 595
179 Ga0307413_10727427 3300031824 Bacteria 827
180 Ga0307410_10432208 3300031852 Bacteria 1070
181 Ga0307406_10003654 3300031901 Bacteria 8379
182 Ga0307406_10025129 3300031901 Bacteria 3564
183 Ga0307409_100138223 3300031995 Bacteria 2095
184 Ga0307411_10096263 3300032005 Bacteria 2080
185 Ga0439436_0019228 3300041404 Bacteria 2039
186 Ga0439436_0069911 3300041404 Bacteria 979
187 Ga0439436_0168031 3300041404 Bacteria 622
188 Ga0439439_0014957 3300041406 Bacteria 1892
189 Ga0439447_045362 3300041407 Bacteria 1061
190 Ga0439466_0141204 3300041411 Bacteria 739
191 Ga0439465_0017320 3300041413 Bacteria 2249
192 Ga0439465_0058018 3300041413 Bacteria 1279
193 Ga0451795_0431751 3300041456 Bacteria 926
194 Ga0451802_1417467 3300041460 Bacteria 515
195 Ga0451833_0058447 3300041491 Bacteria 752
196 Ga0451833_0423803 3300041491 Bacteria 1287
197 Ga0451835_0025022 3300041492 Bacteria 4591
198 Ga0451835_0587763 3300041492 Bacteria 739
199 Ga0451837_1195521 3300041494 Bacteria 747
200 Ga0451837_1313381 3300041494 Bacteria 1149
201 Ga0451839_0865211 3300041496 Bacteria 856
202 Ga0451841_1207741 3300041498 Bacteria 646
203 Ga0451845_0189690 3300041501 Bacteria 5806
204 Ga0451847_0407225 3300041503 Bacteria 3145
205 Ga0451849_1528707 3300041505 Bacteria 1392
206 Ga0451851_0631607 3300041507 Bacteria 1299
207 Ga0451843_0272987 3300041509 Bacteria 1959
208 Ga0451855_0989568 3300041511 Bacteria 1159
209 Ga0451855_2042030 3300041511 Bacteria 1790
210 Ga0451853_2899099 3300041512 Bacteria 1289
211 Ga0439431_0169816 3300041997 Bacteria 626
212 Ga0439442_150485 3300042002 Bacteria 518
213 Ga0439445_0170174 3300042004 Bacteria 638
214 Ga0439449_0145376 3300042007 Bacteria 884
215 Ga0439452_075985 3300042010 Bacteria 736
216 Ga0439452_090676 3300042010 Bacteria 661
217 Ga0450920_033874 3300042122 Bacteria 1010
218 Ga0450906_010034 3300042145 Bacteria 1796
219 Ga0450918_000905 3300042531 Bacteria 6223
220 Ga0495591_123417 3300046458 Bacteria 631
221 Ga0495638_0119641 3300046460 Bacteria 1557
222 Ga0495638_0284755 3300046460 Bacteria 896
223 Ga0495638_0534139 3300046460 Bacteria 585
224 Ga0495650_0045045 3300046471 Bacteria 1860
225 Ga0495650_0105142 3300046471 Bacteria 1055
226 Ga0495605_0015928 3300046474 Bacteria 4079
227 Ga0495605_0122411 3300046474 Bacteria 1178
228 Ga0495585_0073155 3300046492 Bacteria 1866
229 Ga0495585_0090720 3300046492 Bacteria 1646
230 Ga0495596_0000738 3300046500 Bacteria 20164
231 Ga0495607_0008050 3300046501 Bacteria 7238
232 Ga0495583_0046252 3300046506 Bacteria 2008
233 Ga0495606_0037728 3300046507 Bacteria 3278
234 Ga0495606_0044419 3300046507 Bacteria 2955
235 Ga0495610_0002945 3300046512 Bacteria 13742
236 Ga0495610_0019160 3300046512 Bacteria 3837
237 Ga0495610_0084029 3300046512 Bacteria 1455
238 Ga0495610_0220437 3300046512 Bacteria 766
239 Ga0495616_0034897 3300046513 Bacteria 2607
240 Ga0495616_0037836 3300046513 Bacteria 2479
241 Ga0495620_0056393 3300046515 Bacteria 1652
242 Ga0495632_0060127 3300046519 Bacteria 1847
243 Ga0495643_0052037 3300046522 Bacteria 2200
244 Ga0495643_0067686 3300046522 Bacteria 1880
245 Ga0495643_0446863 3300046522 Bacteria 563
246 Ga0495648_0109684 3300046524 Bacteria 1504
247 Ga0495609_0000943 3300046538 Bacteria 21055
248 Ga0495609_0086479 3300046538 Bacteria 1367
249 Ga0495597_0188362 3300046542 Bacteria 831
250 Ga0495633_0007601 3300046558 Bacteria 6211
251 Ga0495633_0057257 3300046558 Bacteria 1831
252 Ga0495656_0367284 3300046615 Bacteria 748
253 Ga0495656_0441287 3300046615 Bacteria 685
254 Ga0495625_0037308 3300046660 Bacteria 3566
255 Ga0495625_0065573 3300046660 Bacteria 2559
256 Ga0495661_0010519 3300046665 Bacteria 6310
257 Ga0495588_0085400 3300046674 Bacteria 1650
258 Ga0495670_0038029 3300046691 Bacteria 2399
259 Ga0495671_0001086 3300046692 Bacteria 18821
260 Ga0495649_0011484 3300046694 Bacteria 5192
261 Ga0495649_0026554 3300046694 Bacteria 3219
262 Ga0495649_0214823 3300046694 Bacteria 996
263 Ga0495660_0169450 3300046810 Bacteria 1064
264 Ga0495672_0002271 3300047320 Bacteria 17861
265 Ga0495672_0528807 3300047320 Bacteria 520
266 Ga0495683_0262811 3300047323 Bacteria 753
267 Ga0495685_080747 3300047447 Bacteria 1083
268 Ga0495673_0067724 3300047469 Bacteria 1510
269 Ga0495673_0153688 3300047469 Bacteria 888
270 Ga0495686_0031679 3300047472 Bacteria 3426
271 Ga0495615_0009826 3300048090 Bacteria 1894
272 Ga0496100_0242040 3300048903 Bacteria 1331
273 Ga0496101_0092727 3300048904 Bacteria 2249
274 Ga0496103_0047279 3300048906 Bacteria 2658
275 Ga0496106_0003583 3300048909 Bacteria 11571
276 Ga0496106_0128093 3300048909 Bacteria 1989
277 Ga0496106_0156112 3300048909 Bacteria 1802
278 Ga0496107_0070478 3300048910 Bacteria 2538
279 Ga0496113_0127353 3300048916 Bacteria 1995
280 Ga0496113_1315248 3300048916 Bacteria 562
281 Ga0496114_0109193 3300048917 Bacteria 2369
282 Ga0496116_0014321 3300048919 Bacteria 6339
283 Ga0496116_0016495 3300048919 Bacteria 5775
284 Ga0496116_0030810 3300048919 Bacteria 3849
285 Ga0496116_0324914 3300048919 Bacteria 718
286 Ga0496116_0359465 3300048919 Bacteria 663
287 Ga0496117_0483545 3300048920 Bacteria 604
288 Ga0496118_0006891 3300048921 Bacteria 12302
289 Ga0496118_0014905 3300048921 Bacteria 7240
290 Ga0496119_0089645 3300048922 Bacteria 1751
291 Ga0496119_0408245 3300048922 Bacteria 647
292 Ga0496120_0019402 3300048923 Bacteria 4350
293 Ga0496121_0005527 3300048924 Bacteria 16152
294 Ga0496121_0010414 3300048924 Bacteria 10492
295 Ga0496121_0011115 3300048924 Bacteria 10045
296 Ga0496121_0036881 3300048924 Bacteria 4350
297 Ga0496121_0110756 3300048924 Bacteria 2094
298 Ga0496121_0568675 3300048924 Bacteria 706
299 Ga0496122_0010611 3300048925 Bacteria 9462
300 Ga0496122_0012504 3300048925 Bacteria 8439
301 Ga0496122_0015579 3300048925 Bacteria 7256
302 Ga0496122_0256138 3300048925 Bacteria 975
303 Ga0496122_0267392 3300048925 Bacteria 944
304 Ga0496123_0002314 3300048926 Bacteria 23928
305 Ga0496123_0003695 3300048926 Bacteria 16847
306 Ga0496123_0021755 3300048926 Bacteria 4972
307 Ga0496123_0168276 3300048926 Bacteria 1159
308 Ga0496124_0007502 3300048927 Bacteria 11582
309 Ga0496124_0014927 3300048927 Bacteria 7479
310 Ga0496124_0146774 3300048927 Bacteria 1855
311 Ga0496124_0617528 3300048927 Bacteria 702
312 Ga0496125_0022386 3300048928 Bacteria 5870
313 Ga0496125_0085958 3300048928 Bacteria 2381
314 Ga0496125_0614801 3300048928 Bacteria 591
315 Ga0496126_0000522 3300048929 Bacteria 74922
316 Ga0496126_0012811 3300048929 Bacteria 8571
317 Ga0496126_0156564 3300048929 Bacteria 1949
318 Ga0496126_0386811 3300048929 Bacteria 1137
319 Ga0496126_0583990 3300048929 Bacteria 882
320 Ga0496126_1021689 3300048929 Bacteria 619
321 Ga0501034_0010344 3300049571 Bacteria 9723
322 Ga0501034_0107266 3300049571 Bacteria 2785
323 Ga0501034_0490021 3300049571 Bacteria 1144
324 Ga0501040_0742398 3300049576 Bacteria 710
325 Ga0501043_0556925 3300049579 Bacteria 851
326 Ga0501070_0540242 3300049586 Bacteria 934
327 Ga0501238_055607 3300049671 Bacteria 598
328 Ga0501280_001541 3300049776 Bacteria 4181
329 nmdc:mga03683_1842_c1 3300050489 Bacteria 6441
330 nmdc:mga03n38_111186_c1 3300050490 Bacteria 1334
331 nmdc:mga03n38_584122_c1 3300050490 Bacteria 635
332 nmdc:mga00v17_37735_c2 3300050491 Bacteria 2483
333 nmdc:mga0yw44_13340_c1 3300050492 Bacteria 4323
334 nmdc:mga0k408_4827_c1 3300050493 Bacteria 7150
335 nmdc:mga06z11_14133_c1 3300050494 Bacteria 3528
336 nmdc:mga04h51_9894_c1 3300050495 Bacteria 2602
337 nmdc:mga07m45_5581_c1 3300050496 Bacteria 6280
338 nmdc:mga0sz30_4147_c1 3300050516 Bacteria 5222
339 Ga0500578_0107158 3300053086 Bacteria 1764
340 Ga0500644_0102723 3300053088 Bacteria 1089
341 Ga0500593_001264 3300053117 Bacteria 9144
342 Ga0500597_201365 3300053120 Bacteria 836
343 Ga0500658_0006087 3300053134 Bacteria 4486
344 Ga0500658_0007038 3300053134 Bacteria 4161
345 Ga0500659_0229825 3300053135 Bacteria 873
346 Ga0500568_0000005 3300053139 Bacteria 614296
347 Ga0500568_0002693 3300053139 Bacteria 10297
348 Ga0500622_0001576 3300053156 Bacteria 17943
349 Ga0500627_0080689 3300053158 Bacteria 1450
350 Ga0500633_0000642 3300053160 Bacteria 5817
351 Ga0500636_0000119 3300053177 Bacteria 41322
352 Ga0500645_091951 3300053730 Bacteria 860

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005262 Ga0065165_1000072 Ga0065165_100007261 131
2 3300025284 Ga0209130_1000125 Ga0209130_100012566 131
3 3300025302 Ga0207426_1010167 Ga0207426_10101672 131
4 3300048922 Ga0496119_0408245 Ga0496119_0408245_85_480 131
5 3300048925 Ga0496122_0012504 Ga0496122_0012504_6518_6913 131
6 3300053120 Ga0500597_201365 Ga0500597_201365_17_412 131
7 3300053730 Ga0500645_091951 Ga0500645_091951_446_841 131
8 iso_pu_bacteria 2996310559 2996314226 136
9 3300053117 Ga0500593_001264 Ga0500593_001264_2035_2448 137
10 3300053139 Ga0500568_0000005 Ga0500568_0000005_164403_164816 137
11 iso_pu_bacteria 2509276033 2509447991 137
12 iso_pu_bacteria 2510065019 2510134929 137
13 iso_pu_bacteria 2513237084 2513573716 137
14 iso_pu_bacteria 2513237093 2513631225 137
15 iso_pu_bacteria 2513237103 2513710880 137
16 iso_pu_bacteria 2513237159 2514001607 137
17 iso_pu_bacteria 2515154134 2515743621 137
18 iso_pu_bacteria 2516653077 2517037652 137
19 iso_pu_bacteria 2517093000 2517096734 137
20 iso_pu_bacteria 2519899620 2520381378 137
21 iso_pu_bacteria 2534681796 2535519319 137
22 iso_pu_bacteria 2582581283 2585164275 137
23 iso_pu_bacteria 2582581294 2585202368 137
24 iso_pu_bacteria 2582581306 2585264506 137
25 iso_pu_bacteria 2582581308 2585278090 137
26 iso_pu_bacteria 2582581865 2585389870 137
27 iso_pu_bacteria 2585427526 2585528982 137
28 iso_pu_bacteria 2585427527 2585532250 137
29 iso_pu_bacteria 2585427528 2585540927 137
30 iso_pu_bacteria 2585427530 2585552610 137
31 iso_pu_bacteria 2585427593 2585839689 137
32 iso_pu_bacteria 2585427634 2586001851 137
33 iso_pu_bacteria 2599185236 2599720017 137
34 iso_pu_bacteria 2615840626 2616307608 137
35 iso_pu_bacteria 2643221573 2643878185 137
36 iso_pu_bacteria 2643221607 2644051789 137
37 iso_pu_bacteria 2643221636 2644201596 137
38 iso_pu_bacteria 2643221643 2644241971 137
39 iso_pu_bacteria 2643221686 2644480657 137
40 iso_pu_bacteria 2643221688 2644495821 137
41 iso_pu_bacteria 2643221689 2644498627 137
42 iso_pu_bacteria 2643221720 2644659489 137
43 iso_pu_bacteria 2643221728 2644700761 137
44 iso_pu_bacteria 2718218232 2720614888 137
45 iso_pu_bacteria 2721755556 2723028301 137
46 iso_pu_bacteria 2721755684 2723561929 137
47 iso_pu_bacteria 2724679232 2725950822 137
48 iso_pu_bacteria 2728369352 2730109237 137
49 iso_pu_bacteria 2738541333 2739035483 137
50 iso_pu_bacteria 2765235942 2766065228 137
51 iso_pu_bacteria 2791355256 2793293538 137
52 iso_pu_bacteria 2791355261 2793327865 137
53 iso_pu_bacteria 2791355262 2793333478 137
54 iso_pu_bacteria 2791355265 2793353787 137
55 iso_pu_bacteria 2791355266 2793359608 137
56 iso_pu_bacteria 2802429606 2805935328 137
57 iso_pu_bacteria 2802429633 2806044470 137
58 iso_pu_bacteria 2802429634 2806052671 137
59 iso_pu_bacteria 2802429635 2806058971 137
60 iso_pu_bacteria 2802429636 2806068366 137
61 iso_pu_bacteria 2802429637 2806074486 137
62 iso_pu_bacteria 2818991453 2819640495 137
63 iso_pu_bacteria 2821123053 2821126263 137
64 iso_pu_bacteria 2834641062 2834641250 137
65 iso_pu_bacteria 2838016132 2838019194 137
66 iso_pu_bacteria 2838042994 2838047453 137
67 iso_pu_bacteria 2838661181 2838663639 137
68 iso_pu_bacteria 2838668709 2838674635 137
69 iso_pu_bacteria 2838701080 2838707007 137
70 iso_pu_bacteria 2838736955 2838737261 137
71 iso_pu_bacteria 2841840854 2841842370 137
72 iso_pu_bacteria 2842110456 2842113339 137
73 iso_pu_bacteria 2842140634 2842142150 137
74 iso_pu_bacteria 2842146304 2842151697 137
75 iso_pu_bacteria 2842163707 2842170046 137
76 iso_pu_bacteria 2842192696 2842198630 137
77 iso_pu_bacteria 2842205361 2842208403 137
78 iso_pu_bacteria 2842217011 2842219983 137
79 iso_pu_bacteria 2842250916 2842256784 137
80 iso_pu_bacteria 2842278818 2842281588 137
81 iso_pu_bacteria 2842285085 2842288712 137
82 iso_pu_bacteria 2842317721 2842321298 137
83 iso_pu_bacteria 2842402390 2842406621 137
84 iso_pu_bacteria 2842409023 2842412952 137
85 iso_pu_bacteria 2842415677 2842419595 137
86 iso_pu_bacteria 2842489311 2842495545 137
87 iso_pu_bacteria 2842495871 2842499064 137
88 iso_pu_bacteria 2842521101 2842527208 137
89 iso_pu_bacteria 2854916844 2854921500 137
90 iso_pu_bacteria 2857516855 2857518809 137
91 iso_pu_bacteria 2857531043 2857532824 137
92 iso_pu_bacteria 2889790730 2889795338 137
93 iso_pu_bacteria 2889914905 2889919367 137
94 iso_pu_bacteria 2913295892 2913298470 137
95 iso_pu_bacteria 2919100787 2919104664 137
96 iso_pu_bacteria 2933586486 2933589370 137
97 iso_pu_bacteria 2935901341 2935907459 137
98 iso_pu_bacteria 2936367885 2936374782 137
99 iso_pu_bacteria 2936375103 2936380474 137
100 iso_pu_bacteria 2937843397 2937847551 137
101 iso_pu_bacteria 2989349275 2989352014 137
102 iso_pu_bacteria 2996893221 2996894646 137
103 iso_pu_bacteria 3003930520 3003931304 137
104 iso_pu_bacteria 3005416602 3005417372 137
105 iso_pu_bacteria 3005445848 3005449370 137
106 iso_pu_bacteria 639633055 639650088 137
107 iso_pu_bacteria 8003400568 8003401068 137
108 iso_pu_bacteria 8005289223 8005294179 137
109 iso_pu_bacteria 8005301065 8005306593 137
110 iso_pu_bacteria 8005307578 8005309482 137
111 iso_pu_bacteria 8005314921 8005320380 137
112 iso_pu_bacteria 8005376324 8005378465 137
113 iso_pu_bacteria 8005382845 8005383756 137
114 iso_pu_bacteria 8005395548 8005401083 137
115 iso_pu_bacteria 8005430974 8005434037 137
116 iso_pu_bacteria 8005497431 8005501750 137
117 iso_pu_bacteria 8005542996 8005546996 137
118 iso_pu_bacteria 8005556819 8005559073 137
119 iso_pu_bacteria 8005563573 8005566869 137
120 iso_pu_bacteria 8005570704 8005574856 137
121 iso_pu_bacteria 8005619151 8005623104 137
122 iso_pu_bacteria 8005626139 8005631588 137
123 iso_pu_bacteria 8005668836 8005673172 137
124 iso_pu_bacteria 8005688590 8005693711 137
125 iso_pu_bacteria 8018163183 8018170311 137
126 iso_pu_bacteria 8023680758 8023687452 137
127 iso_pu_bacteria 8024479707 8024482036 137
128 iso_pu_bacteria 8024501048 8024505852 137
129 iso_pu_bacteria 8056382006 8056387109 137
130 iso_pu_bacteria 2513237150 2513957364 138
131 iso_pu_bacteria 2513237165 2514044738 138
132 iso_pu_bacteria 2643221683 2644468849 138
133 iso_pu_bacteria 644736347 644746489 138
134 3300049576 Ga0501040_0742398 Ga0501040_0742398_167_625 140
135 3300002773 JGI25152J39213_1016576 JGI25152J39213_10165762 141
136 3300002987 JGI25159J45721_1028542 JGI25159J45721_10285422 141
137 3300003187 JGI25151J46595_10001841 JGI25151J46595_100018418 141
138 3300003187 JGI25151J46595_10003849 JGI25151J46595_100038496 141
139 3300003214 JGI25165J46597_1004474 JGI25165J46597_10044742 141
140 3300003215 JGI25153J46596_10002450 JGI25153J46596_100024507 141
141 3300003316 rootH1_10070669 rootH1_100706692 141
142 3300003322 rootL2_10173186 rootL2_101731863 141
143 3300003354 JGI25160J50197_1001905 JGI25160J50197_100190510 141
144 3300003354 JGI25160J50197_1035407 JGI25160J50197_10354072 141
145 3300003374 JGI25161J50226_1002126 JGI25161J50226_10021262 141
146 3300003752 Ga0055539_1005935 Ga0055539_10059352 141
147 3300003771 Ga0055526_1000562 Ga0055526_10005628 141
148 3300003771 Ga0055526_1006015 Ga0055526_10060154 141
149 3300003771 Ga0055526_1015494 Ga0055526_10154941 141
150 3300003775 Ga0055524_1001572 Ga0055524_10015729 141
151 3300003775 Ga0055524_1006120 Ga0055524_10061205 141
152 3300003775 Ga0055524_1043490 Ga0055524_10434902 141
153 3300003790 Ga0055528_1000954 Ga0055528_10009544 141
154 3300003790 Ga0055528_1007348 Ga0055528_10073483 141
155 3300003790 Ga0055528_1020713 Ga0055528_10207132 141
156 3300003792 Ga0055540_1031352 Ga0055540_10313522 141
157 3300003794 Ga0055531_10110726 Ga0055531_101107261 141
158 3300004625 Ga0055543_1000650 Ga0055543_100065018 141
159 3300005262 Ga0065165_1013893 Ga0065165_10138935 141
160 3300005262 Ga0065165_1068144 Ga0065165_10681441 141
161 3300005353 Ga0070669_100288796 Ga0070669_1002887961 141
162 3300005367 Ga0070667_100020712 Ga0070667_1000207123 141
163 3300005455 Ga0070663_101206172 Ga0070663_1012061721 141
164 3300005548 Ga0070665_100072449 Ga0070665_1000724491 141
165 3300005548 Ga0070665_100963470 Ga0070665_1009634702 141
166 3300005563 Ga0068855_100046688 Ga0068855_1000466885 141
167 3300005578 Ga0068854_100008048 Ga0068854_1000080485 141
168 3300005616 Ga0068852_100278348 Ga0068852_1002783483 141
169 3300006048 Ga0075363_100011984 Ga0075363_1000119842 141
170 3300006048 Ga0075363_100204109 Ga0075363_1002041092 141
171 3300006051 Ga0075364_11051895 Ga0075364_110518952 141
172 3300006178 Ga0075367_10002604 Ga0075367_100026044 141
173 3300006178 Ga0075367_10430070 Ga0075367_104300701 141
174 3300006186 Ga0075369_10005260 Ga0075369_100052604 141
175 3300006186 Ga0075369_10177077 Ga0075369_101770772 141
176 3300006186 Ga0075369_10636059 Ga0075369_106360591 141
177 3300006195 Ga0075366_10003470 Ga0075366_100034708 141
178 3300006195 Ga0075366_10095246 Ga0075366_100952463 141
179 3300006353 Ga0075370_10034592 Ga0075370_100345922 141
180 3300006353 Ga0075370_10494401 Ga0075370_104944012 141
181 3300006946 Ga0079104_1000063 Ga0079104_100006310 141
182 3300009093 Ga0105240_10000012 Ga0105240_10000012408 141
183 3300009545 Ga0105237_10001271 Ga0105237_1000127124 141
184 3300010375 Ga0105239_10005397 Ga0105239_1000539712 141
185 3300013100 Ga0157373_10257941 Ga0157373_102579412 141
186 3300013104 Ga0157370_10001804 Ga0157370_1000180419 141
187 3300013104 Ga0157370_11414701 Ga0157370_114147012 141
188 3300013105 Ga0157369_11331926 Ga0157369_113319261 141
189 3300014497 Ga0182008_10017425 Ga0182008_100174253 141
190 3300015262 Ga0182007_10009304 Ga0182007_100093043 141
191 3300015265 Ga0182005_1003228 Ga0182005_10032284 141
192 3300021320 Ga0214544_1000652 Ga0214544_100065217 141
193 3300021321 Ga0214542_1000146 Ga0214542_100014679 141
194 3300021327 Ga0214543_1000054 Ga0214543_100005417 141
195 3300025245 Ga0207425_1003975 Ga0207425_10039755 141
196 3300025245 Ga0207425_1042258 Ga0207425_10422581 141
197 3300025253 Ga0209677_100556 Ga0209677_1005565 141
198 3300025258 Ga0209129_1000203 Ga0209129_100020355 141
199 3300025258 Ga0209129_1000568 Ga0209129_100056826 141
200 3300025258 Ga0209129_1031523 Ga0209129_10315232 141
201 3300025261 Ga0209233_1000161 Ga0209233_100016158 141
202 3300025273 Ga0209673_1000037 Ga0209673_100003751 141
203 3300025273 Ga0209673_1000670 Ga0209673_100067041 141
204 3300025273 Ga0209673_1005902 Ga0209673_10059024 141
205 3300025273 Ga0209673_1011858 Ga0209673_10118585 141
206 3300025273 Ga0209673_1077315 Ga0209673_10773151 141
207 3300025284 Ga0209130_1002110 Ga0209130_10021102 141
208 3300025291 Ga0209675_1001738 Ga0209675_10017387 141
209 3300025292 Ga0209676_1044315 Ga0209676_10443152 141
210 3300025292 Ga0209676_1059260 Ga0209676_10592601 141
211 3300025294 Ga0209025_1000354 Ga0209025_100035454 141
212 3300025294 Ga0209025_1000566 Ga0209025_100056656 141
213 3300025294 Ga0209025_1031713 Ga0209025_10317132 141
214 3300025294 Ga0209025_1052349 Ga0209025_10523492 141
215 3300025294 Ga0209025_1073252 Ga0209025_10732522 141
216 3300025295 Ga0209564_1000207 Ga0209564_100020763 141
217 3300025295 Ga0209564_1000379 Ga0209564_10003797 141
218 3300025297 Ga0209758_1000674 Ga0209758_10006747 141
219 3300025297 Ga0209758_1004194 Ga0209758_10041948 141
220 3300025297 Ga0209758_1017850 Ga0209758_10178504 141
221 3300025297 Ga0209758_1068919 Ga0209758_10689192 141
222 3300025299 Ga0209256_1000758 Ga0209256_100075818 141
223 3300025299 Ga0209256_1001345 Ga0209256_100134524 141
224 3300025299 Ga0209256_1001773 Ga0209256_10017734 141
225 3300025299 Ga0209256_1006537 Ga0209256_10065375 141
226 3300025302 Ga0207426_1000296 Ga0207426_100029654 141
227 3300025302 Ga0207426_1000474 Ga0207426_100047411 141
228 3300025302 Ga0207426_1110173 Ga0207426_11101731 141
229 3300025303 Ga0209051_1007062 Ga0209051_10070623 141
230 3300025303 Ga0209051_1033281 Ga0209051_10332811 141
231 3300025303 Ga0209051_1040409 Ga0209051_10404092 141
232 3300025303 Ga0209051_1048253 Ga0209051_10482532 141
233 3300025913 Ga0207695_10000097 Ga0207695_10000097200 141
234 3300025914 Ga0207671_10000289 Ga0207671_1000028946 141
235 3300025923 Ga0207681_10239778 Ga0207681_102397782 141
236 3300025924 Ga0207694_11050778 Ga0207694_110507782 141
237 3300025986 Ga0207658_10036414 Ga0207658_100364144 141
238 3300027111 Ga0209281_1000110 Ga0209281_100011010 141
239 3300027866 Ga0209813_10026714 Ga0209813_100267142 141
240 3300028379 Ga0268266_11182979 Ga0268266_111829792 141
241 3300028379 Ga0268266_11348678 Ga0268266_113486781 141
242 3300028556 Ga0265337_1019994 Ga0265337_10199942 141
243 3300028558 Ga0265326_10010068 Ga0265326_100100681 141
244 3300028573 Ga0265334_10003173 Ga0265334_100031733 141
245 3300028653 Ga0265323_10003552 Ga0265323_100035526 141
246 3300028666 Ga0265336_10000104 Ga0265336_1000010415 141
247 3300028794 Ga0307515_10000285 Ga0307515_1000028543 141
248 3300028794 Ga0307515_10027939 Ga0307515_100279398 141
249 3300028794 Ga0307515_10315337 Ga0307515_103153372 141
250 3300028800 Ga0265338_10000137 Ga0265338_1000013713 141
251 3300031456 Ga0307513_10436181 Ga0307513_104361812 141
252 3300031548 Ga0307408_100036635 Ga0307408_1000366352 141
253 3300031731 Ga0307405_11483338 Ga0307405_114833381 141
254 3300031824 Ga0307413_10727427 Ga0307413_107274272 141
255 3300031852 Ga0307410_10432208 Ga0307410_104322082 141
256 3300031901 Ga0307406_10003654 Ga0307406_100036549 141
257 3300031901 Ga0307406_10025129 Ga0307406_100251292 141
258 3300031995 Ga0307409_100138223 Ga0307409_1001382232 141
259 3300041404 Ga0439436_0019228 Ga0439436_0019228_1573_2025 141
260 3300041404 Ga0439436_0069911 Ga0439436_0069911_83_508 141
261 3300041404 Ga0439436_0168031 Ga0439436_0168031_142_576 141
262 3300041406 Ga0439439_0014957 Ga0439439_0014957_34_504 141
263 3300041407 Ga0439447_045362 Ga0439447_045362_44_472 141
264 3300041411 Ga0439466_0141204 Ga0439466_0141204_267_701 141
265 3300041413 Ga0439465_0017320 Ga0439465_0017320_1670_2095 141
266 3300041413 Ga0439465_0058018 Ga0439465_0058018_123_548 141
267 3300041456 Ga0451795_0431751 Ga0451795_0431751_171_596 141
268 3300041460 Ga0451802_1417467 Ga0451802_1417467_63_491 141
269 3300041491 Ga0451833_0058447 Ga0451833_0058447_164_589 141
270 3300041491 Ga0451833_0423803 Ga0451833_0423803_661_1086 141
271 3300041492 Ga0451835_0025022 Ga0451835_0025022_624_1049 141
272 3300041492 Ga0451835_0587763 Ga0451835_0587763_16_441 141
273 3300041494 Ga0451837_1195521 Ga0451837_1195521_119_571 141
274 3300041494 Ga0451837_1313381 Ga0451837_1313381_230_655 141
275 3300041496 Ga0451839_0865211 Ga0451839_0865211_382_807 141
276 3300041498 Ga0451841_1207741 Ga0451841_1207741_44_469 141
277 3300041501 Ga0451845_0189690 Ga0451845_0189690_2862_3287 141
278 3300041503 Ga0451847_0407225 Ga0451847_0407225_1741_2166 141
279 3300041505 Ga0451849_1528707 Ga0451849_1528707_902_1327 141
280 3300041507 Ga0451851_0631607 Ga0451851_0631607_673_1098 141
281 3300041509 Ga0451843_0272987 Ga0451843_0272987_677_1129 141
282 3300041511 Ga0451855_0989568 Ga0451855_0989568_649_1074 141
283 3300041511 Ga0451855_2042030 Ga0451855_2042030_957_1382 141
284 3300041512 Ga0451853_2899099 Ga0451853_2899099_663_1088 141
285 3300041997 Ga0439431_0169816 Ga0439431_0169816_91_543 141
286 3300042002 Ga0439442_150485 Ga0439442_150485_10_435 141
287 3300042004 Ga0439445_0170174 Ga0439445_0170174_57_509 141
288 3300042007 Ga0439449_0145376 Ga0439449_0145376_194_619 141
289 3300042010 Ga0439452_075985 Ga0439452_075985_197_622 141
290 3300042010 Ga0439452_090676 Ga0439452_090676_108_560 141
291 3300042122 Ga0450920_033874 Ga0450920_033874_369_794 141
292 3300042145 Ga0450906_010034 Ga0450906_010034_198_650 141
293 3300042531 Ga0450918_000905 Ga0450918_000905_3321_3773 141
294 3300046460 Ga0495638_0119641 Ga0495638_0119641_413_838 141
295 3300046460 Ga0495638_0284755 Ga0495638_0284755_71_496 141
296 3300046460 Ga0495638_0534139 Ga0495638_0534139_41_466 141
297 3300046471 Ga0495650_0045045 Ga0495650_0045045_1251_1676 141
298 3300046471 Ga0495650_0105142 Ga0495650_0105142_82_507 141
299 3300046474 Ga0495605_0015928 Ga0495605_0015928_2334_2759 141
300 3300046492 Ga0495585_0073155 Ga0495585_0073155_892_1317 141
301 3300046492 Ga0495585_0090720 Ga0495585_0090720_119_544 141
302 3300046506 Ga0495583_0046252 Ga0495583_0046252_942_1367 141
303 3300046507 Ga0495606_0037728 Ga0495606_0037728_204_629 141
304 3300046507 Ga0495606_0044419 Ga0495606_0044419_884_1309 141
305 3300046512 Ga0495610_0019160 Ga0495610_0019160_1304_1729 141
306 3300046512 Ga0495610_0084029 Ga0495610_0084029_223_648 141
307 3300046512 Ga0495610_0220437 Ga0495610_0220437_282_707 141
308 3300046513 Ga0495616_0034897 Ga0495616_0034897_2153_2578 141
309 3300046515 Ga0495620_0056393 Ga0495620_0056393_246_671 141
310 3300046519 Ga0495632_0060127 Ga0495632_0060127_1234_1659 141
311 3300046522 Ga0495643_0052037 Ga0495643_0052037_1168_1593 141
312 3300046522 Ga0495643_0067686 Ga0495643_0067686_946_1371 141
313 3300046524 Ga0495648_0109684 Ga0495648_0109684_43_468 141
314 3300046538 Ga0495609_0086479 Ga0495609_0086479_754_1179 141
315 3300046558 Ga0495633_0007601 Ga0495633_0007601_2159_2584 141
316 3300046558 Ga0495633_0057257 Ga0495633_0057257_814_1239 141
317 3300046615 Ga0495656_0441287 Ga0495656_0441287_87_512 141
318 3300046660 Ga0495625_0037308 Ga0495625_0037308_2883_3308 141
319 3300046660 Ga0495625_0065573 Ga0495625_0065573_676_1101 141
320 3300046674 Ga0495588_0085400 Ga0495588_0085400_555_980 141
321 3300046691 Ga0495670_0038029 Ga0495670_0038029_1470_1895 141
322 3300046694 Ga0495649_0026554 Ga0495649_0026554_204_629 141
323 3300046694 Ga0495649_0214823 Ga0495649_0214823_298_723 141
324 3300046810 Ga0495660_0169450 Ga0495660_0169450_106_531 141
325 3300047320 Ga0495672_0528807 Ga0495672_0528807_36_497 141
326 3300047323 Ga0495683_0262811 Ga0495683_0262811_99_524 141
327 3300047447 Ga0495685_080747 Ga0495685_080747_18_443 141
328 3300047469 Ga0495673_0153688 Ga0495673_0153688_212_637 141
329 3300047472 Ga0495686_0031679 Ga0495686_0031679_2888_3313 141
330 3300048090 Ga0495615_0009826 Ga0495615_0009826_89_514 141
331 3300048903 Ga0496100_0242040 Ga0496100_0242040_323_763 141
332 3300048904 Ga0496101_0092727 Ga0496101_0092727_1263_1694 141
333 3300048906 Ga0496103_0047279 Ga0496103_0047279_1132_1572 141
334 3300048909 Ga0496106_0003583 Ga0496106_0003583_4528_4953 141
335 3300048909 Ga0496106_0128093 Ga0496106_0128093_518_949 141
336 3300048909 Ga0496106_0156112 Ga0496106_0156112_1074_1499 141
337 3300048910 Ga0496107_0070478 Ga0496107_0070478_1905_2330 141
338 3300048916 Ga0496113_0127353 Ga0496113_0127353_818_1258 141
339 3300048916 Ga0496113_1315248 Ga0496113_1315248_93_518 141
340 3300048917 Ga0496114_0109193 Ga0496114_0109193_1233_1658 141
341 3300048919 Ga0496116_0016495 Ga0496116_0016495_4319_4744 141
342 3300048919 Ga0496116_0030810 Ga0496116_0030810_2851_3291 141
343 3300048919 Ga0496116_0359465 Ga0496116_0359465_220_645 141
344 3300048920 Ga0496117_0483545 Ga0496117_0483545_134_559 141
345 3300048921 Ga0496118_0006891 Ga0496118_0006891_5851_6291 141
346 3300048921 Ga0496118_0014905 Ga0496118_0014905_3377_3802 141
347 3300048922 Ga0496119_0089645 Ga0496119_0089645_938_1369 141
348 3300048923 Ga0496120_0019402 Ga0496120_0019402_559_990 141
349 3300048924 Ga0496121_0010414 Ga0496121_0010414_152_601 141
350 3300048924 Ga0496121_0011115 Ga0496121_0011115_4796_5221 141
351 3300048924 Ga0496121_0036881 Ga0496121_0036881_1715_2146 141
352 3300048924 Ga0496121_0110756 Ga0496121_0110756_793_1218 141
353 3300048924 Ga0496121_0568675 Ga0496121_0568675_214_639 141
354 3300048925 Ga0496122_0010611 Ga0496122_0010611_3030_3470 141
355 3300048925 Ga0496122_0267392 Ga0496122_0267392_135_560 141
356 3300048926 Ga0496123_0003695 Ga0496123_0003695_3148_3588 141
357 3300048926 Ga0496123_0021755 Ga0496123_0021755_4436_4861 141
358 3300048926 Ga0496123_0168276 Ga0496123_0168276_432_857 141
359 3300048927 Ga0496124_0007502 Ga0496124_0007502_4466_4897 141
360 3300048927 Ga0496124_0014927 Ga0496124_0014927_747_1196 141
361 3300048928 Ga0496125_0022386 Ga0496125_0022386_4142_4582 141
362 3300048928 Ga0496125_0614801 Ga0496125_0614801_43_468 141
363 3300048929 Ga0496126_0000522 Ga0496126_0000522_47432_47857 141
364 3300048929 Ga0496126_0012811 Ga0496126_0012811_2976_3428 141
365 3300048929 Ga0496126_0156564 Ga0496126_0156564_1127_1567 141
366 3300048929 Ga0496126_0386811 Ga0496126_0386811_612_1037 141
367 3300048929 Ga0496126_1021689 Ga0496126_1021689_46_480 141
368 3300049571 Ga0501034_0107266 Ga0501034_0107266_1793_2218 141
369 3300049579 Ga0501043_0556925 Ga0501043_0556925_70_495 141
370 3300049586 Ga0501070_0540242 Ga0501070_0540242_496_921 141
371 3300049671 Ga0501238_055607 Ga0501238_055607_66_515 141
372 3300049776 Ga0501280_001541 Ga0501280_001541_1380_1832 141
373 3300050489 nmdc:mga03683_1842_c1 nmdc:mga03683_1842_c1_1153_1578 141
374 3300050490 nmdc:mga03n38_111186_c1 nmdc:mga03n38_111186_c1_127_552 141
375 3300050490 nmdc:mga03n38_584122_c1 nmdc:mga03n38_584122_c1_55_480 141
376 3300050492 nmdc:mga0yw44_13340_c1 nmdc:mga0yw44_13340_c1_810_1235 141
377 3300050493 nmdc:mga0k408_4827_c1 nmdc:mga0k408_4827_c1_5032_5457 141
378 3300050494 nmdc:mga06z11_14133_c1 nmdc:mga06z11_14133_c1_1153_1578 141
379 3300050495 nmdc:mga04h51_9894_c1 nmdc:mga04h51_9894_c1_2063_2488 141
380 3300050496 nmdc:mga07m45_5581_c1 nmdc:mga07m45_5581_c1_2889_3314 141
381 3300050516 nmdc:mga0sz30_4147_c1 nmdc:mga0sz30_4147_c1_2504_2929 141
382 3300053086 Ga0500578_0107158 Ga0500578_0107158_581_1006 141
383 3300053088 Ga0500644_0102723 Ga0500644_0102723_542_967 141
384 3300053134 Ga0500658_0006087 Ga0500658_0006087_939_1364 141
385 3300053134 Ga0500658_0007038 Ga0500658_0007038_721_1146 141
386 3300053135 Ga0500659_0229825 Ga0500659_0229825_377_802 141
387 3300053139 Ga0500568_0002693 Ga0500568_0002693_3233_3712 141
388 3300053156 Ga0500622_0001576 Ga0500622_0001576_12729_13154 141
389 3300053158 Ga0500627_0080689 Ga0500627_0080689_149_574 141
390 3300053160 Ga0500633_0000642 Ga0500633_0000642_3062_3487 141
391 3300053177 Ga0500636_0000119 Ga0500636_0000119_1864_2289 141
392 3300002773 JGI25152J39213_1003306 JGI25152J39213_10033065 142
393 3300002774 JGI25150J39212_1002023 JGI25150J39212_10020232 142
394 3300002987 JGI25159J45721_1006082 JGI25159J45721_10060824 142
395 3300003187 JGI25151J46595_10006423 JGI25151J46595_100064236 142
396 3300003215 JGI25153J46596_10006473 JGI25153J46596_100064736 142
397 3300003320 rootH2_10096900 rootH2_100969001 142
398 3300003354 JGI25160J50197_1009417 JGI25160J50197_10094172 142
399 3300003374 JGI25161J50226_1003374 JGI25161J50226_10033744 142
400 3300003771 Ga0055526_1012689 Ga0055526_10126892 142
401 3300003773 Ga0055537_1005017 Ga0055537_10050174 142
402 3300003775 Ga0055524_1010658 Ga0055524_10106582 142
403 3300003781 Ga0055536_1000729 Ga0055536_100072921 142
404 3300003784 Ga0055534_1002865 Ga0055534_10028656 142
405 3300003790 Ga0055528_1011000 Ga0055528_10110004 142
406 3300003792 Ga0055540_1000874 Ga0055540_100087420 142
407 3300004625 Ga0055543_1001944 Ga0055543_10019447 142
408 3300005262 Ga0065165_1005274 Ga0065165_10052742 142
409 3300005339 Ga0070660_100580907 Ga0070660_1005809072 142
410 3300005563 Ga0068855_100045008 Ga0068855_1000450082 142
411 3300005577 Ga0068857_100636423 Ga0068857_1006364232 142
412 3300006051 Ga0075364_10066973 Ga0075364_100669732 142
413 3300006948 Ga0099826_10000039 Ga0099826_1000003990 142
414 3300009011 Ga0105251_10109610 Ga0105251_101096102 142
415 3300009036 Ga0105244_10040463 Ga0105244_100404633 142
416 3300009148 Ga0105243_10000875 Ga0105243_100008752 142
417 3300009545 Ga0105237_11470249 Ga0105237_114702492 142
418 3300010375 Ga0105239_10079004 Ga0105239_100790045 142
419 3300013100 Ga0157373_11219558 Ga0157373_112195581 142
420 3300013104 Ga0157370_11168103 Ga0157370_111681031 142
421 3300013105 Ga0157369_10004268 Ga0157369_100042685 142
422 3300013307 Ga0157372_10794576 Ga0157372_107945761 142
423 3300025208 Ga0209436_109717 Ga0209436_1097172 142
424 3300025245 Ga0207425_1000180 Ga0207425_10001807 142
425 3300025258 Ga0209129_1000111 Ga0209129_1000111150 142
426 3300025263 Ga0209565_1000110 Ga0209565_100011062 142
427 3300025273 Ga0209673_1000426 Ga0209673_100042612 142
428 3300025284 Ga0209130_1000205 Ga0209130_100020562 142
429 3300025291 Ga0209675_1000192 Ga0209675_100019248 142
430 3300025292 Ga0209676_1000484 Ga0209676_100048437 142
431 3300025294 Ga0209025_1000116 Ga0209025_1000116158 142
432 3300025295 Ga0209564_1000155 Ga0209564_1000155158 142
433 3300025297 Ga0209758_1000107 Ga0209758_1000107158 142
434 3300025299 Ga0209256_1000087 Ga0209256_1000087158 142
435 3300025302 Ga0207426_1000123 Ga0207426_1000123158 142
436 3300025302 Ga0207426_1064804 Ga0207426_10648042 142
437 3300025303 Ga0209051_1000636 Ga0209051_10006362 142
438 3300025303 Ga0209051_1037257 Ga0209051_10372572 142
439 3300025304 Ga0209257_1006616 Ga0209257_10066162 142
440 3300025304 Ga0209257_1016240 Ga0209257_10162402 142
441 3300025913 Ga0207695_10366754 Ga0207695_103667542 142
442 3300025924 Ga0207694_10668560 Ga0207694_106685602 142
443 3300025935 Ga0207709_10000389 Ga0207709_1000038930 142
444 3300025949 Ga0207667_10082349 Ga0207667_100823492 142
445 3300027666 Ga0209282_1000058 Ga0209282_100005890 142
446 3300031731 Ga0307405_10025479 Ga0307405_100254793 142
447 3300031731 Ga0307405_10100910 Ga0307405_101009102 142
448 3300032005 Ga0307411_10096263 Ga0307411_100962633 142
449 3300046458 Ga0495591_123417 Ga0495591_123417_45_473 142
450 3300046474 Ga0495605_0122411 Ga0495605_0122411_121_549 142
451 3300046500 Ga0495596_0000738 Ga0495596_0000738_14330_14758 142
452 3300046501 Ga0495607_0008050 Ga0495607_0008050_5298_5726 142
453 3300046512 Ga0495610_0002945 Ga0495610_0002945_7241_7669 142
454 3300046513 Ga0495616_0037836 Ga0495616_0037836_187_615 142
455 3300046522 Ga0495643_0446863 Ga0495643_0446863_50_481 142
456 3300046538 Ga0495609_0000943 Ga0495609_0000943_14375_14803 142
457 3300046542 Ga0495597_0188362 Ga0495597_0188362_313_741 142
458 3300046615 Ga0495656_0367284 Ga0495656_0367284_279_707 142
459 3300046665 Ga0495661_0010519 Ga0495661_0010519_193_621 142
460 3300046692 Ga0495671_0001086 Ga0495671_0001086_15683_16114 142
461 3300046694 Ga0495649_0011484 Ga0495649_0011484_568_999 142
462 3300047320 Ga0495672_0002271 Ga0495672_0002271_8458_8886 142
463 3300047469 Ga0495673_0067724 Ga0495673_0067724_363_791 142
464 3300048919 Ga0496116_0014321 Ga0496116_0014321_5380_5808 142
465 3300048919 Ga0496116_0324914 Ga0496116_0324914_102_530 142
466 3300048924 Ga0496121_0005527 Ga0496121_0005527_14442_14870 142
467 3300048925 Ga0496122_0015579 Ga0496122_0015579_1320_1748 142
468 3300048925 Ga0496122_0256138 Ga0496122_0256138_308_763 142
469 3300048926 Ga0496123_0002314 Ga0496123_0002314_23341_23769 142
470 3300048927 Ga0496124_0146774 Ga0496124_0146774_253_684 142
471 3300048927 Ga0496124_0617528 Ga0496124_0617528_237_668 142
472 3300048928 Ga0496125_0085958 Ga0496125_0085958_1061_1489 142
473 3300048929 Ga0496126_0583990 Ga0496126_0583990_193_621 142
474 3300049571 Ga0501034_0010344 Ga0501034_0010344_8821_9249 142
475 3300049571 Ga0501034_0490021 Ga0501034_0490021_415_867 142
476 3300050491 nmdc:mga00v17_37735_c2 nmdc:mga00v17_37735_c2_760_1188 142
477 iso_pu_bacteria 2599185214 2599625998 142
478 iso_pu_bacteria 2599185226 2599674920 142
479 iso_pu_bacteria 2599185227 2599683814 142
480 iso_pu_bacteria 2599185229 2599695583 142
481 iso_pu_bacteria 2928070936 2928076230 142

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

24

139

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3vcx-assembly1.cif.gz_A crystal structure of a putative glyoxalase/bleomycin resistance protein from rhodopseudomonas palustris cga009 0.9747 4 125
3vcx-assembly1.cif.gz_B crystal structure of a putative glyoxalase/bleomycin resistance protein from rhodopseudomonas palustris cga009 0.9616 3 125
3vcx-assembly1.cif.gz_B crystal structure of a putative glyoxalase/bleomycin resistance protein from rhodopseudomonas palustris cga009 0.9538 3 125
3vcx-assembly1.cif.gz_A crystal structure of a putative glyoxalase/bleomycin resistance protein from rhodopseudomonas palustris cga009 0.9435 4 125
2i7r-assembly1.cif.gz_B conserved domain protein 0.8793 3 124
ID Description Score Start End Superfamily
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9814 71 121 3.30.720.110
3vcxB01 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9493 3 55 3.30.720.120
3vcxB01 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9318 3 55 3.30.720.120
3itwB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.93 72 122 3.30.720.110
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9242 71 121 3.30.720.110
ID Description Score Start End GO Terms
AF-A0A1N6CYU6-F1-model_v4 Glyoxalase-like domain-containing protein 0.9905 1 135
AF-A0A420A7B3-F1-model_v4 deleted 0.9895 1 142
AF-A0A4Q2S6J7-F1-model_v4 Glyoxalase 0.9888 1 142
AF-A0A2Z3GG18-F1-model_v4 deleted 0.9886 1 142
AF-A0A5R8Y9J3-F1-model_v4 Glyoxalase 0.988 1 142

Feature Viewer

pLDDT pTM Quality
94.6 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map